slc7a-8

Overview
Nameslc7a-8 (AKN21452.1)
Smed IDSMED30000850
Length (bp)1551
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc7a-8 (SMED30000850) t-SNE clustered cells

Violin plots show distribution of expression levels for slc7a-8 (SMED30000850) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc7a-8 (SMED30000850) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc7a-8 (SMED30000850) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000850

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 3 cellSMED30000850SMESG000006721.1 SmedASXL_001816SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30000850SMESG000006721.1 SmedASXL_001816SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30000850SMESG000006721.1 dd_Smed_v4_12027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000850SMESG000006721.1 dd_Smed_v4_12027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000850SMESG000006721.1 dd_Smed_v4_12027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000850SMESG000006721.1 dd_Smed_v4_12027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000850SMESG000006721.1 dd_Smed_v4_12027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000850SMESG000006721.1 Contig48745newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000850SMESG000006721.1 Contig48745uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
glial cellSMED30000850SMESG000006721.1 dd_Smed_v6_12027_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30000850SMESG000006721.1 dd_Smed_v4_12027_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc7a-8 vs. Ensembl Human
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 317.005 bits (811), Expect = 6.060e-102
Identity = 207/470 (44.04%), Postives = 302/470 (64.26%), Query Frame = 3
Query:   93 HTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKE 1502
               ++L++ + + +G+ IIIG IIG+GIF+SP GVL+ T SVGMS+ +W +CG+ S  G++ YAELG TI KSGG Y YILE FGPL AF+ +W+  + I   + A  SL F +YIL+P F  C+IP  A+ L+  +G+  +  +N  SV W+ R  +F T  K+ A+LIIIV G  +L +G   +F D F+  ++S   L LAFY G +AYAGW YLNF+T E+ NP + +P+AI  S+ IVT+ YV TN+AY   ++  E+L     S AVAV F+++ +G FS  +PIFV  S FGSMNG   +VSRL Y A+ +GHLPE L+M+ ++  TP+PAVI L  L+++  F+  +  L+    F+  +  G+AV+ LIYLR KCP++ R FK+PL +P +F    LF+  L++Y  P  + IG  I   G+P Y +F++W  KP+    ++E +T  +Q    VVPEE +
Sbjct:   35 QEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELL----LSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDK 500          
BLAST of slc7a-8 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 262.692 bits (670), Expect = 7.883e-81
Identity = 194/479 (40.50%), Postives = 292/479 (60.96%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSL--IGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK------TFLVVPEEKEN*YK 1514
            ++L+K I +  G+ +++G +IGSGIFVSP GVL +T S GMS+I+W + GLFS +G++ YAELG TI KSG  Y YILE+FG   AFI +W++ + +     A  ++ FA YI+QP F SCD P  A  L+    +  +  +NC  VKW TR    FT +KV+AL+ IIV+G  KL +G+   F D F  S+   G+L+LA Y   ++Y+GW+ LNF+T E+ NP RNLP+AI  S+ IVT+IY+ TN+AY  VL+  ++L     S AVAV FADQT GMFS  +PI V  S FG +N    + SRL +  + +GHLP+ L+M+ I+  TP+PA++F   +++++     +  LI    FS+    G++V   +YLR K P  PR  KL +  PI+F +  +F+ I+ ++    +SL  IG+A+  +      +++    +P  + N+  ++T   Q+      T L V EEK++  K
Sbjct:   39 MQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLS----SDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVLTELDVAEEKKDERK 513          
BLAST of slc7a-8 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 262.692 bits (670), Expect = 7.883e-81
Identity = 194/479 (40.50%), Postives = 292/479 (60.96%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSL--IGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK------TFLVVPEEKEN*YK 1514
            ++L+K I +  G+ +++G +IGSGIFVSP GVL +T S GMS+I+W + GLFS +G++ YAELG TI KSG  Y YILE+FG   AFI +W++ + +     A  ++ FA YI+QP F SCD P  A  L+    +  +  +NC  VKW TR    FT +KV+AL+ IIV+G  KL +G+   F D F  S+   G+L+LA Y   ++Y+GW+ LNF+T E+ NP RNLP+AI  S+ IVT+IY+ TN+AY  VL+  ++L     S AVAV FADQT GMFS  +PI V  S FG +N    + SRL +  + +GHLP+ L+M+ I+  TP+PA++F   +++++     +  LI    FS+    G++V   +YLR K P  PR  KL +  PI+F +  +F+ I+ ++    +SL  IG+A+  +      +++    +P  + N+  ++T   Q+      T L V EEK++  K
Sbjct:   39 MQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLS----SDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVLTELDVAEEKKDERK 513          
BLAST of slc7a-8 vs. Ensembl Human
Match: SLC7A5 (solute carrier family 7 member 5 [Source:HGNC Symbol;Acc:HGNC:11063])

HSP 1 Score: 259.996 bits (663), Expect = 6.017e-80
Identity = 205/468 (43.80%), Postives = 301/468 (64.32%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDP---FADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            + LQ++I +  G+ II+G IIGSGIFV+P GVLK   S G+++++W  CG+FS +G++ YAELG TI KSGG+Y Y+LE +G L AF+ +WI  + I   S    +L+FA Y+L+PLF +C +P  A  LV  L +  + A+NCYSVK ATR    F  +K+LAL +II++GF ++ +G+V S  DP   F  +    G++ LA Y G +AY GWNYLNF+T EMINP RNLP+AII SL IVT++YV TN+AY   LS  +ML     S AVAV F +  +G+ S ++P+FVG S FGS+NG   + SRL +  + +GHLP  L+M+  + LTP+P+++F   +++++ F+  I  +I    F   +   +A+  +I+LR + P L R  K+ L LP+ F+L  LF+  ++ ++ P +  IG  II  G+P+Y   V WK+KPK +     S T+  QK   VVP+E
Sbjct:   44 VTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGDV-SNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTLSTEQMLS----SEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQE 506          
BLAST of slc7a-8 vs. Ensembl Human
Match: SLC7A8 (solute carrier family 7 member 8 [Source:HGNC Symbol;Acc:HGNC:11066])

HSP 1 Score: 258.455 bits (659), Expect = 5.017e-79
Identity = 176/439 (40.09%), Postives = 272/439 (61.96%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSN-TSP--GSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            L+   SVG+++I+W++ G  + +G++ YAELGVTIPKSGG+Y Y+ + FG L+ F+ +WI  + I   + A  +L F+ Y+LQPLF +C  P S L L+  + L  +  +NC SV+WATR    FT  K+LAL +II++G  ++ +G         A  N   P  G +ALAF QG +AY GWN+LN++T E+++P +NLP AI  S+ +VT +YV  N+AY+  +SP+E+L     S AVAV F ++ +G+ + +MPI V  S FG +NG   + SRL +  A +GHLP  LAM+ +K  TP+PA++F    +++   T  +  LI   GF   +  G+ V+  I LR K P++PR  K+ L+ PI++LL   F+ + +++ +P    IG+AI+  G+P+Y + V W+ KPK  ++  E LT+  QK  +VV  E E 
Sbjct:   66 LENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELL----ASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVER 500          
BLAST of slc7a-8 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 263.462 bits (672), Expect = 7.384e-82
Identity = 204/479 (42.59%), Postives = 300/479 (62.63%), Query Frame = 3
Query:   90 NHTDIK---LQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVL---SFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISY-LIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            N T+ K   L+KS+ +F G+ +I+G IIGSGIFVSP GV +   SVG+S+I+W++ G+F+A+G+  YAELG  I KSGG+Y YI+E+FGP  AFI +WI  + +   ++   +L FA Y L+P F  C  P+    L+ +L +  + AINC SV+ AT    +FTI+KV+AL +II+ G   LF G      SF + F +++     ++LAFY G +AY+GWN+LNF+  E+ NP RNLP+AI  S+T  TVIYV TN+A    +SP EMLE    S AVAV+FA++  G F+ +MP+ V  S  GS NG   + +RL Y+ A +G +P  L M++ K  TP+PAVI   ALS+ +       Y LI     S+ +  G A++ L +LR   P+  R  K+PL+ P +FL   + + ++ +   P D+ IG+ I+   +P+Y IF+ WK+KPK      +S T++IQK F+VV E+KE+
Sbjct:   19 NETEGKGKGLEKSLTLFNGVSMIVGCIIGSGIFVSPTGVQEQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEMLE----SPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVVDEDKED 493          
BLAST of slc7a-8 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 263.462 bits (672), Expect = 7.384e-82
Identity = 204/479 (42.59%), Postives = 300/479 (62.63%), Query Frame = 3
Query:   90 NHTDIK---LQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVL---SFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISY-LIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            N T+ K   L+KS+ +F G+ +I+G IIGSGIFVSP GV +   SVG+S+I+W++ G+F+A+G+  YAELG  I KSGG+Y YI+E+FGP  AFI +WI  + +   ++   +L FA Y L+P F  C  P+    L+ +L +  + AINC SV+ AT    +FTI+KV+AL +II+ G   LF G      SF + F +++     ++LAFY G +AY+GWN+LNF+  E+ NP RNLP+AI  S+T  TVIYV TN+A    +SP EMLE    S AVAV+FA++  G F+ +MP+ V  S  GS NG   + +RL Y+ A +G +P  L M++ K  TP+PAVI   ALS+ +       Y LI     S+ +  G A++ L +LR   P+  R  K+PL+ P +FL   + + ++ +   P D+ IG+ I+   +P+Y IF+ WK+KPK      +S T++IQK F+VV E+KE+
Sbjct:   19 NETEGKGKGLEKSLTLFNGVSMIVGCIIGSGIFVSPTGVQEQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEMLE----SPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVVDEDKED 493          
BLAST of slc7a-8 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 259.225 bits (661), Expect = 3.533e-80
Identity = 198/473 (41.86%), Postives = 289/473 (61.10%), Query Frame = 3
Query:   99 DIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGN---VLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVI-FLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            D  L+K++ +F G+ II+G IIGSGIF+SP G+     SVG+S+I+WVL GLF+ +G+  YAELG  I KSGG+Y YI+E+FGP  AF+ +WI  + +   +    +L FA Y+L+P +  CD P  +  L+  L L  + A+NC SVKWA++   FF ++K  AL++II  G + +  G      SF + F ++     + +LAFY G +AY GWNYLNF+  E+ NP RNLP++I  S ++ T+IY  TN+A    ++P EML     S AVAV+FA++  G F+  MPIFV  S  GS NG  L+ SRL Y  A +G +P  L MV+    TP+PAVI       +    + +I  LI     S+ +  G A+  L Y R   P+ PR+ K P+V PI+F +  + + ++ V   P D+ IG+ I+  G+P+Y+IF+ WK KPK + +LT+S+TI+ QK F+VV   KE 
Sbjct:   25 DKGLEKTMTLFNGVSIIVGCIIGSGIFISPTGIQAQAGSVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEML----ASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVVDANKEE 493          
BLAST of slc7a-8 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 258.84 bits (660), Expect = 1.162e-79
Identity = 198/473 (41.86%), Postives = 289/473 (61.10%), Query Frame = 3
Query:   99 DIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGN---VLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVI-FLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            D  L+K++ +F G+ II+G IIGSGIF+SP G+     SVG+S+I+WVL GLF+ +G+  YAELG  I KSGG+Y YI+E+FGP  AF+ +WI  + +   +    +L FA Y+L+P +  CD P  +  L+  L L  + A+NC SVKWA++   FF ++K  AL++II  G + +  G      SF + F ++     + +LAFY G +AY GWNYLNF+  E+ NP RNLP++I  S ++ T+IY  TN+A    ++P EML     S AVAV+FA++  G F+  MPIFV  S  GS NG  L+ SRL Y  A +G +P  L MV+    TP+PAVI       +    + +I  LI     S+ +  G A+  L Y R   P+ PR+ K P+V PI+F +  + + ++ V   P D+ IG+ I+  G+P+Y+IF+ WK KPK + +LT+S+TI+ QK F+VV   KE 
Sbjct:   61 DKGLEKTMTLFNGVSIIVGCIIGSGIFISPTGIQAQAGSVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEML----ASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVVDANKEE 529          
BLAST of slc7a-8 vs. Ensembl Celegans
Match: aat-2 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19151])

HSP 1 Score: 242.276 bits (617), Expect = 6.197e-74
Identity = 204/480 (42.50%), Postives = 301/480 (62.71%), Query Frame = 3
Query:   78 DKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNV--LSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMF--SCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPN---LPRSFKXXXXXXXXXXXXXXXXGILTVYE-KPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPE 1493
            ++ V+   IKL+  I +F G  IIIG+IIGSGIFVSP GVL    S GMS+++W+L G+F+ +G++ Y+ELG  IPKSGG+Y YI E+FGPL +F+ +W+  V I   SLA  ++  A Y LQP F SC +P+  + L     +A +  INC+ V+ ATR   FFTI+K++AL +II  G Y L  G++  L   D    S T   ++A+AFY G ++++G++YLNF+T E+ NP RNLP AI  S+ IVT++Y+  NIAY +VL+  E+L+    S AVA+ FAD+ +G F    LMP+FV  S  GS+NG  ++ SR+ ++ A    LPE  AM+SI+ LTP+P++IFL   S+V  F  ++  LI    F+  ++   +V+ L+ LR   P      R  K+ L+ PI+F L+ LF+ IL  +   P + + GV ++  GIPIY++FV  K +P  + ++    T +IQK F  VPE
Sbjct:    5 EEEVSLNQIKLKPRISLFNGCTIIIGVIIGSGIFVSPKGVLLEAGSAGMSLLIWLLSGVFAMIGAVCYSELGTLIPKSGGDYAYIYEAFGPLPSFLFLWVALVIINPTSLAIIAITCATYALQP-FYSCPVPDVVVNLFAGCIIAVLTFINCWDVRMATRTNDFFTITKLIALTLIITCGGYWLSLGHIDNLVMPDVAEGSQTKLSAIAMAFYSGVFSFSGFSYLNFVTEELKNPFRNLPRAIYISIPIVTIVYMLVNIAYFSVLTVDEILD----SDAVAITFADKILGTFGSKILMPLFVSFSCVGSLNGILITCSRMFFSGARNSQLPELFAMISIRQLTPIPSLIFLGGTSIVMLFIGNVFQLINYLSFAESLVVFSSVAGLLKLRFTMPENVLNARPIKISLLWPILFFLMCLFLLILPFFHSDPWELIYGVFLVLSGIPIYVLFVYNKYRPGFIQSVWIGFTHFIQKLFYCVPE 479          
BLAST of slc7a-8 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334550)

HSP 1 Score: 286.574 bits (732), Expect = 1.999e-90
Identity = 181/435 (41.61%), Postives = 275/435 (63.22%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKE 1502
            L YT SV +++I+WV+ GLFS +G+  YAELG  I KSG +Y YI+E+FGP  AFI +WI  + +   S A  +L F+ Y+L+P F  C  P  +  L+ +  +  +  INC+ VKWAT     FT +K+LAL III  G Y+L+ GN   FT  F +++T   S+AL+FY G +AY GWNYLNF+  E+ +P +NLP AI  S T+VT++YV  N+++  +LSP E++     S AVAV +A++  GM +  +P+FV  S FG++NG  L+ SRL Y  A  G +PE L M+ I+  TP PAV+ +A LS+++     I  LI   GF+  +  G+AV CL +LR   PNLPR  ++P+V PI++L+  +F+ ++ +Y  P ++  G+ +I   IP+Y++F+ WK+KP        SLT ++QK  +V+ ++ +
Sbjct:   75 LMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMVSLTRFLQKMLMVLGKQTK 503          
BLAST of slc7a-8 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334549)

HSP 1 Score: 286.574 bits (732), Expect = 1.999e-90
Identity = 181/435 (41.61%), Postives = 275/435 (63.22%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKE 1502
            L YT SV +++I+WV+ GLFS +G+  YAELG  I KSG +Y YI+E+FGP  AFI +WI  + +   S A  +L F+ Y+L+P F  C  P  +  L+ +  +  +  INC+ VKWAT     FT +K+LAL III  G Y+L+ GN   FT  F +++T   S+AL+FY G +AY GWNYLNF+  E+ +P +NLP AI  S T+VT++YV  N+++  +LSP E++     S AVAV +A++  GM +  +P+FV  S FG++NG  L+ SRL Y  A  G +PE L M+ I+  TP PAV+ +A LS+++     I  LI   GF+  +  G+AV CL +LR   PNLPR  ++P+V PI++L+  +F+ ++ +Y  P ++  G+ +I   IP+Y++F+ WK+KP        SLT ++QK  +V+ ++ +
Sbjct:   75 LMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVM----GSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMVSLTRFLQKMLMVLGKQTK 503          
BLAST of slc7a-8 vs. Ensembl Fly
Match: gb (gene:FBgn0039487 transcript:FBtr0345216)

HSP 1 Score: 286.189 bits (731), Expect = 2.801e-90
Identity = 194/473 (41.01%), Postives = 300/473 (63.42%), Query Frame = 3
Query:   90 NHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFA-SCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            + + + ++K +G+ +G+ II+GII GSGIFVSP GV++   SVG S+++WVLCGL S +G++ YAELG  IPKSGG+Y YI E++G L AF+ +W   +     + A   L FA Y+L+P F  +C+IP  AL L+  + +  +  +N Y +K  T+       +K+ AL++II++G   +  GNV +FT PF ++ T PG +++AFY G ++YAGWNYLNF+T E+ +P RNLP AI  SL +VT IYV  N+AYLAVLSP EM+     S A+AV F D+ +G+FS ++P+ V  S FG ++   ++ SR+ +  A  GH+P  L+ +S+K  TP+P+++FL  LS+V      +  LI  A         ++VS ++Y R   P + R  K+ + +P +F+++  F+ ++ +Y  P +  +GV I  +GIP Y + VVWK+KPK V +  +S+T   QK F+   EEKE+
Sbjct:   49 DSSRVVIKKQLGLLEGVAIILGIIFGSGIFVSPKGVIREVESVGASLVIWVLCGLLSMIGALCYAELGTAIPKSGGDYAYIFEAYGSLPAFLYLWDAMMIFVPTTNAIMGLTFASYVLEPFFGGACEIPKIALQLLAAITICFLTYLNSYYMKVTTKMQNVIMFTKIAALVLIILVGLVWMMMGNVENFTRPFDNTETDPGKMSVAFYSGIFSYAGWNYLNFMTEELRDPYRNLPRAIYISLPLVTGIYVLANVAYLAVLSPSEMI----ASNAIAVTFGDKILGVFSLIIPLMVAISAFGGLSVHIMTSSRICFVGARNGHMPAILSHISVKSYTPLPSLVFLCFLSIVMLVVSDVYVLITYASIVESFFIMLSVSAVLYFRYTRPCMERPIKVAMWIPALFVIVCAFLVVVPIYVAPYEVGMGVLITIIGIPFYYVGVVWKNKPKWVQSTIDSVTFTCQKLFMSAKEEKED 517          
BLAST of slc7a-8 vs. Ensembl Fly
Match: gb (gene:FBgn0039487 transcript:FBtr0085132)

HSP 1 Score: 286.189 bits (731), Expect = 2.801e-90
Identity = 194/473 (41.01%), Postives = 300/473 (63.42%), Query Frame = 3
Query:   90 NHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFA-SCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            + + + ++K +G+ +G+ II+GII GSGIFVSP GV++   SVG S+++WVLCGL S +G++ YAELG  IPKSGG+Y YI E++G L AF+ +W   +     + A   L FA Y+L+P F  +C+IP  AL L+  + +  +  +N Y +K  T+       +K+ AL++II++G   +  GNV +FT PF ++ T PG +++AFY G ++YAGWNYLNF+T E+ +P RNLP AI  SL +VT IYV  N+AYLAVLSP EM+     S A+AV F D+ +G+FS ++P+ V  S FG ++   ++ SR+ +  A  GH+P  L+ +S+K  TP+P+++FL  LS+V      +  LI  A         ++VS ++Y R   P + R  K+ + +P +F+++  F+ ++ +Y  P +  +GV I  +GIP Y + VVWK+KPK V +  +S+T   QK F+   EEKE+
Sbjct:   49 DSSRVVIKKQLGLLEGVAIILGIIFGSGIFVSPKGVIREVESVGASLVIWVLCGLLSMIGALCYAELGTAIPKSGGDYAYIFEAYGSLPAFLYLWDAMMIFVPTTNAIMGLTFASYVLEPFFGGACEIPKIALQLLAAITICFLTYLNSYYMKVTTKMQNVIMFTKIAALVLIILVGLVWMMMGNVENFTRPFDNTETDPGKMSVAFYSGIFSYAGWNYLNFMTEELRDPYRNLPRAIYISLPLVTGIYVLANVAYLAVLSPSEMI----ASNAIAVTFGDKILGVFSLIIPLMVAISAFGGLSVHIMTSSRICFVGARNGHMPAILSHISVKSYTPLPSLVFLCFLSIVMLVVSDVYVLITYASIVESFFIMLSVSAVLYFRYTRPCMERPIKVAMWIPALFVIVCAFLVVVPIYVAPYEVGMGVLITIIGIPFYYVGVVWKNKPKWVQSTIDSVTFTCQKLFMSAKEEKED 517          
BLAST of slc7a-8 vs. Ensembl Fly
Match: gb (gene:FBgn0039487 transcript:FBtr0347412)

HSP 1 Score: 286.189 bits (731), Expect = 2.801e-90
Identity = 194/473 (41.01%), Postives = 300/473 (63.42%), Query Frame = 3
Query:   90 NHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFA-SCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            + + + ++K +G+ +G+ II+GII GSGIFVSP GV++   SVG S+++WVLCGL S +G++ YAELG  IPKSGG+Y YI E++G L AF+ +W   +     + A   L FA Y+L+P F  +C+IP  AL L+  + +  +  +N Y +K  T+       +K+ AL++II++G   +  GNV +FT PF ++ T PG +++AFY G ++YAGWNYLNF+T E+ +P RNLP AI  SL +VT IYV  N+AYLAVLSP EM+     S A+AV F D+ +G+FS ++P+ V  S FG ++   ++ SR+ +  A  GH+P  L+ +S+K  TP+P+++FL  LS+V      +  LI  A         ++VS ++Y R   P + R  K+ + +P +F+++  F+ ++ +Y  P +  +GV I  +GIP Y + VVWK+KPK V +  +S+T   QK F+   EEKE+
Sbjct:   49 DSSRVVIKKQLGLLEGVAIILGIIFGSGIFVSPKGVIREVESVGASLVIWVLCGLLSMIGALCYAELGTAIPKSGGDYAYIFEAYGSLPAFLYLWDAMMIFVPTTNAIMGLTFASYVLEPFFGGACEIPKIALQLLAAITICFLTYLNSYYMKVTTKMQNVIMFTKIAALVLIILVGLVWMMMGNVENFTRPFDNTETDPGKMSVAFYSGIFSYAGWNYLNFMTEELRDPYRNLPRAIYISLPLVTGIYVLANVAYLAVLSPSEMI----ASNAIAVTFGDKILGVFSLIIPLMVAISAFGGLSVHIMTSSRICFVGARNGHMPAILSHISVKSYTPLPSLVFLCFLSIVMLVVSDVYVLITYASIVESFFIMLSVSAVLYFRYTRPCMERPIKVAMWIPALFVIVCAFLVVVPIYVAPYEVGMGVLITIIGIPFYYVGVVWKNKPKWVQSTIDSVTFTCQKLFMSAKEEKED 517          
BLAST of slc7a-8 vs. Ensembl Zebrafish
Match: slc7a11 (solute carrier family 7 member 11 [Source:ZFIN;Acc:ZDB-GENE-150416-1])

HSP 1 Score: 294.278 bits (752), Expect = 1.902e-93
Identity = 188/434 (43.32%), Postives = 264/434 (60.83%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEK 1499
            L+ + SVGMS+++WV CG+ S  G++ YAELG  I KSGG Y YILE+FGP  AF+ +W   + I    LA  +L F +YIL+P+F  C +P  A+ L   +G+  +  +N  SV W  R  +F T SK+LA+ IIIV G Y+LF+G   +F + F  +      L LAFY G +AYAGW YLNF+T E+ NP R +P+AI  S+ IV + Y  TN+AY  V+S  E+L     S AVAV FA++ MG FS  +P+FV  S FGSMNG   ++SR+ + A+ +G LPE L+M+ I+  TP+PAVI L  ++++  F   I  L+    F   +  G+AV  LIYLR   P+LPR FK+P+ +P +F     F+  L++Y  P ++ IG AI   GIP Y IF+  K KPK     ++S+   +Q    VVP E 
Sbjct:   69 LQNSGSVGMSLVVWVACGILSLFGALSYAELGTCIKKSGGHYTYILEAFGPQVAFVRLWADMIAIRPAGLAVIALAFGRYILEPIFMPCGVPEIAIKLATTIGITIVMYLNSMSVSWTARLQIFLTFSKLLAIAIIIVPGLYQLFKGETKNFENAFEVNTAQLTGLPLAFYSGMYAYAGWFYLNFVTEEVENPERTVPLAICISMVIVMICYTLTNVAYYTVMSADELL----ASNAVAVTFAEKLMGNFSYAVPVFVALSCFGSMNGCLFAISRMFFVASREGQLPEVLSMIHIRRHTPLPAVIVLYPITLLILFLGDIYSLLNFMSFLRWLFIGVAVVGLIYLRFTRPDLPRPFKVPIFIPAVFSFTCFFMVFLSLYSDPINTGIGFAISLTGIPAYYIFIHSKRKPKWFQKFSDSMNRSLQILLEVVPAEH 498          
BLAST of slc7a-8 vs. Ensembl Zebrafish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 267.314 bits (682), Expect = 2.011e-83
Identity = 198/470 (42.13%), Postives = 295/470 (62.77%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXX--XFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            ++L+K I +  G+ +I+G +IGSGIFVSP GVL Y+ S G+S+++W + G+FS +G++ YAELG TI KSG  Y YILESFG   AFI +W + + I   S A  ++ FA Y++QPLF +C+ P SA  L+    +  +  IN   VKW TR    FT +KVLAL++II+ G  KL +G  ++F D F  S+  PG +ALA Y   ++Y+GW+ LNF+T E+ NP RNLP++I  S+ IVT+IY+ TN+AY AVL    +L     S AVAV FAD T+G+ S  +PI V  S +G +N   ++ SRL +  A +GHLP++L+M+ I+  TP+PA++F  A+++++     +  LI    FS+    G++++  IYLR K P+ PR  KL LV PI+F L  +F+  + +Y    +SLIG+AI   G+P+Y   I +    +P  +T L  ++T + Q T   V  E + 
Sbjct:    1 MQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGIFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLIAAACICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAILA----SDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNSLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAITRFTQFTCFCVLTEMDT 466          
BLAST of slc7a-8 vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 267.7 bits (683), Expect = 3.274e-83
Identity = 208/481 (43.24%), Postives = 310/481 (64.45%), Query Frame = 3
Query:   66 KMTTDKIVNHTD--IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSF--TDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            K  T+K++   +  + L+++I +  G+ II+G IIGSGIFV+P GV+K   SVG+S+++W +CG+FS +G++ YAELG TI KSGG+Y YILE +G L AF+ +WI  + I   S    + +FA YIL+P+F  C +P +   LV  L +  + A+NCYSVK ATR    F  +K+LAL +II+IGF ++ +G+ +     + F  SNT  G++ LA Y G +AY GWNYLNF+T EMI P +NLP AII SL IVTV+YV TN+AY   LSP +ML     S AVAV F +  +G  + ++P+FVG S FGS+NG   + SRL +  + +GHLP  L+M+    LTP+P++IF   +++++ F+  I  +I    F   +   MA+  +++LR K P L R  K+ ++LPI+F+L  LF+ +++ ++ P +  IG  IIA G+P+Y   V W++KPK +  +  S T+  QK   VVP+E
Sbjct:   20 KQVTEKMLTGREETVVLKRTITLVNGVAIIVGTIIGSGIFVTPTGVVKEAGSVGLSLVVWTVCGVFSTIGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYILKPIFPVCPVPETGAKLVACLCILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEIGKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKMLS----SEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQIIFSSTVMCQKMMEVVPQE 496          
BLAST of slc7a-8 vs. Ensembl Zebrafish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 267.7 bits (683), Expect = 3.545e-83
Identity = 197/473 (41.65%), Postives = 294/473 (62.16%), Query Frame = 3
Query:   93 HTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXX--XXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
               ++L+K I +  G+ +I+G +IGSGIFVSP GVL Y+ S G+S+++W + G+FS +G++ YAELG TI KSG  Y YILESFG   AFI +W + + I   S A  ++ FA Y++QPLF +C+ P SA  L+    +  +  IN   VKW TR    FT +KVLAL++II+ G  KL +G  ++F D F  S+  PG +ALA Y   ++Y+GW+ LNF+T E+ NP RNLP++I  S+ IVT+IY+ TN+AY AVL    +L     S AVAV FAD T+G+ S  +PI V  S +G +N   ++ SRL +  A +GHLP++L+M+ I+  TP+PA++F  A+++++     +  LI    FS+    G++++  IYLR K P+ PR  KL LV PI+F L  +F+  + +Y    +SLIG+AI   G+P+    I +    +P  +T L  ++T + Q T   V  E + 
Sbjct:   24 RESMQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGIFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLIAAACICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAIL----ASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNSLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAITRFTQFTCFCVLTEMDT 492          
BLAST of slc7a-8 vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 263.848 bits (673), Expect = 1.897e-81
Identity = 188/435 (43.22%), Postives = 278/435 (63.91%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSF--TDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            +K   SVG+S+++W +CG+FS +G++ YAELG TI KSGG+Y YILE +G L AF+ +WI  + I   S    + +FA YIL+P+F  C +P +   LV  L +  + A+NCYSVK ATR    F  +K+LAL +II+IGF ++ +G+ +     + F  SNT  G++ LA Y G +AY GWNYLNF+T EMI P +NLP AII SL IVTV+YV TN+AY   LSP +ML     S AVAV F +  +G  + ++P+FVG S FGS+NG   + SRL +  + +GHLP  L+M+    LTP+P++IF   +++++ F+  I  +I    F   +   MA+  +++LR K P L R  K+ ++LPI+F+L  LF+ +++ ++ P +  IG  IIA G+P+Y   V W++KPK +  +  S T+  QK   VVP+E
Sbjct:   92 VKEAGSVGLSLVVWTVCGVFSTIGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYILKPIFPVCPVPETGAKLVACLCILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEIGKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKMLS----SEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQIIFSSTVMCQKMMEVVPQE 522          
BLAST of slc7a-8 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 312.768 bits (800), Expect = 2.099e-100
Identity = 195/435 (44.83%), Postives = 273/435 (62.76%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKE 1502
            L+ T SVGMS+++W  CG+ S  G++ YAELG  I KSGG Y YILE+FGPL AFI +W+  + I   + A  SL F +YIL+P F  C+IP+ A+ LV  LG+  +  +N  SV W+ R  +F T  K++A+LIIIV G  +L +G   +F D F   + S   L LAFY G +AYAGW YLNF+T E+ NP +N+P+AI  S+ IVTV YV TN+AY   +S  E++     S AVAV +A++  G FS  +PIFV  S FGSMNG   +VSR+ Y A+ +GHLPE L+M+ ++  TP+PAVI L  L++V  FT  I  L+    F   +  G+AV+ LIYLR K P + R FK+P+ +P +F    LF+  L++Y  P ++ IG AI   G+P Y +FV+W +KP+     T+  T+ +Q    V P +K 
Sbjct:   68 LQNTGSVGMSLVVWTACGILSLFGALCYAELGTCIKKSGGHYTYILEAFGPLPAFIRVWVELLVIRPAATAVISLAFGRYILEPFFIQCEIPDLAIKLVTALGITIVMVLNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELV----LSSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTDRTTLMLQILLEVAPTDKN 498          
BLAST of slc7a-8 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 304.294 bits (778), Expect = 2.018e-97
Identity = 191/423 (45.15%), Postives = 267/423 (63.12%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYI 1466
            L+ T SVGMS+++W  CG+ S  G++ YAELG  I KSGG Y YILE+FGPL AFI +W+  + I   + A  SL F +YIL+P F  C+IP+ A+ LV  LG+  +  +N  SV W+ R  +F T  K++A+LIIIV G  +L +G   +F D F   + S   L LAFY G +AYAGW YLNF+T E+ NP +N+P+AI  S+ IVTV YV TN+AY   +S  E++     S AVAV +A++  G FS  +PIFV  S FGSMNG   +VSR+ Y A+ +GHLPE L+M+ ++  TP+PAVI L  L++V  FT  I  L+    F   +  G+AV+ LIYLR K P + R FK+P+ +P +F    LF+  L++Y  P ++ IG AI   G+P Y +FV+W +KP+     T  +  +I
Sbjct:   54 LQNTGSVGMSLVVWTACGILSLFGALCYAELGTCIKKSGGHYTYILEAFGPLPAFIRVWVELLVIRPAATAVISLAFGRYILEPFFIQCEIPDLAIKLVTALGITIVMVLNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELV----LSSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTGIIQYFI 472          
BLAST of slc7a-8 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 303.908 bits (777), Expect = 3.795e-97
Identity = 191/423 (45.15%), Postives = 267/423 (63.12%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYI 1466
            L+ T SVGMS+++W  CG+ S  G++ YAELG  I KSGG Y YILE+FGPL AFI +W+  + I   + A  SL F +YIL+P F  C+IP+ A+ LV  LG+  +  +N  SV W+ R  +F T  K++A+LIIIV G  +L +G   +F D F   + S   L LAFY G +AYAGW YLNF+T E+ NP +N+P+AI  S+ IVTV YV TN+AY   +S  E++     S AVAV +A++  G FS  +PIFV  S FGSMNG   +VSR+ Y A+ +GHLPE L+M+ ++  TP+PAVI L  L++V  FT  I  L+    F   +  G+AV+ LIYLR K P + R FK+P+ +P +F    LF+  L++Y  P ++ IG AI   G+P Y +FV+W +KP+     T  +  +I
Sbjct:   68 LQNTGSVGMSLVVWTACGILSLFGALCYAELGTCIKKSGGHYTYILEAFGPLPAFIRVWVELLVIRPAATAVISLAFGRYILEPFFIQCEIPDLAIKLVTALGITIVMVLNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELV----LSSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTGIIQYFI 486          
BLAST of slc7a-8 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 303.523 bits (776), Expect = 6.170e-97
Identity = 190/423 (44.92%), Postives = 267/423 (63.12%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYI 1466
            L+ T SVGMS+++W  CG+ S  G++ YAELG  I KSGG Y YILE+FGPL AFI +W+  + I   + A  SL F +YIL+P F  C+IP+ A+ LV  LG+  +  +N  SV W+ R  +F T  K++A+LIIIV G  +L +G   +F D F   + S   L LAFY G +AYAGW YLNF+T E+ NP +N+P+AI  S+ IVTV YV TN+AY   +S  E++     S AVAV +A++  G FS  +PIFV  S FGSMNG   +VSR+ Y A+ +GHLPE L+M+ ++  TP+PAVI L  L++V  FT  I  L+    F   +  G+AV+ LIYLR K P + R FK+P+ +P +F    LF+  L++Y  P ++ IG AI   G+P Y +FV+W +KP+     T    +++
Sbjct:   68 LQNTGSVGMSLVVWTACGILSLFGALCYAELGTCIKKSGGHYTYILEAFGPLPAFIRVWVELLVIRPAATAVISLAFGRYILEPFFIQCEIPDLAIKLVTALGITIVMVLNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELV----LSSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPEWFRTFTAIFALHL 486          
BLAST of slc7a-8 vs. Ensembl Xenopus
Match: SLC7A11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:100496726])

HSP 1 Score: 303.138 bits (775), Expect = 8.369e-97
Identity = 189/410 (46.10%), Postives = 263/410 (64.15%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPK 1427
            L+ T SVGMS+++W  CG+ S  G++ YAELG  I KSGG Y YILE+FGPL AFI +W+  + I   + A  SL F +YIL+P F  C+IP+ A+ LV  LG+  +  +N  SV W+ R  +F T  K++A+LIIIV G  +L +G   +F D F   + S   L LAFY G +AYAGW YLNF+T E+ NP +N+P+AI  S+ IVTV YV TN+AY   +S  E++     S AVAV +A++  G FS  +PIFV  S FGSMNG   +VSR+ Y A+ +GHLPE L+M+ ++  TP+PAVI L  L++V  FT  I  L+    F   +  G+AV+ LIYLR K P + R FK+P+ +P +F    LF+  L++Y  P ++ IG AI   G+P Y +FV+W +KP+
Sbjct:   60 LQNTGSVGMSLVVWTACGILSLFGALCYAELGTCIKKSGGHYTYILEAFGPLPAFIRVWVELLVIRPAATAVISLAFGRYILEPFFIQCEIPDLAIKLVTALGITIVMVLNSVSVSWSARIQIFLTFCKLIAILIIIVPGVLQLIKGETQNFKDAFIGKDVSVMGLPLAFYSGMYAYAGWFYLNFVTEEVENPEKNVPLAICISMAIVTVGYVLTNVAYYTTISAEELV----LSSAVAVTYAERLFGSFSLAVPIFVALSCFGSMNGGVFAVSRMFYVASREGHLPEILSMIHVRKHTPLPAVIVLLPLTMVMLFTGDIYSLLNFFSFVRWLFIGLAVAGLIYLRYKRPEMHRPFKVPIFIPALFSFTCLFMVALSLYSDPINTGIGFAITLTGVPAYYLFVIWDNKPE 465          
BLAST of slc7a-8 vs. Ensembl Mouse
Match: Slc7a11 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 [Source:MGI Symbol;Acc:MGI:1347355])

HSP 1 Score: 312.383 bits (799), Expect = 2.505e-100
Identity = 210/472 (44.49%), Postives = 299/472 (63.35%), Query Frame = 3
Query:   90 NHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
                + L+K I + +G+ IIIG +IGSGIF+SP G+L+ T SVGMS++ W  CG+ S  G++ YAELG +I KSGG Y YILE FGPL AF+ +W+  + I   + A  SL F +YIL+P F  C+IP  A+ LV  +G+  +  +N  SV W+ R  +F T  K+ A+LIIIV G  +L +G    F D F+  +TS   L LAFY G +AYAGW YLNF+T E+ NP + +P+AI  S+ I+TV YV TN+AY   +S  E+L+    S AVAV F+++ +G FS  +PIFV  S FGSMNG   +VSRL Y A+ +GHLPE L+M+ +   TP+PAVI L  L++V  F+  +  L+    F+  +  G+AV+ LIYLR K P++ R FK+PL +P +F    LF+ +L++Y  P  + +G  I   G+P Y +F+VW  KPK    L++ +T  +Q    VVPE+ + 
Sbjct:   34 GQEKVVLKKKITLLRGVSIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYILEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELLQ----SSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITRTLQIILEVVPEDSKE 501          
BLAST of slc7a-8 vs. Ensembl Mouse
Match: Slc7a11 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 [Source:MGI Symbol;Acc:MGI:1347355])

HSP 1 Score: 300.056 bits (767), Expect = 1.032e-95
Identity = 205/459 (44.66%), Postives = 290/459 (63.18%), Query Frame = 3
Query:   69 MTTDKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLT 1445
            M   +      + L+K I + +G+ IIIG +IGSGIF+SP G+L+ T SVGMS++ W  CG+ S  G++ YAELG +I KSGG Y YILE FGPL AF+ +W+  + I   + A  SL F +YIL+P F  C+IP  A+ LV  +G+  +  +N  SV W+ R  +F T  K+ A+LIIIV G  +L +G    F D F+  +TS   L LAFY G +AYAGW YLNF+T E+ NP + +P+AI  S+ I+TV YV TN+AY   +S  E+L+    S AVAV F+++ +G FS  +PIFV  S FGSMNG   +VSRL Y A+ +GHLPE L+M+ +   TP+PAVI L  L++V  F+  +  L+    F+  +  G+AV+ LIYLR K P++ R FK+PL +P +F    LF+ +L++Y  P  + +G  I   G+P Y +F+VW  KPK    L+
Sbjct:   27 MGDQEPPGQEKVVLKKKITLLRGVSIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYILEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELLQ----SSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLS 481          
BLAST of slc7a-8 vs. Ensembl Mouse
Match: Slc7a6 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 6 [Source:MGI Symbol;Acc:MGI:2142598])

HSP 1 Score: 263.077 bits (671), Expect = 3.936e-81
Identity = 194/475 (40.84%), Postives = 292/475 (61.47%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSL--IGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK------TFLVVPEEKE 1502
            ++L+K I +  G+ +++G +IGSGIFVSP GVLKYT S G+S+I+W + GLFS +G++ YAELG TI KSG  Y YILE+FG   AFI +W++ + +   S A  ++ FA YI++P F +CD P  A  L+    +  +  +NC  VKW TR    FT +KVLAL+ II++G  KL +G+   F D F  S+ + G L+LA Y   ++Y+GW+ LNF+T E+ NP RNLP+AI  S+ IVT+IY+ TN+AY  VL+ +++ +    S AVAV FADQT GMFS  +PI V  S FG +N    + SRL +  + +GHLP  L+M+ I+  TP+PA++F   +++++     +  LI    FS+    G++V   +YLR K P+ PR  KL L  PI+F +  LF+  + ++    +SL  IG+A+  + +    +++    +P  + N+  ++T   QK      T L V EEK 
Sbjct:   39 MQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLKYTASYGLSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLIVEPTSQAIIAITFANYIIKPSFPTCDPPYVACRLLAAACVCLLTFVNCAYVKWGTRVQDTFTYAKVLALIAIIIMGLVKLCQGHTEHFQDAFKGSSWNVGDLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNIQDVHK----SDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPNLLSMIHIERFTPVPALLFNCTMTLIYLVVKDVFLLINYFSFSYWFFVGLSVVGQLYLRWKEPDWPRPLKLSLFFPIVFCVCSLFLVAVPLFSDTINSLIGIGIALSGVPVYFLGVYLPESRRPLFIRNVLATVTRVTQKLCFCVLTELDVTEEKN 509          
BLAST of slc7a-8 vs. Ensembl Mouse
Match: Slc7a10 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 10 [Source:MGI Symbol;Acc:MGI:1858261])

HSP 1 Score: 261.922 bits (668), Expect = 1.532e-80
Identity = 199/477 (41.72%), Postives = 300/477 (62.89%), Query Frame = 3
Query:   99 DIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNV--LSFTDPFADSNT-SPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK-TFLVVP----EEKEN 1505
             + L+K IG+     IIIG IIGSGIF+SP GVL+++ SVG+++ +WVL G  +ALGS+ YAELGV IPKSGG+Y Y+ E FG L+ F+ +W   + +   SLA  S+ F+ Y+LQP+F +C  P +A  ++ +  L  +  +N  SV+WATR  V FT  K+LAL +II +GF ++F+G+   L  T+ FA   T S G LALAF QG +A++GWN+LN++T E+++P +NLP AI  S+ +VT +Y  TN+AY   +SP+E+L     S AVAV F ++ +G FS +MP+ V  S FG +NG   + SRL ++ A +GHLP  LAM+ ++  TP+PA++     + V         LI    F   +  G+ +  L+ LR + P L R  K+ L++P+++L+   F+ + +   +P    +G+ II  G+PI+ + V W+SKPK V   TES+T + Q+  F+V P    EE+EN
Sbjct:   39 RVALKKEIGLVSACTIIIGNIIGSGIFISPKGVLEHSGSVGLALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGFLLLWSAVLIMYPTSLAVISMTFSNYVLQPVFPNCIPPATASRVLSMACLMLLTWVNSSSVRWATRIQVIFTGGKLLALSLIITVGFVQIFQGHFEELRPTNAFAFWMTPSVGHLALAFLQGSFAFSGWNFLNYVTEELVDPRKNLPRAIFISIPLVTFVYTFTNVAYFTAMSPQELLS----SNAVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTSSRLCFSGAREGHLPSFLAMIHVRRCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLVLRWRRPALHRPIKVNLLVPVVYLVFWAFLLVFSFISEPMVCGVGIIIILTGVPIFFLGVFWRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEEN 511          
BLAST of slc7a-8 vs. Ensembl Mouse
Match: Slc7a8 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 [Source:MGI Symbol;Acc:MGI:1355323])

HSP 1 Score: 261.536 bits (667), Expect = 1.823e-80
Identity = 178/439 (40.55%), Postives = 275/439 (62.64%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSN-TSP--GSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            L+   SVG+++I+W++ G+ +A+G++ YAELGVTIPKSGG+Y Y+ + FG L+ F+ +WI  + I   + A  +L F+ Y+LQPLF +C  P S L L+  + L  +  +NC SV+WATR    FT  K+LAL +II++G  ++ +G         A  N   P  G +ALAF QG +AY GWN+LN++T E+++P +NLP AI  S+ +VT +YV  NIAY+  +SP+E+L     S AVAV F ++ +G+ + +MPI V  S FG +NG   + SRL +  A +GHLP  LAM+ +K  TP+PA++F    +++   T  +  LI   GF   +  G+ V+  I LR K P++PR  K+ L+ PI++LL   F+ I +++ +P    IG+AI+  G+P+Y + V W+ KPK   +  +SLT+  QK  +VV  ++ N
Sbjct:   65 LENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELL----ASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYPQEGN 499          
BLAST of slc7a-8 vs. UniProt/SwissProt
Match: sp|Q9UPY5|XCT_HUMAN (Cystine/glutamate transporter OS=Homo sapiens OX=9606 GN=SLC7A11 PE=1 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 2.910e-101
Identity = 207/470 (44.04%), Postives = 302/470 (64.26%), Query Frame = 3
Query:   93 HTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKE 1502
               ++L++ + + +G+ IIIG IIG+GIF+SP GVL+ T SVGMS+ +W +CG+ S  G++ YAELG TI KSGG Y YILE FGPL AF+ +W+  + I   + A  SL F +YIL+P F  C+IP  A+ L+  +G+  +  +N  SV W+ R  +F T  K+ A+LIIIV G  +L +G   +F D F+  ++S   L LAFY G +AYAGW YLNF+T E+ NP + +P+AI  S+ IVT+ YV TN+AY   ++  E+L     S AVAV F+++ +G FS  +PIFV  S FGSMNG   +VSRL Y A+ +GHLPE L+M+ ++  TP+PAVI L  L+++  F+  +  L+    F+  +  G+AV+ LIYLR KCP++ R FK+PL +P +F    LF+  L++Y  P  + IG  I   G+P Y +F++W  KP+    ++E +T  +Q    VVPEE +
Sbjct:   35 QEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELL----LSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDK 500          
BLAST of slc7a-8 vs. UniProt/SwissProt
Match: sp|Q5RAG7|XCT_PONAB (Cystine/glutamate transporter OS=Pongo abelii OX=9601 GN=SLC7A11 PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 5.368e-101
Identity = 207/470 (44.04%), Postives = 302/470 (64.26%), Query Frame = 3
Query:   93 HTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKE 1502
               ++L++ + + +G+ IIIG IIG+GIF+SP GVL+ T SVGMS+ +W +CG+ S  G++ YAELG TI KSGG Y YILE FGPL AF+ +W+  + I   + A  SL F +YIL+P F  C+IP  A+ L+  +G+  +  +N  SV W+ R  +F T  K+ A+LIIIV G  +L +G   +F D F+  ++S   L LAFY G +AYAGW YLNF+T E+ NP + +P+AI  S+ IVT+ YV TN+AY   ++  E+L     S AVAV F+++ +G FS  +PIFV  S FGSMNG   +VSRL Y A+ +GHLPE L+M+ ++  TP+PAVI L  L+++  F+  +  L+    F+  +  G+AV+ LIYLR KCP++ R FK+PL +P +F    LF+  L++Y  P  + IG  I   G+P Y +F++W  KP+    ++E +T  +Q    VVPEE +
Sbjct:   35 QEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELL----LSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGSVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDK 500          
BLAST of slc7a-8 vs. UniProt/SwissProt
Match: sp|Q9WTR6|XCT_MOUSE (Cystine/glutamate transporter OS=Mus musculus OX=10090 GN=Slc7a11 PE=1 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.752e-99
Identity = 210/472 (44.49%), Postives = 299/472 (63.35%), Query Frame = 3
Query:   90 NHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
                + L+K I + +G+ IIIG +IGSGIF+SP G+L+ T SVGMS++ W  CG+ S  G++ YAELG +I KSGG Y YILE FGPL AF+ +W+  + I   + A  SL F +YIL+P F  C+IP  A+ LV  +G+  +  +N  SV W+ R  +F T  K+ A+LIIIV G  +L +G    F D F+  +TS   L LAFY G +AYAGW YLNF+T E+ NP + +P+AI  S+ I+TV YV TN+AY   +S  E+L+    S AVAV F+++ +G FS  +PIFV  S FGSMNG   +VSRL Y A+ +GHLPE L+M+ +   TP+PAVI L  L++V  F+  +  L+    F+  +  G+AV+ LIYLR K P++ R FK+PL +P +F    LF+ +L++Y  P  + +G  I   G+P Y +F+VW  KPK    L++ +T  +Q    VVPE+ + 
Sbjct:   34 GQEKVVLKKKITLLRGVSIIIGTVIGSGIFISPKGILQNTGSVGMSLVFWSACGVLSLFGALSYAELGTSIKKSGGHYTYILEVFGPLLAFVRVWVELLVIRPGATAVISLAFGRYILEPFFIQCEIPELAIKLVTAVGITVVMVLNSTSVSWSARIQIFLTFCKLTAILIIIVPGVIQLIKGQTHHFKDAFSGRDTSLMGLPLAFYYGMYAYAGWFYLNFITEEVDNPEKTIPLAICISMAIITVGYVLTNVAYFTTISAEELLQ----SSAVAVTFSERLLGKFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVHKHTPLPAVIVLHPLTMVMLFSGDLYSLLNFLSFARWLFMGLAVAGLIYLRYKRPDMHRPFKVPLFIPALFSFTCLFMVVLSLYSDPFSTGVGFLITLTGVPAYYLFIVWDKKPKWFRRLSDRITRTLQIILEVVPEDSKE 501          
BLAST of slc7a-8 vs. UniProt/SwissProt
Match: sp|Q59I64|YLAT2_DANRE (Y+L amino acid transporter 2 OS=Danio rerio OX=7955 GN=slc7a6 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 3.523e-82
Identity = 197/470 (41.91%), Postives = 295/470 (62.77%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXX--XFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            ++L+K I +  G+ +I+G +IGSGIFVSP GVL Y+ S G+S+++W + G+FS +G++ YAELG TI KSG  Y YILESFG   AFI +W + + I   S A  ++ FA Y++QPLF +C+ P SA  L+    +  +  IN   VKW TR    FT +KVLAL++II+ G  KL +G  ++F D F  S+  PG +ALA Y   ++Y+GW+ LNF+T E+ NP RNLP++I  S+ IVT+IY+ TN+AY AVL    +L     S AVAV FAD T+G+ S  +PI V  S +G +N   ++ SRL +  A +GHLP++L+M+ I+  TP+PA++F  A+++++     +  LI    FS+    G++++  IYLR K P+ PR  KL LV PI+F L  +F+  + +Y    ++LIG+AI   G+P+Y   I +    +P  +T L  ++T + Q T   V  E + 
Sbjct:    1 MQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGIFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLIAAACICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAILA----SDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNTLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAITRFTQFTCFYVLTEMDT 466          
BLAST of slc7a-8 vs. UniProt/SwissProt
Match: sp|Q7YQK4|LAT1_RABIT (Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC7A5 PE=1 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.460e-81
Identity = 207/468 (44.23%), Postives = 302/468 (64.53%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDP---FADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            + LQ++I +  G+ II+G IIGSGIFV+P GVLK   S G+S+++W +CG+FS +G++ YAELG TI KSGG+Y Y+LE +G L AF+ +WI  + I   S    +L+FA Y+L+P+F +C +P  A  LV  L +  + A+NCYSVK ATR    F  +K+LAL +II++GF ++ +G V S  DP   F  +N   G++ LA Y G +AY GWNYLNF+T EMINP RNLP+AII SL I T++YV TN+AY   LSP +ML     S AVAV F +  +G+ S ++P+FVG S FGS+NG   + SRL +  + +GHLP  L+M+  + LTP+P+++F  A+++++ F+  I  +I    F   +   +A+  +++LR K P L R  K+ L LP+ F+L  LF+  ++ ++ P +  IG  II  G+P+Y   V WK+KPK +     S T   QK   VVP+E
Sbjct:   40 VALQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLSLVVWAVCGVFSIVGALCYAELGTTITKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPVFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGGV-SNLDPKFSFEGTNWDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPICTLVYVLTNLAYFTTLSPEQML----ASEAVAVDFGNHHLGVMSWVIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSVLSMIHPQLLTPVPSLVFTCAMTLLYAFSRDIFSVINFFSFFNWLCVALAIIGMMWLRYKKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSATALCQKLMQVVPQE 502          
BLAST of slc7a-8 vs. TrEMBL
Match: A0A0H3YF65 (Slc7a-8 OS=Schmidtea mediterranea OX=79327 GN=slc7a-8 PE=2 SV=1)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 479/479 (100.00%), Postives = 479/479 (100.00%), Query Frame = 3
Query:   69 MTTDKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            MTTDKIVNHTDIKLQKSIGVFQGMCIIIGIIIGSGIFVSPIGVLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLVLPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN
Sbjct:    1 MTTDKIVNHTDIKLQKSIGVFQGMCIIIGIIIGSGIFVSPIGVLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLVLPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 479          
BLAST of slc7a-8 vs. TrEMBL
Match: A0A0H3YK27 (Slc7a-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc7a-4 PE=2 SV=1)

HSP 1 Score: 461.07 bits (1185), Expect = 2.968e-155
Identity = 273/455 (60.00%), Postives = 362/455 (79.56%), Query Frame = 3
Query:   63 VKMTTDKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPK 1427
            +   + K    + I+L+K IGVF+G+ IIIG+I+GSGIFVSP+GVLKYT+SVG+S ++W++ G+FS  G++V+AELG TIP+SGGEYIYI+++FG + AF+C+WITF+ IG V+ AANS+IFAQYILQP+F SC++P +A+++   LG+ ++ AINCY+V+WAT+  + FT+SKVLALLIIIVIG   L RGN  SF DPF+ S     S+ +AFYQGFWAY+GWNYLNFLT+EM NP +NLP+AII SLT++TV+Y+  N+AYLAVLSP+E+L I   S AVAV FAD+TMG+ S +MPIFVG SVFGSMN E LS+SRLT T A +  +PE LAMVS K+LTPMPAVI +  L+++F F  +  YLIELAGF+F VI+ MAV CL+YLR KCP+LPR FKLP+++P++FLL DLFIG LT+Y++P DS I + ++ L IP+YIIF+ W  K +
Sbjct:   27 ISHASKKTKYKSLIQLRKDIGVFEGVSIIIGVIVGSGIFVSPVGVLKYTDSVGLSFVMWLIAGIFSTTGALVWAELGTTIPRSGGEYIYIMKTFGSMPAFLCLWITFILIGAVATAANSMIFAQYILQPIFGSCEVPVTAVLITANLGIMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKTE 481          
BLAST of slc7a-8 vs. TrEMBL
Match: A0A564YEX9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5212 PE=4 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 1.516e-142
Identity = 270/478 (56.49%), Postives = 351/478 (73.43%), Query Frame = 3
Query:   72 TTDKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            ++D     T IK++K I V Q + I+ G+I+GSGIFVSP+GVLKY+NSVG+S+I+WV+ G+FS LG++VYAELGV I KSGGEY YILE+FG L AFI MWITFV IGGVS AANSL+FAQYILQP++  C+IP+  + +V + GL  I AINCY VKWA R  V F+  K+ ALL+II  G Y L  G+V +F + F DS  SPG LAL+FYQGFWA++GWNYLNFLT E+ NP +NLP++I   L++VT +Y+ TNIAYLAVLS  EML   S S AVAV+FA + M   + LMPIFVGASVFGS+NGE +S+SRLTYT A +GH+P  L+M+     TP+PA+I L  L++ F F   I  LIELAGF+F  I+ +AV+ LIY+R + P+L  SF+LP++ PI+FL+ D+FI  LTVY++P +SL  V ++   IPIY   V WK+KP+S+ N     T+Y+QK F VVP E E+
Sbjct:   12 SSDNGDGKTVIKMKKEINVLQAVSIVFGVIVGSGIFVSPVGVLKYSNSVGLSLIMWVVPGVFSMLGALVYAELGVRIQKSGGEYAYILEAFGGLPAFIVMWITFVIIGGVSCAANSLVFAQYILQPIYPDCEIPSHIVTMVAICGLMLICAINCYKVKWAARVAVIFSFGKIFALLLIIGFGLYFLATGHVENFHNAFEDSRYSPGELALSFYQGFWAFSGWNYLNFLTEEIKNPGKNLPLSIGIGLSLVTGLYMLTNIAYLAVLSRHEMLASGSGSSAVAVIFAQRAMPWIAMLMPIFVGASVFGSINGEAMSMSRLTYTGAREGHMPSILSMIHHTNFTPIPAIIILLFLAIGFQFYSDIFALIELAGFAFSFIASLAVASLIYMRYRDPHLKTSFRLPIIFPILFLICDVFILALTVYQQPKESLSNVILMLSAIPIYWFGVSWKNKPRSLQNTIYKTTVYLQKVFAVVPVEDES 489          
BLAST of slc7a-8 vs. TrEMBL
Match: C1L452 (Cystine/glutamate transporter OS=Schistosoma japonicum OX=6182 GN=EWB00_006252 PE=2 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 2.971e-141
Identity = 258/480 (53.75%), Postives = 352/480 (73.33%), Query Frame = 3
Query:   66 KMTTDKIVNHT--DIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRS-FKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            K   D   +HT   + L+K + + QG+ I++G+IIGSGIFVSP+GVL+YT SVG+S ++W + GLFSALG+IVYAELGVTIP+SGGEY+YIL++FGPL AF+  WITFV IG  S AANSLIFA YIL+P++  C  P+  + +V LLG+ ++  I+C+SVKWAT+  + FT  KV ALLII+  G + L +GNV SF + F DS TSPG+LALAFYQGFWA++GWNYLNFLT E+ NP R LPI II SLT VT+IY+ TN+AYLAVLSP E+L     S A+AV FA ++MG+   +MP  VGASVFGS+NGE  S+SRL +TA  +GH+P  L+MV+I  LTP+P+++ +  L+++F  + +I YLIEL GF+F VIS MAV  L+Y+R   P +  S FKLP+  P+++L++D+ IGILT+Y++P  S I + ++  GI +Y   V+WK KP+ + +L   +TI +QK   VV ++
Sbjct:    3 KTKKDTTEDHTGQSVALKKEVSILQGVSIVVGVIIGSGIFVSPVGVLRYTKSVGLSFVMWTVTGLFSALGAIVYAELGVTIPRSGGEYVYILQTFGPLPAFLAFWITFVVIGSASCAANSLIFADYILRPIYMDCTTPSFVVRIVALLGILTLCFIHCFSVKWATKTAIIFTTCKVAALLIIVGFGLFYLGKGNVESFHNSFEDSETSPGALALAFYQGFWAFSGWNYLNFLTGEVKNPGRTLPIVIILSLTTVTLIYIFTNVAYLAVLSPAEVLASGEGSTAIAVTFATRSMGVVGLIMPALVGASVFGSINGEIFSISRLAFTAGEEGHMPAILSMVNIDRLTPIPSILAVVILAILFQMSDNILYLIELTGFAFSVISAMAVCSLLYIRRTNPQMNTSGFKLPIFFPVLYLIVDIAIGILTIYQEPIKSAISLGVMLFGIVVYAFGVLWKKKPRPLLSLIYHITITLQKVLKVVEQD 482          
BLAST of slc7a-8 vs. TrEMBL
Match: Q26594 (Amino acid permease OS=Schistosoma mansoni OX=6183 GN=PRM1 PE=2 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 3.787e-138
Identity = 265/476 (55.67%), Postives = 349/476 (73.32%), Query Frame = 3
Query:   78 DKIVNHTD-IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRS-FKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEK 1499
            +K  N T+ + L+K + V QG+ I++G+IIGSGIFVSP+GVLK+T SVG+S I+W + GLFS LG+IVYAELGVTIP+SGGEY+YIL++FGPL AF+  WITFV IG  S AAN+LIFAQYIL+P++  C  P   +  V +LGL  +  ++C+SVK AT+  V FT  KV ALLIII  G Y L +GNV SF + F DS  SPG LAL FYQGFWA++GWNYLNFLT E+ NP R LPI II SLT VT IY+ TN+AYLAVLSP E+L  S  S A+AV FA +TMG+   +MP  VGASVFGS+NGE  S+SRL +TA  +GH+P  L+MV+I  LTP+P+++ +  LSV+F     I YLIEL GF+F V+S MAV  L+Y+R   P +  S FKLP+  P+++L++D+ IGIL +Y+KPTD  + + ++ LG+P+Y+  VVWK+KP+S+ +L   +TI +QK   VV +EK
Sbjct:    8 NKDSNATESVALKKEVSVLQGVSIVVGVIIGSGIFVSPVGVLKHTKSVGLSFIMWAVTGLFSTLGAIVYAELGVTIPRSGGEYVYILQTFGPLLAFLAFWITFVVIGSASCAANALIFAQYILRPVYMDCVTPTIVIRTVAVLGLLLLCFVHCFSVKLATKVAVVFTACKVTALLIIIGFGLYYLGKGNVESFKNAFEDSEKSPGELALGFYQGFWAFSGWNYLNFLTGEVKNPGRTLPIVIILSLTTVTFIYILTNVAYLAVLSPLEVLA-SEGSTAIAVSFASRTMGVVGLVMPALVGASVFGSINGEVFSISRLAFTAGEEGHMPALLSMVNIDRLTPIPSILIVVTLSVIFQMFDDILYLIELTGFAFSVMSAMAVCSLLYIRRTNPEMNTSGFKLPIFFPVLYLIVDIAIGILAIYQKPTDCAVSLGVMLLGVPVYLFGVVWKNKPRSMRSLIYGVTITLQKVLKVVEQEK 482          
BLAST of slc7a-8 vs. Ensembl Cavefish
Match: slc7a11 (solute carrier family 7 member 11 [Source:NCBI gene;Acc:103037778])

HSP 1 Score: 292.352 bits (747), Expect = 7.827e-93
Identity = 186/434 (42.86%), Postives = 268/434 (61.75%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEK 1499
            LK + SVGMS+++WV CG+ S  G++ YAELG  I KSGG Y YI+E+FGP  AF+ +W   + I    +A  SL FA+YIL+P+F  C +P  A+ +   +G+ ++  IN  SV W  R  +F T SK+LA+ IIIV G Y+LF+G   +F + F   +     L LAFY G +AYAGW YLNF+T E+ NP RN+P+AI  S+ IVTV Y  TN+AY  V+S  ++L     S AVAV FA++ MG FS  +P+FV  S FGSMNG   ++SR+ + A+ +G LPE L+M+ ++  TP+ AVI L  ++++  F   I  L+    F   +  G+AV  LIYLR   P++PR FK+P+ +P +F     F+  L++Y  P ++ IG AI+  GIP Y I +V+  +PK     ++S+   +Q    VVP E 
Sbjct:   59 LKNSGSVGMSLVVWVACGVLSLFGALSYAELGTCIKKSGGHYTYIMEAFGPQVAFVQLWADIIAIRPAGVAVISLAFARYILEPIFMPCGVPEIAIKVTTAIGITTVMYINSMSVSWTARLQIFLTFSKLLAIAIIIVPGLYQLFKGETKNFQNAFQVDSVQVTGLPLAFYSGMYAYAGWFYLNFVTEEVENPERNVPLAICISMVIVTVCYTLTNVAYYTVMSAADLL----ASDAVAVTFAEKLMGNFSMAVPLFVAMSCFGSMNGCLFAISRMFFVASREGQLPEVLSMIHVRRHTPIAAVIVLYPITLLNLFLGDIYSLLNFMSFLRWLFIGVAVLGLIYLRYTRPDMPRPFKVPIFIPAVFSFTSFFMVFLSLYSDPVNTGIGFAILLTGIPAYYILIVFNKRPKWFQKFSDSVNRSLQIILEVVPAEN 488          
BLAST of slc7a-8 vs. Ensembl Cavefish
Match: slc7a8b (large neutral amino acids transporter small subunit 2 [Source:NCBI gene;Acc:103044995])

HSP 1 Score: 270.781 bits (691), Expect = 2.193e-84
Identity = 202/484 (41.74%), Postives = 301/484 (62.19%), Query Frame = 3
Query:   72 TTDKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFT-----DPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVV-PEEKEN 1505
            T  K    + + L+K IG+     II+G IIGSGIFVSP GVL+  +SVG+++I+W+  G+ +A+G++ YAELGVTIPKSGG+Y Y+ + FG L+ F+ +WI  + I   + A  SL F+ Y+LQPLF +C    S L L+  + L  +  +NC+SV+WATR    FT  K+LAL +II++G  ++ +GN          +PF D +   G +ALAF QG +AY GWN+LN++T E+I+P RNLP AI  S+ +VT +YV  N+AY+  +SP E+L     S AVAV F ++ +G+ S +MPI V  S FG +NG   + SR+ +  A +GHLP  LAM+ +   TP+PA++F    +++   T  +  LI   GF   +  G+ V+  I LRI+ P+L R  K+ LV P+++LL   F+ + ++Y +P    IG+AI+  G+P+Y + V W++KPK  T+    +T   QK  LVV P E E 
Sbjct:   17 TNSKQPESSGVALKKEIGLLSACGIIVGNIIGSGIFVSPKGVLENASSVGLALIIWISTGVITAIGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIALLVIYPTNQAVISLTFSNYVLQPLFPTCFATESGLRLLAAVCLLLLTWVNCFSVRWATRVQDIFTAGKLLALGLIIIMGIVQMCKGNYYWLEPAHAFEPFQDYDV--GRIALAFLQGSFAYGGWNFLNYVTEELIDPYRNLPRAIFISIPLVTFVYVFANVAYITAMSPTELLA----SNAVAVTFGEKLLGVMSWIMPISVALSTFGGINGSLFTSSRMFFAGAREGHLPRLLAMIHVNRFTPIPALLFTCISTLLMLCTSDMYTLINYVGFINYLFYGVTVAGQIVLRIRQPDLSRPIKVSLVWPVIYLLFWAFLLVFSLYSQPMVCCIGLAIMLTGVPVYYLGVYWENKPKKFTHFVGKMTGLGQKLCLVVYPAEDER 494          
BLAST of slc7a-8 vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 263.848 bits (673), Expect = 1.245e-81
Identity = 189/488 (38.73%), Postives = 294/488 (60.25%), Query Frame = 3
Query:   90 NHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSL--IGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN*YKKLLNFNYD*KF 1547
            ++  +KL+K I +  G+C+I+G +IGSGIFVSP GVL Y+ S G+S+++W + G+FS  G++ YAELG TI KSG  Y YILE+FG   AFI +W + + I   S A  ++ F+ Y++QP+F +C  P +A  L+    +  +  +NC  VKW TR   FFT +KV+AL+ +I+ G  K+F+G+  +F   F +S+  PG +ALA Y   ++Y+GW+ LNF+T E+ NP RNLP++I  S+ IVTVIY+ TN+AY  +L    +L+    S AVAV FAD+  G+F+  +P+ V  S FG +N   L+ SRL +  + +GHLP+ L M+ +   TP+PA++F  A+++V+     I  LI    FS+    G+++   +YLR K P+ PR  KL ++ PI+F L  +F+ ++ +Y    +SL  IG+A+  + +     +     +P  +     S  + IQK    V  E +    K LN  Y+  F
Sbjct:   26 SNESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAILD----SDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEMDTDEGKDLNPKYNTHF 509          
BLAST of slc7a-8 vs. Ensembl Cavefish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 262.692 bits (670), Expect = 2.094e-81
Identity = 170/389 (43.70%), Postives = 250/389 (64.27%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFK 1268
            ++L+K I +  G+ +I+G +IGSGIFVSP GVL Y+ S G+S+++W + G+FS +G++ YAELG TI KSG  Y YILESFG   AFI +W + + I   S A  ++ FA Y++QPLF +C+ P SA  L+    +  +  IN   VKW TR    FT +KVLAL++II+ G  KL +GN  +F   F  S+  PG +ALA Y   ++Y+GW+ LNF+T E+ NP RNLP+AI  S+ IVT+IY+ TN+AY AVL    +L     S AVAV FAD T+G+ S  +PI V  S +G +N   ++ SRL +  + +GHLP++L+M+ +   TP+PA++F  A+++++     +  LI    FS+    G++++  IYLR K P+ PR  K
Sbjct:   27 MQLKKEISLINGISLIVGNMIGSGIFVSPKGVLLYSTSYGLSLVIWAIGGMFSVIGALCYAELGTTIKKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLLAAACICLLTFINAAYVKWGTRVQDLFTYAKVLALIVIIITGIVKLCQGNTQNFEGFFEGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIENPERNLPLAIAVSMPIVTIIYILTNVAYYAVLDMSAIL----ASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHVHRFTPVPALLFNCAMALIYLAVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKDPDRPRPLK 411          
BLAST of slc7a-8 vs. Ensembl Cavefish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 262.692 bits (670), Expect = 2.094e-81
Identity = 170/389 (43.70%), Postives = 250/389 (64.27%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFK 1268
            ++L+K I +  G+ +I+G +IGSGIFVSP GVL Y+ S G+S+++W + G+FS +G++ YAELG TI KSG  Y YILESFG   AFI +W + + I   S A  ++ FA Y++QPLF +C+ P SA  L+    +  +  IN   VKW TR    FT +KVLAL++II+ G  KL +GN  +F   F  S+  PG +ALA Y   ++Y+GW+ LNF+T E+ NP RNLP+AI  S+ IVT+IY+ TN+AY AVL    +L     S AVAV FAD T+G+ S  +PI V  S +G +N   ++ SRL +  + +GHLP++L+M+ +   TP+PA++F  A+++++     +  LI    FS+    G++++  IYLR K P+ PR  K
Sbjct:   27 MQLKKEISLINGISLIVGNMIGSGIFVSPKGVLLYSTSYGLSLVIWAIGGMFSVIGALCYAELGTTIKKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLLAAACICLLTFINAAYVKWGTRVQDLFTYAKVLALIVIIITGIVKLCQGNTQNFEGFFEGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIENPERNLPLAIAVSMPIVTIIYILTNVAYYAVLDMSAIL----ASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHVHRFTPVPALLFNCAMALIYLAVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKDPDRPRPLK 411          
BLAST of slc7a-8 vs. Ensembl Sea Lamprey
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 287.345 bits (734), Expect = 2.343e-91
Identity = 186/433 (42.96%), Postives = 263/433 (60.74%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            L  T SVGMS+++W  CG+ S  G++ YAELG  I KSGG Y YILE+FGPL AF+ +W+  + I   + A  +L F QYILQP+F  C +P  A+ +V  L ++ +  IN  SV W  R   F T SK+ A+ III+ G   L +GN   F D F         L LAFY G +AY+GW Y+NF+T E+ NP RN+P+AI  S+ IVTV Y   N+AY AV+S  E+L     S AVAV FA++ +G FS  +P+FV  S  GS+NG   +++R+ + A+ +GHLP  L+M+ I+  TP+PAVI L  L+++  F   I  L+    F+  +   MAVS L+Y+R   P++ R FK+PL +P+ F L  L +  L++Y  P +S IG AI   G+P+Y + VVW  KP +V   T+ +T  +Q    V P+E
Sbjct:   76 LTNTGSVGMSLVVWAACGVLSLFGALSYAELGTCIKKSGGHYTYILEAFGPLPAFVRLWVELIIIRPAATAVIALTFGQYILQPMFPQCHVPQLAVKIVTALAISLVMFINSSSVSWTARLQTFLTFSKLAAVGIIIIPGIIHLAKGNTEHFQDSFVGKEVGLMGLPLAFYSGMYAYSGWFYMNFVTEEVDNPERNIPLAICISMGIVTVAYTFMNMAYFAVMSGAELL----ASKAVAVTFAERLLGNFSITVPVFVALSCLGSLNGGVFAIARMFFVASREGHLPHILSMIHIRKHTPLPAVIILYPLTMLMLFVGDIYSLLNFFSFARWLFIAMAVSGLVYMRFTRPHMHRPFKVPLFIPVFFSLSCLLVVALSLYSDPVNSGIGCAITLSGVPVYYLTVVWDGKPTAVKRATDRVTRVLQLILQVAPQE 504          
BLAST of slc7a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002665.1 (pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1 gene:ENSPMAG00000002414.1 transcript:ENSPMAT00000002665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 2.523e-65
Identity = 131/348 (37.64%), Postives = 201/348 (57.76%), Query Frame = 3
Query:  225 SMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFK 1268
            ++++W  CGL S LG++ YAELG  +P +GGEY Y+  +FG   AF+  W +   +     +A +L FA+Y+L+PLF  C  P + +  + +  L  +  +NC S+KWA RA    T+ K+LAL I+ V G   L  G   +    FA +  SP  +  +FYQG WAY GWN LN+ T E+ +  +N+   I+ ++ +VT  YV  NI+Y+ VL+P+E++     S AVAV + D+ +G FS ++P+ V  S FGS+N     + RL Y AA +GH    LAM+S+++ TP PAV F   LSV F     +  L    GF   ++ G+  + L+ LR + P+L R ++
Sbjct:   76 ALLVWAGCGLLSLLGALCYAELGAAVPTTGGEYAYVRRAFGAPLAFLFAWTSVALLRPAMNSAVALTFAEYVLRPLFHGCPAPPAIVKCLAIASLLVVGILNCVSMKWAMRALDVLTLLKMLALAIVSVGGLVLLASGRTHNPLGSFAGAPPSPAQIGESFYQGLWAYGGWNALNYATEELKDVHKNITRCIVVAVPLVTAFYVLVNISYMTVLTPKEIIS----SAAVAVTWGDRVLGSFSWIVPLSVAVSTFGSLNCSAFVMGRLNYAAAREGHALPLLAMLSVRHQTPTPAVAFSTLLSVAFVLPTDLIMLTNYFGFVTWLLVGLNCAGLLVLRYREPDLRRPYR 419          
BLAST of slc7a-8 vs. Ensembl Sea Lamprey
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 159.844 bits (403), Expect = 1.263e-45
Identity = 96/230 (41.74%), Postives = 144/230 (62.61%), Query Frame = 3
Query:   93 HTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPAR 782
               ++L+K I +  G+C+I+G +IGSGIFVSP GVL Y+ S G+S+++W L G+FS  G++ YAELG TI KSG  Y YILE+FG   AFI +W + + I   S A  ++ FA Y++QP+F++C+ P +A  L+    +  +  +NC  VK   R     T +KV+AL+ +I+ G   L +G   +    F  SN   G++ALA Y   ++Y+GW+ LNF+T E+ NP R
Sbjct:   37 QDSMQLKKEISLVSGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWALGGIFSVFGALCYAELGTTITKSGASYAYILEAFGKFPAFIRLWTSLLIIEPTSQAVIAITFANYLVQPIFSTCEPPYAASRLIAAACICLLTFVNCAYVKHGIRVQDLSTYAKVIALIAVIIAGIVFLGKGKTENLESSFEGSNWDVGNMALALYSALFSYSGWDTLNFVTEEIKNPER 266          
BLAST of slc7a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000258.1 (pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 gene:ENSPMAG00000000231.1 transcript:ENSPMAT00000000258.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.969 bits (354), Expect = 4.639e-39
Identity = 70/195 (35.90%), Postives = 115/195 (58.97%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPAR 782
            L++  SVG ++++W+ CG  S LG++ YAELG TI +SG  YIY+ E+ G L AF+ +W+ F+ +    +A   L   QY L+ L++ C +P  A+ L+ ++ ++ +  +N +S   + R     ++SK+ AL  II +G   + RG    F + F  +++ P  L LAFY G +AY+GW  LN +T E+  P R
Sbjct:   33 LRHAGSVGWALMVWLACGFLSLLGALSYAELGTTIRQSGSHYIYLRETLGTLPAFLFLWVEFIIVRPSVMAVVFLSMGQYSLEALYSPCAVPRIAVKLLAMVSISFVVWVNTWSSTLSLRVQSCLSVSKLAALASIIGVGIAHVARGRTEYFENAFDTADSRPEGLPLAFYSGMFAYSGWASLNSVTEEVKRPER 227          
BLAST of slc7a-8 vs. Ensembl Sea Lamprey
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 90.8929 bits (224), Expect = 2.059e-21
Identity = 67/190 (35.26%), Postives = 115/190 (60.53%), Query Frame = 3
Query:  927 DQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            +  +G+ S ++P+FV  S FGS+NG   + SRL +  A +GHLP  L+M+  +  TP+P+++F   +++++  +  I  +I    F   +   MA+  +++LR K P   R  K+ ++LPI F+L  +F+ +++V   P +  IG+ II  GIP+Y + V W++KP S+ NL  S+TI  QK   V+P+E
Sbjct:    6 NYHLGVMSWIIPVFVSLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHRRLFTPVPSLLFTCLMTLLYAISDDIFSVINFFSFFNWLCIAMAICGMMWLRYKEPQRDRPIKVNILLPISFVLACIFLIVVSVVVTPVECGIGLGIILTGIPVYFVGVRWQNKPPSLLNLISSMTILSQKVLEVIPQE 195          
BLAST of slc7a-8 vs. Ensembl Yeast
Match: MUP1 (High affinity methionine permease; integral membrane protein with 13 putative membrane-spanning regions; also involved in cysteine uptake [Source:SGD;Acc:S000003287])

HSP 1 Score: 62.7734 bits (151), Expect = 6.764e-11
Identity = 69/231 (29.87%), Postives = 110/231 (47.62%), Query Frame = 3
Query:  213 SVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFI-CMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRG-----NVLSFTDPFADSNTSPG-SLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREML 884
            SVG+++I+W +  + +  G  VY E G  IPK+GGE  Y+   F     FI CM+  ++   G + A NS+  A   L          N   I V ++  A +  IN  +VK          I K+  +L I + G+  L  G        +F + F  + T+    +  A Y   W++ G++ +N+   E+ NP R L IA   S+  + +IY+  NIAY AV+ P++ L
Sbjct:   92 SVGLALIMWAVGAIIAISGLYVYMEFGTAIPKNGGEKNYLEAIFRKPKFFITCMYAAYIFFLGWA-AGNSINTAIMFLTAADTEVTKWNQRGIGVAVVFFAFL--INSLNVKIGLYLQNILGIFKIGIVLFISITGWVALGGGLKDGYQSHNFRNAFEGTETATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAIIYIFVNIAYFAVV-PKDKL 318          
BLAST of slc7a-8 vs. Ensembl Yeast
Match: MUP3 (Low affinity methionine permease; similar to Mup1p [Source:SGD;Acc:S000001028])

HSP 1 Score: 57.3806 bits (137), Expect = 2.701e-9
Identity = 69/240 (28.75%), Postives = 115/240 (47.92%), Query Frame = 3
Query:  210 NSVGMSMI---LWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWIT-FVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTIS----KVLALLIIIVIGFYKLF----RGNV---LSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREML 884
            N+ G  +I   +WV     +  G  ++ E G  IPKSGG   ++  SF      I +  + +  + G +L   S++F +Y+L   F   D   S  + +  +    I A+  + V  + R  VF   +    K++ ++++   G Y LF     G V   L  T    DS  S  S+A AF   F+ ++GW+ ++ +TSE+ NP + L ++   SL I  V Y   N+AYL VL+  E++
Sbjct:   93 NTGGNKLIYFAIWVFSAAIAFAGLYLFLEFGSWIPKSGGRKNFLERSFERPRLLISVVFSCYSVLTGYALTG-SIVFGKYVLSA-FGVTDDSWSKYVSISFI----IFAVLIHGV--SVRHGVFIQNALGGLKLIMIVLMCFAGLYTLFFYKSTGQVAWDLPVTQVEKDSLLSVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSLIICFVCYTMMNVAYLKVLTYEEIV 324          
BLAST of slc7a-8 vs. Ensembl Nematostella
Match: EDO40551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S703])

HSP 1 Score: 263.848 bits (673), Expect = 4.535e-82
Identity = 193/476 (40.55%), Postives = 287/476 (60.29%), Query Frame = 3
Query:   87 VNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDI-PNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCV-ISGMAVSC-LIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            V   +I L+K + +  G+ +++G++IGSGIF+SP GVL+ T SVG+S+++W  CGL +  GS+ Y E+G  IPKSG EY Y+ ++FGPL AF+  W   + I   SLA  SL FA+Y+ QP F +C+I P S   ++    LA    INC SV+WATR    FT+ K++A+ I++++G   + +G V    DPF  S  +P ++ LAFY G WAY GWN LNF+T EM NPAR+LP A+I  + +VT+ Y+ TNIAY+AV+    +L     S AVA+   D  +G  S ++PIFV  S FG +NG   S +RL Y +A  GH+P  LAM+  K  TPMP++IF+  ++++     +  +   +  FSF   +S  AV C L+YLR K PN  R +K+ LV+P++     L++ I    ++P +S + +  I LGIP+Y +F  W    K      +     +QK F +  EE+ +
Sbjct:   28 VEIKEIHLKKEVSLINGVALVVGVMIGSGIFISPKGVLQQTGSVGLSLVVWAGCGLLALFGSLCYCEMGTMIPKSGAEYSYLKDAFGPLPAFLYSWTLALIIRPSSLAIVSLTFARYVTQPFFPNCEISPLSVRKILAACCLALTLFINCASVRWATRIQDSFTLGKLIAIAILVILGIITIAKGQVEYLEDPFEKSTPNPAAIGLAFYSGLWAYDGWNALNFVTEEMKNPARDLPRALIIGIPLVTICYLLTNIAYIAVVGREGILS----SGAVAMTVGDMYLGPMSWIIPIFVACSTFGCVNGLLFSGARLVYVSARNGHMPRLLAMIHNKCQTPMPSIIFMNTIALIMLIPDASEFGTLVNYFSFAAWLSYFAVICALLYLRWKRPNAHRPYKVWLVIPVIAACAALYLLITPFAKEPVESSMALIFIVLGIPVYFLFCKWDILGKMCGPSVDKFLWNVQKWFDLSLEERPD 499          
BLAST of slc7a-8 vs. Ensembl Nematostella
Match: EDO41594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3U0])

HSP 1 Score: 246.514 bits (628), Expect = 4.114e-76
Identity = 181/444 (40.77%), Postives = 260/444 (58.56%), Query Frame = 3
Query:  204 YTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCD--IPN--SALILVGLLGLASIAAI---NCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISY--LIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK-TFLVVPEEKEN 1505
            YT S G+ + +W LCG+ + +GS+ YAELG  I KSG EY Y+  +FG   AF+  W + + +    +A  SL F QY+++P F +C    P+     IL  LL    I  I   NC+SVK ATR  V FT +K++A+ ++I+ G  +L +G   SF D F  + TS G +  AFY G WAY GWN LN++T E+ NP R+LP +I+  + + TV YV  NIAYL VL+P E++     S AVAV  +++  G+ +  +PIFV  S FG+ NG   S  RL Y AA +GHLPE LAMV  K  TP+PA++F + ++ +     S S+  LI    F+  V  G  VS L++LR + P + R +K+PL++PIM LL  L++ I   YE P +S   +  I  GIP Y++FV +K  PK   N  +S+T  +Q      +PE +E 
Sbjct:   16 YTGSAGLGIAVWALCGVIAMMGSLCYAELGTMIVKSGAEYAYLNAAFGERVAFLFSWTSTILLKPSQIAIVSLAFGQYVVEPFFPTCSGFDPDRLDLKILEKLLAAVCIGVITYVNCFSVKLATRVQVVFTAAKLIAIAMLIITGLVRLGQGFTGSFDDAFKGTTTSIGMVGFAFYNGLWAYDGWNNLNYVTEELKNPYRDLPRSILFGIPLGTVCYVLVNIAYLTVLTPVEVM----ASGAVAVTLSNRLYGVMAWTIPIFVACSTFGAANGSAFSGGRLVYVAAREGHLPEFLAMVHTKRHTPLPAMLFNSIIAWLMLLPDSSSFETLINYFSFAAWVFYGSTVSALLWLRYRKPEMERPYKVPLLVPIMVLLASLYLIIAPFYEAPLESFYCLLFILAGIPFYLVFVYFKVAPKWFLNGVDSITYKLQVLCDCALPESEEE 455          
BLAST of slc7a-8 vs. Ensembl Nematostella
Match: EDO37074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGV3])

HSP 1 Score: 247.669 bits (631), Expect = 4.571e-76
Identity = 154/398 (38.69%), Postives = 241/398 (60.55%), Query Frame = 3
Query:   81 KIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFC--VISGMAVSCLIYLRIKCPNLPRSFK 1268
            K+   + + L+K + +  G+  I+G +IGSGIF+SP G+L  T S+G+S+++W  CG  + L  + Y ELG  + KSG EY Y++E+FGP+ AF+  W   +       A  SLIFA+Y+ +P F  C  P + + L+GL  + ++  INC+SV+WATR    FT +K+L + ++++IG  +L +G   +  + F  S T P  +  AFY G WAY GWN LN+ T EM +PAR++P AII  ++I+T  Y+  NIAY+ VL    +L     S AVAV   D  +G    ++P+FV AS FG++NG   +  RLTYTAA  G LP  LAM+ +K LTP+P+++  + +++     P  +++  +  FSF   +  G + + L++LR K P +PR ++
Sbjct:   29 KVQIQSKVGLEKRVTLLSGISFIVGTVIGSGIFISPTGILGTTQSIGLSLMVWFGCGFLALLACLCYTELGTAVQKSGAEYAYLMEAFGPIPAFLFAWTGIIINRPAITAIVSLIFAEYVAKPFFPECAPPPAVVKLLGLACIVTVTGINCWSVRWATRVQRIFTYAKLLCIAMLVIIGVVELCKGKTENLQNAFEGSETDPAKIGFAFYIGLWAYDGWNSLNYCTEEMKDPARDMPKAIIIGISIITGCYLMVNIAYITVLGGAGIL----ASEAVAVSIGDVYLGPMKWIIPVFVAASTFGTVNGVAFTSGRLTYTAARDGLLPSMLAMIQVKRLTPLPSMLLTSTIAICMLLPPGSNFMSLVGFFSFAAWLFYGGSFAALLWLRYKKPEMPRPYR 422          
BLAST of slc7a-8 vs. Ensembl Nematostella
Match: EDO38377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD43])

HSP 1 Score: 241.506 bits (615), Expect = 8.006e-74
Identity = 185/459 (40.31%), Postives = 277/459 (60.35%), Query Frame = 3
Query:   78 DKIVN-HTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAI---NCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAG-FSFC--VISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSV 1433
            D+ +N    + L++S+GV  G+ +++GIIIGSGIF +P  V+ Y+ SVG+S+++W L GL S  GS+ Y ELG+ IP SGGEY Y+LE+FGPL AF+  W+  + I  + +    L+F  Y+ +P +  C+       L  L+  AS+  +   NC SVKW++R  V FT++K++A+++++  G  ++  G+V SF D F  S T  G +  AFY   ++Y GWN +N+   E+ NP RNLP+ I  S+ +VT+ YV  N+ YLAVLSP E+ E    S AVAV  A +  G+ +  MP  V  SVFGS+NG   ++ RLTY AA  GHLP  +AM+  K  TP+PA++F +A   V    P +S    L   FSF   V  G  +S L+++R + P++ R +K+ +++P + LLL L++ I   YE P  S      +  GIP+Y +FV +K  PK V
Sbjct:   23 DESLNVEPRVTLKRSLGVPTGVSLLVGIIIGSGIFATPKWVMVYSGSVGLSLVVWCLGGLISLFGSLCYIELGLMIPVSGGEYEYLLEAFGPLPAFLFAWLYSLFIKNMGIVILLLVFGAYVTEPFYPGCNEREDLERLRKLIAAASLGVVVFLNCASVKWSSRIQVGFTVAKMVAIVMLVFTGVVRIAMGHVSSFADVFEGSETRVGLVGFAFYNALFSYDGWNNVNYCVEELKNPKRNLPLCIWISIPVVTLSYVLVNVGYLAVLSPVEIQE----SNAVAVTLAYRLYGVMAWTMPFLVACSVFGSVNGSCFALGRLTYAAARNGHLPRIMAMIHKKKRTPLPAILF-SAFICVLMMIPDVSTFSSLLNYFSFLTWVNYGATISGLLWMRYRKPDVHRPYKVFILIPCLVLLLSLYLVIAPFYEAPIASSFATLFVLAGIPVYFVFVRFKLLPKCV 476          
BLAST of slc7a-8 vs. Ensembl Nematostella
Match: EDO41148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S561])

HSP 1 Score: 236.113 bits (601), Expect = 1.179e-71
Identity = 159/442 (35.97%), Postives = 258/442 (58.37%), Query Frame = 3
Query:  198 LKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLG---LASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISY--LIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTF-LVVPE-EKE 1502
            L YT SVG+S+++W LCG+ +  GS+ Y EL + IP+ GGEY Y++++FGP +AF+  WI+   +   ++    L F  Y+++P F  C      + ++ +L    L  I  +NC SVKW++R  + FT+ K++A+L++++ G  ++ +G+V S  D F  + TS G +  AFY G ++Y GWN LNF   E+  P R +P AI  ++ +VT  YV  NI YL+VL+P E+      S AVAV  A +  G+ +  +PI V  S FGS NG F S  RL Y AA +GHLPE LAMV  K  TP+PA++F + +S +     S  +  L+    F   +  G+ +  +I++R++  +  R +K+P++LP +  LL +++ +   Y+ P  S   +  +  GIP+Y+ FV +K  P+ + +    +T+ IQ    + +P+ EKE
Sbjct:   64 LLYTGSVGLSLLVWALCGMIALFGSLSYVELALMIPRCGGEYAYLMQAFGPFAAFLYSWISVCFLKPATVLI-LLAFGAYVIEPFFPHCSHREDLVPVIKILAASALGVITIVNCASVKWSSRIQIAFTVGKMIAILMLVLTGIVRIAQGHVSSLKDSFQGTATSLGMVGFAFYNGLFSYDGWNQLNFFVEEIKEPNRTVPRAIWIAIPLVTASYVLVNIGYLSVLTPDEL----RTSNAVAVTLASRMYGVMAWTIPILVAFSTFGSANGNFFSGGRLAYAAAREGHLPELLAMVHTKRHTPIPAILFSSTISCIMLIPDSSKFETLLNFGAFIVWLFYGVTMFSIIWMRVRQKDKTRPYKVPIILPCLMTLLSIYLVVAPFYQAPLPSFYALLAVLSGIPVYLFFVRYKVLPQCIMDRYARITVRIQLVLGVALPKSEKE 500          
BLAST of slc7a-8 vs. Ensembl Medaka
Match: ENSORLT00000006048.2 (large neutral amino acids transporter small subunit 1 [Source:NCBI gene;Acc:101158196])

HSP 1 Score: 298.516 bits (763), Expect = 9.333e-95
Identity = 209/471 (44.37%), Postives = 308/471 (65.39%), Query Frame = 3
Query:   99 DIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNV--LSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
             I+L++SI +F G+ +IIG IIGSGIFV+P GV+K T S G+S+++W  CG+ S +G++ YAELG TI KSGG+Y YILE +G L+AF+ +W+  + I   S    SL+FA Y+L+PL+ SC +P+SA  L+  L L S+  +NC SV+ AT+    FT SK+ AL III+ GF ++F G+V  L+    F  S     ++ LA Y G +A+ GWNYLN++T EM+NP RNLP+AII S+ IVTV+YV TN+AY   +SP  M+E    S AVAV F +Q +G  S L+P+FVG S FG++NG   + +RL Y  A +G LP +L +V     TP+P++IF   LS+++T +  I  +I L  F   +  GMA++ L++LR+  P+L R  K+ L +P+ F+L  +F+ +++ +  P + L+G +II  GIP Y++   WK KP  V  + E  T++ QK  + VPEE+E 
Sbjct:   62 KIELKRSITLFNGVGMIIGTIIGSGIFVTPTGVVKETGSAGLSLVVWSACGVVSTMGALCYAELGTTIAKSGGDYTYILEVYGELAAFLKLWVEMLIIRPSSQYVVSLVFATYLLKPLYPSCPVPDSAAKLIACLCLTSLTFVNCISVRAATKVQDLFTASKLFALCIIILFGFIQIFTGDVPYLTPEKSFEGSKMGVDNIVLALYSGLFAFGGWNYLNYVTEEMVNPERNLPLAIIISMPIVTVVYVLTNLAYFTTISPEVMVE----SEAVAVTFGEQHLGRMSWLIPVFVGMSCFGAVNGSLFTSARLFYAGAREGQLPAALGLVHTDLFTPVPSLIFTCFLSMMYTISQDIFSVINLFSFFTWLCVGMAIAGLVWLRLTKPDLRRPIKVYLFIPVTFVLGCIFMIVVSFWAAPFECLVGTSIILTGIPAYLLGYKWK-KPHMVQKMLEIFTMFCQKILMSVPEEREQ 527          
BLAST of slc7a-8 vs. Ensembl Medaka
Match: slc7a5 (solute carrier family 7 member 5 [Source:NCBI gene;Acc:101163489])

HSP 1 Score: 267.314 bits (682), Expect = 6.360e-83
Identity = 207/470 (44.04%), Postives = 302/470 (64.26%), Query Frame = 3
Query:   93 HTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSF--TDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
               + L+++I +  G+ II+G IIGSGIFV+P GV+K   SVG+S+I+W +CG+FS +G++ YAELG TI KSGG+Y YILE +G L AF+ +WI  + I   S    + +FA Y+L+PLF  C +P +   LV  L +  +  +NCYSVK ATR   FF  +K+LAL++II+IGF K+ +G+       + F  SN   G++ LA Y G +AY GWNYLNF+T EMI P +NLP AII SL IVT +YV TN+AY   LSP++ML     S AVAV F +  +G  + ++P+FVG S FGS+NG   + SRL +  A +GHLP  L+M+    LTP+P++IF   +++++ F+  I  +I    F   +   +A+  +++LR K P L R  K+ ++LPI F+L  LF+ I++ ++ P +  IG  IIA G+P+Y I V W++KPK + +   S T + QK   VVP+E
Sbjct:   51 EDGVALKRTITLLNGVAIIVGTIIGSGIFVTPTGVVKEAGSVGLSLIVWAVCGVFSTVGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYLLKPLFPVCPVPENGAKLVACLCILLLTFVNCYSVKAATRVQDFFAAAKLLALILIIIIGFVKIGQGDTDDLLPENSFKGSNYEFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTAVYVLTNLAYFTTLSPQQML----GSEAVAVDFGNHHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHPTLLTPLPSLIFTCLMTLLYAFSNDIFSVINFFSFFNWLCIALAIIGMMWLRHKKPELERPIKVNILLPISFVLACLFLIIVSFWKTPIECAIGFGIIATGLPVYFIGVWWQNKPKWLLHGIFSSTAWCQKVMEVVPQE 516          
BLAST of slc7a-8 vs. Ensembl Medaka
Match: slc7a10a (asc-type amino acid transporter 1 [Source:NCBI gene;Acc:101166040])

HSP 1 Score: 264.233 bits (674), Expect = 8.900e-82
Identity = 196/476 (41.18%), Postives = 292/476 (61.34%), Query Frame = 3
Query:   90 NHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFA---DSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK-TFLVVPEEKEN 1505
            N   + L+K IG+     IIIG IIGSGIF+SP GVL++  SVG+S+I+WV  G   ALGS+ YAELGVTIPKSGG+Y Y+ E FG L  F+ +W   + +   +LA  +L F+ Y+LQP F +C  P  A+ L+  + +  +  +NC SV+WATR    FT+ K+LAL +IIV+G  ++FRG+  +     A     ++S G +ALAF Q  +AY+GWN+LN++T E++ P +NLP AI  S+ +VT++Y  TNIAY + ++P E+L     S AVAV F ++ +GMFS +MPI V  S FG +NG   + SRL ++ A +GHLP  LAM+ +K  TP+PA++     ++V         LI    F   +  G+ ++ L+YLR   PNL R  ++ L++PI +L+    +   ++Y +P    +G+ I+  G+P+Y + V WK KPK V  L E  T   QK  ++V P+   +
Sbjct:   27 NSGKVTLKKEIGLLSACAIIIGNIIGSGIFISPKGVLEHAGSVGLSLIVWVCGGGICALGSLCYAELGVTIPKSGGDYSYVTEIFGGLVGFLLLWSAVLIMYPTTLAVIALTFSNYVLQPAFQNCVPPFIAIKLLAAICVLFLTWVNCSSVRWATRIQDIFTVGKLLALALIIVVGLVQIFRGHYDALVPSVAFEFQQDSSVGQIALAFLQASFAYSGWNFLNYVTEEVVEPRKNLPRAIYISIPLVTLVYTMTNIAYFSSMTPEELL----ASNAVAVTFGEKLLGMFSWVMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPYLLAMIHLKNCTPIPALLVCCFATIVILCIGETHNLINYVSFINYLSYGVTIAGLLYLRKTRPNLARPIRVSLLVPISYLVFWAVLLGFSLYSEPVVCGLGMVIMLTGVPVYFVGVQWKEKPKWVYRLVERFTYVGQKLCYVVFPQNDSS 498          
BLAST of slc7a-8 vs. Ensembl Medaka
Match: si:dkeyp-120h9.1 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101167380])

HSP 1 Score: 259.61 bits (662), Expect = 3.094e-80
Identity = 185/467 (39.61%), Postives = 283/467 (60.60%), Query Frame = 3
Query:   78 DKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSL--IGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK 1472
            D     + ++L++ I +  G+C+I+G +IGSGIFVSP GVL YT S G+S+I+W + G+FS  G++ YAELG TI KSG  Y YILE+FG   AFI +W + + +     A  +L F+ Y++QP + +C  P  A+ L+    +  + A+NC  VKW     V  T++KVLAL++II+ G  KL +G   +F + F  S   PG +ALA Y   ++Y+GW+ LNF+T E+ NP RNLP++I  S+ IVTVIY+ TNIAY  V+    +L     S AVAV FAD+ +G    L+PI V  S +G +N   ++ SRL +  + +GHLP  L M+ +K  TP+PA+ F  A+S+ +   P +  LI    F++ +  G++++  IYLRIK P++ R  KL L  PI++ L  +F+ I+ +Y    +SL  IGVA+    +    I +   S+P  ++ L + + ++ QK
Sbjct:    6 DVASQGSGMRLKQEISLLHGVCLIVGNMIGSGIFVSPKGVLMYTGSFGLSLIVWAIGGVFSVFGALCYAELGTTIRKSGASYAYILEAFGGFLAFIRLWTSLMIVEPACQAVIALTFSSYLVQPFYPTCSAPYHAVRLIAAAIICLLTAVNCLKVKWGAILQVISTVAKVLALIVIIITGLVKLAQGFDQNFENSFKGSKLDPGYMALALYSALYSYSGWDTLNFITEEIKNPERNLPLSIAISMPIVTVIYIMTNIAYYVVMDADTVLS----SEAVAVTFADEVLGWARWLIPISVAISCYGGLNSSIIAASRLFFVGSREGHLPNVLCMIHVKRYTPIPALFFNGAMSLFYLSVPDVFQLINYFSFNYWLFIGLSIASQIYLRIKAPDMHRPVKLSLFFPIVYCLCSIFLVIVPLYSDTLNSLVGIGVALSGAPVYYICIHLPPSSRPAFLSKLLDKICLFTQK 468          
BLAST of slc7a-8 vs. Ensembl Medaka
Match: ENSORLT00000022942.2 (asc-type amino acid transporter 1 [Source:NCBI gene;Acc:101165956])

HSP 1 Score: 258.455 bits (659), Expect = 1.610e-79
Identity = 197/480 (41.04%), Postives = 295/480 (61.46%), Query Frame = 3
Query:   78 DKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDP--FADSNT-SPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQK-TFLVVPEEKEN 1505
            +KI +   + L+K IG+     IIIG IIGSGIF+SP GVL+++ SVG+++++WVL G  + LGS+ YAELGVTIPKSGG+Y Y+ E FG L  F+ +W   + +   +LA  +L F+ YILQP+F  C  P  A  L+    L  +  +NC SV+ ATR    FT+ K++AL +IIV+G  ++F GN  + T    F+ S T S G +ALAF Q  +A++GWN+LN++T E++ P RNLP AI  S+ +VT +Y  TNIAY + +SP E+L     S AVAV F ++ +G+FS +MPI V  S FG +NG   + SRL ++ A +GHLP  LAM+  K  TP+PA++   A ++V         LI    F   +  G+ ++ L+Y R K PNL R  ++ L++P+ +L+    +   ++Y +P    +G+ I+  G+P+Y + V WK KPK + ++ E  T   Q+  F+V P+   N
Sbjct:   25 EKIPDR--VTLKKEIGLLSACTIIIGNIIGSGIFISPKGVLEHSGSVGLALVVWVLGGCIAGLGSLCYAELGVTIPKSGGDYSYVTEIFGGLMGFLLLWSAVLIMYPTTLAVIALTFSSYILQPVFPDCVPPYVATRLLSATCLIFLTWVNCSSVRLATRIQDIFTVGKLMALGLIIVVGLVQIFNGNYEALTPQVAFSMSRTPSVGQIALAFLQASFAFSGWNFLNYVTEEVVEPRRNLPRAIYISIPLVTFVYTLTNIAYFSSMSPEELLS----SNAVAVTFGEKLLGVFSVIMPISVALSTFGGINGYLFTSSRLCFSGAREGHLPSLLAMIHCKRCTPIPALLVCCAATIVILCIGETHNLINYVSFINYLSYGVTIAGLLYYRWKKPNLYRPIRVNLLVPVSYLMFWALLLGFSLYSEPVVCGVGLVIMLTGVPVYFLGVHWKEKPKCIYSMIEKATFVGQRLCFVVFPQIDPN 498          
BLAST of slc7a-8 vs. Planmine SMEST
Match: SMESG000006721.1 (SMESG000006721.1)

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 476/479 (99.37%), Postives = 477/479 (99.58%), Query Frame = 3
Query:   69 MTTDKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            MTTDKIVNH DIKLQKSIGVFQGMCIIIGIIIGSGIFVSPIGVLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANS IFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPL+LPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN
Sbjct:    1 MTTDKIVNHIDIKLQKSIGVFQGMCIIIGIIIGSGIFVSPIGVLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSFIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLILPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 479          
BLAST of slc7a-8 vs. Planmine SMEST
Match: SMESG000017104.1 (SMESG000017104.1)

HSP 1 Score: 479.945 bits (1234), Expect = 1.012e-165
Identity = 281/465 (60.43%), Postives = 374/465 (80.43%), Query Frame = 3
Query:  102 IKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEE 1496
            I+L+K IGVF+G+ IIIG+I+GSGIFVSP+GVLKYT+SVG+S ++W++ G+FS  G++V+AELG TIP+SGGEYIYI+++FG + AF+C+WITF+ IG V+ AANS+IFAQYILQP+F SC++P +A+++   LG+ ++ AINCY+V+WAT+  + FT+SKVLALLIIIVIG   L RGN  SF DPF+ S     S+ +AFYQGFWAY+GWNYLNFLT+EM NP +NLP+AII SLT++TV+Y+  N+AYLAVLSP+E+L I   S AVAV FAD+TMG+ S +MPIFVG SVFGSMN E LS+SRLT T A +  +PE LAMVS K+LTPMPAVI +  L+++F F  +  YLIELAGF+F VI+ MAV CL+YLR KCP+LPR FKLP+++P++FLL DLFIG LT+Y++P DS I + ++ L IP+YIIF+ W  KP+S+T+L   +T+ +QK   VV ++
Sbjct:   31 IQLRKDIGVFEGVSIIIGVIVGSGIFVSPVGVLKYTDSVGLSFVMWLIAGIFSTTGALVWAELGTTIPRSGGEYIYIMKTFGSMPAFLCLWITFILIGAVATAANSMIFAQYILQPIFGSCEVPVTAVLITANLGIMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKITVNLQKLLNVVLQD 495          
BLAST of slc7a-8 vs. Planmine SMEST
Match: SMESG000081276.1 (SMESG000081276.1)

HSP 1 Score: 429.098 bits (1102), Expect = 3.469e-146
Identity = 265/466 (56.87%), Postives = 355/466 (76.18%), Query Frame = 3
Query:  108 LQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKEN 1505
            L+K IGV QG+ IIIG+IIGSGIFVSP+GVLK+T+SVG+S ++W+L G+FS +G++VYAELGVTIP SGGEYIYIL++FG L AF C+WITF+ IG  S AAN+ IFAQY+L+PLF  C+IP SA I +GL G+ ++ AINCY+VKWA +  + FT+ KV ALL+II +G + +F G   SF +PFA SN + GSL+LAFY GFWA+AGWNYLNFLT EM NP+RNLPIAI+ SL IVT +Y+  N+AYL VL+PREML     S A+AV FA++TMG FS +MPI V ASVFGSMNGE LS+SRLTY  A + HLP  ++M+S  +LTPMP++I +  + + F  +  + YLIELAGF++ VI  MA   L+Y+R K       F+L +++PI FL++D+F+ +L +Y++P +SLIG+ I+ LG+PI+++ V WK KPKS  N TE+LT++ QK  LV+P + E+
Sbjct:   16 LRKEIGVLQGVSIIIGVIIGSGIFVSPVGVLKHTHSVGLSFVIWLLTGVFSIIGALVYAELGVTIPLSGGEYIYILKTFGGLLAFCCLWITFLLIGAASTAANAFIFAQYLLKPLFLECEIPASAQICLGLFGVFTLLAINCYNVKWAAKLAIVFTVGKVSALLLIIGLGLFNIFMGRSDSFNEPFAGSNFNAGSLSLAFYHGFWAFAGWNYLNFLTEEMKNPSRNLPIAILLSLLIVTSVYIMVNVAYLGVLTPREMLIAGESSSAIAVGFAERTMGSFSWIMPICVAASVFGSMNGEILSMSRLTYAGANEKHLPTVISMISKSHLTPMPSIIIMGVVVICFQLSLDVFYLIELAGFAYTVIFAMATCSLLYIRHKSHETKTKFRLNIIIPITFLIVDIFVAVLALYQQPKESLIGIGIMILGVPIFLVGVSWKDKPKSFNNFTENLTVWAQKLLLVIPPDAED 481          
BLAST of slc7a-8 vs. Planmine SMEST
Match: SMESG000051755.1 (SMESG000051755.1)

HSP 1 Score: 282.722 bits (722), Expect = 2.090e-89
Identity = 198/481 (41.16%), Postives = 306/481 (63.62%), Query Frame = 3
Query:   75 TDKIVNHT---DIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSA--LILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVVPEEKE 1502
            TD++V  +    ++L+K I +  G+ II+G IIGSGIFVSP  V   + S G ++I+W LCG+FS +G+  Y ELG  I +SGG+Y Y+L++FGP  AF+ +W+  +    VS A  +L+FA+Y L+ L+  C  P  A  L+  G +G+ +   INCYSV+W+T      + +KV ALLIII+ G  KL +G+  ++ + FADS+T+PG  A+AFY G +AY GWNYLN L  EM NP R+LP++I+ S+ ++  IYV TN+AY  +L P E+L   + +V VA+    +  G+   +MPIFV  S FG +NG  L+ SR+ + AA +  +P  L  +++KY TP+P+V+F++ +S+V+     I+ LI   GF   +  G+AV  +I+ R K P+ PR  ++ L  PI++ +  + + IL+    P +SL+G+ II    P+Y IFV+WK KPKS  +  +++T+ +QK F VVP +K+
Sbjct:    6 TDEVVKESSNDKVELKKEINLLNGIGIIVGSIIGSGIFVSPTEVFIKSGSPGSALIIWFLCGIFSLIGAYCYMELGTMITRSGGDYAYVLDAFGPFIAFLRLWVDVIVARPVSQAIIALVFAEYTLEALYIGCVSPIMAKRLLAAGCIGILTF--INCYSVRWSTLVQDILSYAKVFALLIIIMTGIVKLAQGDTGNWENAFADSSTNPGDYAMAFYAGLFAYNGWNYLNCLIEEMKNPRRDLPLSILISMILIIFIYVLTNMAYFTILLPSEILNTKAVAVTVAI----RLYGVMWWIMPIFVAMSTFGGVNGNLLATSRIFFVAAQENQMPMILETINVKYYTPVPSVLFVSLVSLVYLCFSDINILINYMGFVNWLAIGVAVFTVIWFRYKDPSKPRPIRVHLAFPIIYCVATVILLILSFVGGPYESLMGIVIILTAAPVYWIFVLWK-KPKSFQDKLDNITVVLQKLFYVVPSQKK 479          
BLAST of slc7a-8 vs. Planmine SMEST
Match: SMESG000025359.1 (SMESG000025359.1)

HSP 1 Score: 261.922 bits (668), Expect = 2.894e-81
Identity = 191/482 (39.63%), Postives = 294/482 (61.00%), Query Frame = 3
Query:   63 VKMTTDKIVNHTDIKLQKSIGVFQGMCXXXXXXXXXXXXXXXXXXLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLXXXXXXXXXXXXAYLAVLSPREMLEIXXXXXXXXXXXXDQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKXXXXXXXXXXXXXXXXGILTVYEKPTDSLIGVAXXXXXXXXXXXFVVWKSKPKSVTNLTESLTIYIQKTFLVV----PEE 1496
            VK +  ++V   D+K  K+I +  G+ II+G +IGSGIF+SP GV   T S   S+++W+LCG+++ +G+  YAELG  I +S G+Y Y+ E+FGPL AFI MWI  +     ++A  SL FAQY+L+P++  C+ P  A  L+    +  I  +NC+SVK +TR     T +KV AL+III+ G  KL  G  +++  PF  + T+ G + +AFY G +AY GW+YLN +  EM +P +++P AI  S  +VT+IYV  N++Y  +LS  E+ E    S A+AV    Q  G+   ++P+FV  S FG +NG  L+ SR+   AA    +P+ LAM++ K+ TP+P+V+F+A +S+ +   P I  L+   GF   +  G+AV  LIY RIK   + R  ++ +V PI++L + +F+ I      P +S++G  I+   IP+Y I V+WK KPK    + ES+ I +QK F+V+    PE+
Sbjct:   10 VKSSNGEVVKTIDLK--KTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFE----SNALAVRIGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKRFNRMLESINISVQKMFMVILPAMPEK 485          
The following BLAST results are available for this feature:
BLAST of slc7a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A116.060e-10244.04solute carrier family 7 member 11 [Source:HGNC Sym... [more]
SLC7A67.883e-8140.50solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A67.883e-8140.50solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A56.017e-8043.80solute carrier family 7 member 5 [Source:HGNC Symb... [more]
SLC7A85.017e-7940.09solute carrier family 7 member 8 [Source:HGNC Symb... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aat-17.384e-8242.59Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-17.384e-8242.59Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-33.533e-8041.86Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-31.162e-7941.86Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-26.197e-7442.50Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16071.999e-9041.61gene:FBgn0039844 transcript:FBtr0334550[more]
CG16071.999e-9041.61gene:FBgn0039844 transcript:FBtr0334549[more]
gb2.801e-9041.01gene:FBgn0039487 transcript:FBtr0345216[more]
gb2.801e-9041.01gene:FBgn0039487 transcript:FBtr0085132[more]
gb2.801e-9041.01gene:FBgn0039487 transcript:FBtr0347412[more]
back to top
BLAST of slc7a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a111.902e-9343.32solute carrier family 7 member 11 [Source:ZFIN;Acc... [more]
slc7a62.011e-8342.13solute carrier family 7 member 6 [Source:NCBI gene... [more]
slc7a53.274e-8343.24solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a63.545e-8341.65solute carrier family 7 member 6 [Source:NCBI gene... [more]
slc7a51.897e-8143.22solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A112.099e-10044.83solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A112.018e-9745.15solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A113.795e-9745.15solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A116.170e-9744.92solute carrier family 7 member 11 [Source:NCBI gen... [more]
SLC7A118.369e-9746.10solute carrier family 7 member 11 [Source:NCBI gen... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc7a112.505e-10044.49solute carrier family 7 (cationic amino acid trans... [more]
Slc7a111.032e-9544.66solute carrier family 7 (cationic amino acid trans... [more]
Slc7a63.936e-8140.84solute carrier family 7 (cationic amino acid trans... [more]
Slc7a101.532e-8041.72solute carrier family 7 (cationic amino acid trans... [more]
Slc7a81.823e-8040.55solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of slc7a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UPY5|XCT_HUMAN2.910e-10144.04Cystine/glutamate transporter OS=Homo sapiens OX=9... [more]
sp|Q5RAG7|XCT_PONAB5.368e-10144.04Cystine/glutamate transporter OS=Pongo abelii OX=9... [more]
sp|Q9WTR6|XCT_MOUSE1.752e-9944.49Cystine/glutamate transporter OS=Mus musculus OX=1... [more]
sp|Q59I64|YLAT2_DANRE3.523e-8241.91Y+L amino acid transporter 2 OS=Danio rerio OX=795... [more]
sp|Q7YQK4|LAT1_RABIT1.460e-8144.23Large neutral amino acids transporter small subuni... [more]
back to top
BLAST of slc7a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF650.000e+0100.00Slc7a-8 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YK272.968e-15560.00Slc7a-4 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A564YEX91.516e-14256.49Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
C1L4522.971e-14153.75Cystine/glutamate transporter OS=Schistosoma japon... [more]
Q265943.787e-13855.67Amino acid permease OS=Schistosoma mansoni OX=6183... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a117.827e-9342.86solute carrier family 7 member 11 [Source:NCBI gen... [more]
slc7a8b2.193e-8441.74large neutral amino acids transporter small subuni... [more]
slc7a71.245e-8138.73solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a62.094e-8143.70solute carrier family 7 member 6 [Source:NCBI gene... [more]
slc7a62.094e-8143.70solute carrier family 7 member 6 [Source:NCBI gene... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A112.343e-9142.96solute carrier family 7 member 11 [Source:HGNC Sym... [more]
ENSPMAT00000002665.12.523e-6537.64pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1... [more]
slc7a71.263e-4541.74solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
ENSPMAT00000000258.14.639e-3935.90pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 g... [more]
slc7a52.059e-2135.26solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MUP16.764e-1129.87High affinity methionine permease; integral membra... [more]
MUP32.701e-928.75Low affinity methionine permease; similar to Mup1p... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405514.535e-8240.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415944.114e-7640.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370744.571e-7638.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383778.006e-7440.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411481.179e-7135.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc7a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006048.29.333e-9544.37large neutral amino acids transporter small subuni... [more]
slc7a56.360e-8344.04solute carrier family 7 member 5 [Source:NCBI gene... [more]
slc7a10a8.900e-8241.18asc-type amino acid transporter 1 [Source:NCBI gen... [more]
si:dkeyp-120h9.13.094e-8039.61Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
ENSORLT00000022942.21.610e-7941.04asc-type amino acid transporter 1 [Source:NCBI gen... [more]
back to top
BLAST of slc7a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006721.10.000e+099.37SMESG000006721.1[more]
SMESG000017104.11.012e-16560.43SMESG000017104.1[more]
SMESG000081276.13.469e-14656.87SMESG000081276.1[more]
SMESG000051755.12.090e-8941.16SMESG000051755.1[more]
SMESG000025359.12.894e-8139.63SMESG000025359.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000850
GenBankAKN21452.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000850 ID=SMED30000850|Name=slc7a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1551bp
GGATGAATGAAAATTAATAATTATTATTTTAAACTTATTAAAAAGTGGTT
TTAAAATAAATTGTAAAGATGACAACTGACAAGATAGTTAATCATACTGA
CATTAAATTACAAAAATCAATCGGTGTTTTTCAAGGAATGTGCATCATTA
TCGGAATAATCATTGGCTCTGGTATATTTGTTTCACCAATTGGAGTTTTA
AAATATACAAACTCCGTTGGAATGTCGATGATACTGTGGGTTCTTTGTGG
ACTTTTCAGTGCTCTGGGATCTATAGTATATGCAGAGCTAGGCGTAACGA
TTCCGAAATCTGGTGGAGAATATATTTATATACTAGAATCCTTTGGGCCA
TTATCAGCTTTCATTTGCATGTGGATAACATTTGTTACTATTGGTGGTGT
TAGTCTGGCTGCTAATAGTTTAATATTTGCTCAATATATTTTACAACCAT
TATTTGCATCTTGTGACATTCCCAATTCGGCGCTTATTTTAGTTGGTTTA
CTTGGTCTTGCATCTATCGCGGCGATCAATTGCTACAGTGTCAAATGGGC
TACTAGGGCGACTGTATTTTTTACCATAAGCAAGGTGCTGGCTTTACTGA
TTATCATCGTTATCGGGTTTTATAAATTATTTAGAGGAAATGTTTTGAGT
TTTACTGATCCATTTGCTGATTCGAATACATCTCCAGGTTCCTTAGCTTT
GGCTTTCTATCAAGGGTTTTGGGCTTATGCTGGATGGAATTATTTAAACT
TCCTTACGTCTGAAATGATAAACCCAGCCAGAAATCTGCCGATTGCTATA
ATAGGATCTCTGACAATTGTCACTGTTATATATGTCACTACGAACATTGC
TTATTTGGCAGTTTTATCACCTAGAGAAATGCTGGAAATAAGTTCTAAGT
CGGTTGCTGTTGCAGTGGTTTTTGCTGATCAAACTATGGGAATGTTTTCA
TGCTTAATGCCAATTTTCGTCGGTGCATCAGTATTTGGAAGCATGAATGG
TGAATTCCTTTCTGTTTCAAGATTGACATACACGGCAGCCGGACAAGGTC
ATTTGCCGGAATCTCTAGCCATGGTCAGCATCAAATACTTGACGCCGATG
CCAGCCGTTATTTTTCTGGCAGCTTTGTCGGTAGTGTTTACGTTCACTCC
GAGCATTTCGTACCTCATCGAACTGGCAGGATTTTCATTCTGCGTGATTT
CAGGCATGGCAGTATCATGTCTTATTTATCTACGTATAAAGTGTCCAAAT
TTACCCAGAAGCTTTAAGCTTCCTCTAGTTTTGCCAATTATGTTTCTTTT
ACTGGATTTATTCATTGGGATATTGACAGTCTATGAAAAACCTACAGATT
CCCTTATAGGTGTTGCTATAATTGCCTTAGGAATACCAATATACATTATA
TTTGTTGTCTGGAAATCCAAGCCCAAATCGGTGACCAATCTCACAGAATC
CCTTACTATATATATTCAAAAGACATTTCTTGTCGTACCTGAAGAAAAAG
AAAATTGATACAAAAAACTACTAAATTTCAATTATGATTGAAAATTTTTC
A
back to top

protein sequence of SMED30000850-orf-1

>SMED30000850-orf-1 ID=SMED30000850-orf-1|Name=SMED30000850-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=480bp
MTTDKIVNHTDIKLQKSIGVFQGMCIIIGIIIGSGIFVSPIGVLKYTNSV
GMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFIC
MWITFVTIGGVSLAANSLIFAQYILQPLFASCDIPNSALILVGLLGLASI
AAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFA
DSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTI
VTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIF
VGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFL
AALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFK
LPLVLPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKS
KPKSVTNLTESLTIYIQKTFLVVPEEKEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR002293AA/rel_permease1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 13..468
e-value: 4.3E-83
score: 281.5
NoneNo IPR availablePANTHERPTHR11785AMINO ACID TRANSPORTERcoord: 9..476
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 17..39
NoneNo IPR availableTMHMMTMhelixcoord: 279..301
NoneNo IPR availableTMHMMTMhelixcoord: 429..448
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 366..388
NoneNo IPR availableTMHMMTMhelixcoord: 139..158
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
NoneNo IPR availableTMHMMTMhelixcoord: 165..187
NoneNo IPR availableTMHMMTMhelixcoord: 340..362
NoneNo IPR availableTMHMMTMhelixcoord: 401..419
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
IPR002293Amino acid/polyamine transporter IPFAMPF13520AA_permease_2coord: 18..428
e-value: 2.0E-52
score: 178.4
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 9..461
e-value: 1.4E-68
score: 228.8