Innexin

Overview
NameInnexin
Smed IDSMED30000845
Length (bp)1615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30000845) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30000845) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30000845) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30000845) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000845

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000845SMESG000055261.1 SmedASXL_063274SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000845SMESG000055266.1 SmedASXL_015010SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 304.294 bits (778), Expect = 1.019e-98
Identity = 149/363 (41.05%), Postives = 226/363 (62.26%), Query Frame = 1
Query:  310 RLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLP-KLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWR-LLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWN 1392
            R+DDDF D+LNY ++S +I     +   +QY G PIQCW+P +FT  WE+Y E+YCW+ +TY+ P+    P +  DR+  +ISYYQW   VLA++AL F+IPC++WR LL   SG N+Q + Q+A DA  +  D    +++ IA HM+  L+             +R ++ V+G C  +   NY++ +Y+ IK+LYL NVV Q++++  F+GT   FYG  +L DL+ G EW  SG+FPR+T CDF+ + LG  H +T+QCVL +NMF EKIF+ LWFW  ++  ++AVS+  W+          +FIR YL+  +L    +    K F+  +L  DG+F M +IS + GDI+A +++  LW+
Sbjct:   16 RVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE------------IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSV--KKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 304.294 bits (778), Expect = 1.019e-98
Identity = 149/363 (41.05%), Postives = 226/363 (62.26%), Query Frame = 1
Query:  310 RLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLP-KLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWR-LLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWN 1392
            R+DDDF D+LNY ++S +I     +   +QY G PIQCW+P +FT  WE+Y E+YCW+ +TY+ P+    P +  DR+  +ISYYQW   VLA++AL F+IPC++WR LL   SG N+Q + Q+A DA  +  D    +++ IA HM+  L+             +R ++ V+G C  +   NY++ +Y+ IK+LYL NVV Q++++  F+GT   FYG  +L DL+ G EW  SG+FPR+T CDF+ + LG  H +T+QCVL +NMF EKIF+ LWFW  ++  ++AVS+  W+          +FIR YL+  +L    +    K F+  +L  DG+F M +IS + GDI+A +++  LW+
Sbjct:   16 RVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE------------IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSV--KKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 304.679 bits (779), Expect = 2.444e-98
Identity = 152/379 (40.11%), Postives = 233/379 (61.48%), Query Frame = 1
Query:  310 RLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLP-KLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWR-LLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQ-RHNECEPFKS 1437
            R+DDDF D+LNY ++S +I     +   +QY G PIQCW+P +FT  WE+Y E+YCW+ +TY+ P+    P +  DR+  +ISYYQW   VLA++AL F+IPC++WR LL   SG N+Q + Q+A DA  +  D    +++ IA HM+  L+             +R ++ V+G C  +   NY++ +Y+ IK+LYL NVV Q++++  F+GT   FYG  +L DL+ G EW  SG+FPR+T CDF+ + LG  H +T+QCVL +NMF EKIF+ LWFW  ++  ++AVS+  W+          +FIR YL+  +L    +    K F+  +L  DG+F M +IS + GDI+A +++  LW+ +  + R +  E F+ 
Sbjct:   16 RVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE------------IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSV--KKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKSPIEMFEG 380          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 296.59 bits (758), Expect = 9.008e-96
Identity = 143/372 (38.44%), Postives = 232/372 (62.37%), Query Frame = 1
Query:  286 GKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLP-KLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLY 1398
              + S +  +DDD  D+LNY +++ +I V   L   +QY G PIQCW+P  FT   E+Y E+YCW+ +TYF P+   +P    +R++ +I YYQW   VLA++ALLF++P ++WRLL  QSG ++Q ++Q+A D+  +  +   ++++ IA ++++ L  K    +G + K   L+       C R+SG  ++F+YI +K+LY +N+VGQ++L+  F+G    +YG+QVL DL+ G EW +SGHFPR+T CDF+ K LG  H +T+QCVL +NMF EKIF+ LWFW  ++   T  SL  W+   +    +  F+  YL  +E  K  +    + F+F +LR DG+F++ +++ + G++   ++   LWN Y
Sbjct:   10 SAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLI------ICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 285.804 bits (730), Expect = 1.655e-91
Identity = 143/382 (37.43%), Postives = 234/382 (61.26%), Query Frame = 1
Query:  316 DDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLT-DRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFD-----YLRTDGLFIMHLISINVGDIVAADVVCELWNLY------RSQRHNECE 1425
            DDD  DRLNY ++ +L+++       +QY G+PIQCWIP +FT  WE+Y+E+YC++ +TYF   D+ +P    DR+  +I YYQW   +L +QA+LF++P + WRL+   SG  L++++  AK A+ +      ++ K    H+ + L  +  +     AK+    +Y          G+YL+++Y+ +K LYL+ +V Q  ++  F+GTSY+F+G+ +L D++ G EW +SGHFPR+T CDF+ + LG  H +T+QCVL +NMF EK+++ LWFW VI+G  T ++L++W  KLM R  +   I+ YL++ +    S+++ R   I D      L++DG+FI HLI  N G + + DV+ ++W+ +      RSQ+    E
Sbjct:   16 DDDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDREGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSRF-----AKYTSAFTY---------GGSYLTYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNKHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIED--NFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMWDRFLQDEDNRSQKKQPAE 381          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 108.612 bits (270), Expect = 1.497e-25
Identity = 102/388 (26.29%), Postives = 171/388 (44.07%), Query Frame = 1
Query:  334 RLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKIS---------------YYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWR---KSGHFPRITFCDF-KTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECE-PFKS 1437
            R++Y+ + I++I    L   RQY G PI C I  E   G     ++YCWI  T+  P   RL  +T R  V+                 YYQW   VL  QA+LF++P  +W+       +   R+  +  D N+ I +             D+C   +K          K L+ Y  G     N  N+ +F + + + L  +NV+GQ+Y +  F+   +S YG  VL       + R    +  FP++T C F K    G    +   CVLPLN+  EKI++ LWFW +I+  ++ +SL+  +  +   K +   +R   +L E    SEE      + +       F+++ +  N+  ++  +V+ +L        H+  + PF +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVP--ERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK------SWEGGRLKMLVMDLNSPIVN-------------DECKNDRK----------KILVDYFIGNL---NRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE----SEEV---ELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSAHKRPFDA 367          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 108.612 bits (270), Expect = 1.497e-25
Identity = 102/388 (26.29%), Postives = 171/388 (44.07%), Query Frame = 1
Query:  334 RLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKIS---------------YYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWR---KSGHFPRITFCDF-KTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECE-PFKS 1437
            R++Y+ + I++I    L   RQY G PI C I  E   G     ++YCWI  T+  P   RL  +T R  V+                 YYQW   VL  QA+LF++P  +W+       +   R+  +  D N+ I +             D+C   +K          K L+ Y  G     N  N+ +F + + + L  +NV+GQ+Y +  F+   +S YG  VL       + R    +  FP++T C F K    G    +   CVLPLN+  EKI++ LWFW +I+  ++ +SL+  +  +   K +   +R   +L E    SEE      + +       F+++ +  N+  ++  +V+ +L        H+  + PF +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVP--ERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK------SWEGGRLKMLVMDLNSPIVN-------------DECKNDRK----------KILVDYFIGNL---NRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE----SEEV---ELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSAHKRPFDA 367          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 108.612 bits (270), Expect = 1.497e-25
Identity = 102/388 (26.29%), Postives = 171/388 (44.07%), Query Frame = 1
Query:  334 RLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKIS---------------YYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWR---KSGHFPRITFCDF-KTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECE-PFKS 1437
            R++Y+ + I++I    L   RQY G PI C I  E   G     ++YCWI  T+  P   RL  +T R  V+                 YYQW   VL  QA+LF++P  +W+       +   R+  +  D N+ I +             D+C   +K          K L+ Y  G     N  N+ +F + + + L  +NV+GQ+Y +  F+   +S YG  VL       + R    +  FP++T C F K    G    +   CVLPLN+  EKI++ LWFW +I+  ++ +SL+  +  +   K +   +R   +L E    SEE      + +       F+++ +  N+  ++  +V+ +L        H+  + PF +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVP--ERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK------SWEGGRLKMLVMDLNSPIVN-------------DECKNDRK----------KILVDYFIGNL---NRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE----SEEV---ELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSAHKRPFDA 367          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 108.612 bits (270), Expect = 1.497e-25
Identity = 102/388 (26.29%), Postives = 171/388 (44.07%), Query Frame = 1
Query:  334 RLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKIS---------------YYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWR---KSGHFPRITFCDF-KTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECE-PFKS 1437
            R++Y+ + I++I    L   RQY G PI C I  E   G     ++YCWI  T+  P   RL  +T R  V+                 YYQW   VL  QA+LF++P  +W+       +   R+  +  D N+ I +             D+C   +K          K L+ Y  G     N  N+ +F + + + L  +NV+GQ+Y +  F+   +S YG  VL       + R    +  FP++T C F K    G    +   CVLPLN+  EKI++ LWFW +I+  ++ +SL+  +  +   K +   +R   +L E    SEE      + +       F+++ +  N+  ++  +V+ +L        H+  + PF +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDC-IVDEIPLG---VMDTYCWIYSTFTVP--ERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK------SWEGGRLKMLVMDLNSPIVN-------------DECKNDRK----------KILVDYFIGNL---NRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAE----SEEV---ELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSAHKRPFDA 367          
BLAST of Innexin vs. Ensembl Fly
Match: Inx3 (gene:FBgn0265274 transcript:FBtr0085350)

HSP 1 Score: 83.1889 bits (204), Expect = 8.817e-17
Identity = 93/394 (23.60%), Postives = 160/394 (40.61%), Query Frame = 1
Query:  319 DDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQC----WIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKI-----------SYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSY-VNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVL----------YDLVTGIEWRKSGHFPRITFCDF-KTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLR---TDGLFIMHLISINVGDIVAADVVCELWNLYRSQR 1410
            D+   R +Y+ ++ ++     +       G PI C     IP            ++CWI+ TY  P  +     TD     +           SYYQW   VL  Q L+F++P  +W+               +      +I D L+  +               +     + +  R+L Y VN    + N+ N  SF Y   ++L  +NV+  ++++ +F+G ++  YG  VL          +D +  I       FPR+T C F K    G    +   CVL LN+  EKI+I LWFW +I+  I+ V++L  L  +M    +            ++K+S  S ++  I   +R        I+H +S N+     +D++ +L  L  + R
Sbjct:   26 DNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIPMHVI-------NTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWK--------------NMEDGKIRMITDGLRGMV--------------SVPDDYRRDRQDRILKYFVN----SLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPMIEI-------FPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTR----------ETIIKRSYRSAQRKEIAGLVRRLEIGDFLILHFLSQNLSTRSYSDMLQQLCGLLGASR 363          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.146e-94
Identity = 143/372 (38.44%), Postives = 232/372 (62.37%), Query Frame = 1
Query:  286 GKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLP-KLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLY 1398
              + S +  +DDD  D+LNY +++ +I V   L   +QY G PIQCW+P  FT   E+Y E+YCW+ +TYF P+   +P    +R++ +I YYQW   VLA++ALLF++P ++WRLL  QSG ++Q ++Q+A D+  +  +   ++++ IA ++++ L  K    +G + K   L+       C R+SG  ++F+YI +K+LY +N+VGQ++L+  F+G    +YG+QVL DL+ G EW +SGHFPR+T CDF+ K LG  H +T+QCVL +NMF EKIF+ LWFW  ++   T  SL  W+   +    +  F+  YL  +E  K  +    + F+F +LR DG+F++ +++ + G++   ++   LWN Y
Sbjct:   10 SAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLI------ICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.939e-84
Identity = 136/367 (37.06%), Postives = 227/367 (61.85%), Query Frame = 1
Query:  310 RLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPK-LTDRQDVKISYYQWASIVLAVQALLFFIPCMIWR-LLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGY-KAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLM---ELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWN 1392
            RLDDDF D+LNY +++ ++     L   +QY G PIQCW+P  FT   E+Y E+YCW+ +TY+ P+   +P+ +  R++ +I YYQW   +LA++ALLF++PC++WR LL   SG NLQ ++Q+A DA  +  +   +++  +A HM   ++   I   G+ ++ F  L     G  C R+ G Y++ +YI IKVLY  NV+ Q +L+   +G++   YG  +L DL+  IEW ++G FPR+T CDF+ + LG  H +T+QCVL +NMF EKIF+ LWFW +  G +T  + + W+  +        F+R YL+++        +++   + F  ++LR DG+F++ +IS + G++++++++  LW 
Sbjct:  136 RLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQL---GANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 4.228e-71
Identity = 138/384 (35.94%), Postives = 213/384 (55.47%), Query Frame = 1
Query:  310 RLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYF-NPV-DRRLPKLTDR--QDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARN---SGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTS-YSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELV------KKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNE 1419
            R DDD+SDRLNY  +  +++    L   +Q+ G+PI+C  P +F   WE+YAE+YCW  DTYF  P  D  L K  +R   D ++SYYQW    L +QA  F  P  +W+     SG  +  +++ AKD+  +  +  +K+I  +  H+   L+        ++A  +R    V+      N   S  ++S++Y+  KVLY LNV  QLYLM  F+GT+ + +YG  V+ D+V G  W +SG+FPR   CDF+ +++     Y++QCVL +N+F EKIF+LLWFW VI+   + VSL+ W   L+       F++ +L L  L        + E+S    F+  YL  DG+F++ ++S + G I A D+V  L+  Y  Q  N+
Sbjct:   17 REDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALR--------FQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNK 392          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 236.884 bits (603), Expect = 6.845e-71
Identity = 141/440 (32.05%), Postives = 231/440 (52.50%), Query Frame = 1
Query:  292 IGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPK-LTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIP-DHLQKSIKFIAIH----MDKCLKRKKIYGTGYKA--KFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTS-YSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVK-KSEESWRKN-------------------FIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFKSYDETNLSGYKFINVNKE-ICAEIPGKIDT 1521
            I +  +R DDD  DRLNY ++ +++ V   +   +QY G PI+CW+        EEY ESYCWI +TY+ P+   +P   T R++ +I YYQW   +L  +AL+F +PC+ WRL   QSG N+Q ++  A DA A++     QK+++ I  +    +D      +I   G+ A  KF R LS           G  +S VY   K+LY +NVV Q +++   + +S + F+G QVL D+  G  W ++GHFPR+T CDF+ + L   + YT+QC L +N+  EK+F  LW W +I+  IT  S + W+        K  ++  ++++ E  + K  + + K+                   F+ D+L++DG+ ++ +IS + GD++   +V  LW  YR +   E   F+ ++E      + I   +E I    PG+  +
Sbjct:   12 ISALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIKFSRFLS-----------GQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWRE---FEEHEEMKDVEMRRIQGTRERIVIANPGQTKS 437          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61715|INX19_CAEEL (Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=inx-19 PE=1 SV=2)

HSP 1 Score: 232.261 bits (591), Expect = 4.254e-69
Identity = 137/439 (31.21%), Postives = 229/439 (52.16%), Query Frame = 1
Query:  292 IGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPK-LTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAII-PDHLQKSIKFIAIH----MDKCLKRKKIYGTGYKA--KFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTS-YSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVK-KSEESWRKN-------------------FIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFKSYDETNLSGYKFINVNKEICAEIPGKIDT 1521
            I +  +R DDD  DRLNY ++ +++ V   +   +QY G PI+CW+        EEY ESYCWI +TY+ P+   +P   T R++ +I YYQW   +L  +AL+F +PC+ WRL   QSG N+Q ++  A D  A++     QK+++ I  +    +D      +I   G+ A  KF R LS           G  LS ++   K+LY +NVV Q  ++   + +S + F+G QVL D+  G  W ++GHFPR+T CDF+ + L   + YT+QC L +N+  EK+F  LW W +I+  IT  S + W+        K  ++  ++++ E  + K  + + K+                   F+ D+L++DG+ ++ +IS + GD++   +V  LW  +R +   E   F+ ++E      + I+  + I    PG+  +
Sbjct:   28 INALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIKFSRFLS-----------GQCLSILHSFTKLLYSMNVVAQFLILNACLKSSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRERNWRE---FEEHEEMKDVEMRRIHGGERIVISNPGQTKS 452          
BLAST of Innexin vs. TrEMBL
Match: Q2L6N1 (Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 5.965e-162
Identity = 224/406 (55.17%), Postives = 305/406 (75.12%), Query Frame = 1
Query:  247 EMDATLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDAN-AIIPDHLQKSIKFIAIHMDKCLKRKKI--------YGTGYKAKFKRLLSYVNGGCC-ARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFK 1434
            +MDAT  WR+ KLG+IGSN++R DDDF DRLNYQF+ +L+ + I L G+RQY GKPIQCWIPQEFTRGWEEY E+YCW+S+TYF  +  R+P    R +  I YYQWA I+L +Q+LLF+IPC+IWR +  QSGFN++RI+QVA DAN ++IP+ LQKSI FIA HMD CL R +I           G ++KF R L+ +   CC  +  GN+L+ +YI IK LYL+N++GQLYLM++FIGT Y+FYGI+VL+DL+ G EW  SG+FPR+TFCD + KKLGKNH+Y+LQCVLP+NMFLEKI+I LWFW+VI+G  T  SL SW+ ++ +  ++ + IR+YL+LM ++  +++   + F   YLR+DG F++ LI+IN+GD+VA D++CE+W +YR +R  E E  K
Sbjct:   38 DMDATFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDTRNEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRSNGKRSKFSRCLAKLRCICCLGKLQGNFLTVLYISIKFLYLINIIGQLYLMEKFIGTKYTFYGIRVLWDLMRGHEWHHSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLCSLFSWIRRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELK 443          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GCN3 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 7.687e-155
Identity = 208/396 (52.53%), Postives = 300/396 (75.76%), Query Frame = 1
Query:  250 MDATLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPV-DRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFK 1434
            MDAT +W++ KLG+IGS+++R DDDF+DRLNYQF+ +++ + I L G+RQY GKPIQCWIPQEFTRGWEEYAE+YCW+++TY+  V +  LP    R+   I+YYQWA IVLAVQAL+F++PC+IWRL +  SGFN+++I+Q+A DAN +IP+ L K+I+F+A +M+ C+ R++ Y  G   + K  L+  +  CC +  GN+L  +Y  IKVLYLLNV GQLY+M++F+GT+Y+F+G QVL DL  GI+W +S +FPR+TFCD + KKLG N+ YTLQCVLPLNMFLEKI++ LWFW+V++  +T  S ++W  ++   + +  F+R YLK+M ++K ++++  + F+ +YLR DG+FI  LI++N GDIVA D+ CELW++YR +R  E +  K
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVPEEHLPAEHLRRKRMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNVRKILQMATDANVVIPEALNKNIRFMARYMEGCIYRQREYRRGVGVRVKHCLAKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFVGTTYTFFGFQVLRDLFNGIQWYQSSNFPRVTFCDLQAKKLGVNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLGSFVNWFFRMAFARRRLIFVRKYLKIMNVLKDTDKTTSRKFVENYLRIDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTK 396          
BLAST of Innexin vs. TrEMBL
Match: A0A267EEW5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 7.099e-153
Identity = 213/415 (51.33%), Postives = 307/415 (73.98%), Query Frame = 1
Query:  250 MDATLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDR-RLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFK---SYDETNLSGYKFINVN 1482
            MDAT +W++ KLG+IGS+++R DDDF+DRLNYQF+ +++ + I L G+RQY GKPIQCWIPQEFTRGWEEYAE+YCW+++TY+  V    LP    R ++ I+YYQWA IVLAVQAL+F++PC+IWRL +  SGFNL++I+Q+A DAN +IP+ L K+++F+A +M+ C+ R++ Y  G   + K  LS  +  CC +  GN+L  +Y  IKVLYLLNV GQLY+M++FIGT+Y+F+G +VL D+V GI+W +S +FPR+TFCD + KK G+N+ YTLQCVLPLNMFLEKI++ LWFW+V++  +T  S ++W  ++   + +  FIR YLK+M ++K ++++  + F+ +YLR DG+FI  LI++N GDIVA D+ CELW++YR +R  E +  K    +  T  +G    N N
Sbjct:    1 MDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVQADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDANVVIPEALNKNVRFMARYMEGCIYRQREYRRGVGVRLKHCLSKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTKLEPDHRHTAFAGMNATNGN 415          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GJJ5 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 5.181e-152
Identity = 206/404 (50.99%), Postives = 298/404 (73.76%), Query Frame = 1
Query:  226 GNIGDPTEMDATLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDR-RLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFK 1434
            G I     MDAT +W++ KLG+IGS+R R+DDDF+DRLNYQFS +++ + I L G+RQY GKPIQCWIPQEFTRGWEEYAE+YCW+++TY+  ++   LP+   R  + I+YYQWA IVLAVQAL+F+IPC+IWRL +  SGFN++R++Q+A DAN +IP+ L K+++F+A +M+ C+ R++ Y  G   + +R LS  +  CC +  GN+L  +Y  +K+LYLLN  GQLYLM++F+GT+++F+G +VL D++ G+ W +S +FPR+TFCD + +K+G N+ YTLQCVLPLNMFLEKI++ LWFW  ++  IT  S +SW  ++   + +  F+R YLK+M  +K ++    + F+ +YLR DG+FI+ L+S N GDIVA D+ CELW++YR +R  E E  K
Sbjct:   83 GFILQAPVMDATFMWKLSKLGRIGSSRQRVDDDFADRLNYQFSGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASLEADHLPEEQSRSRLTITYYQWAPIVLAVQALMFYIPCLIWRLFMNYSGFNVRRLLQMAADANVVIPEALNKNVRFMARYMEGCIYRQREYKRGLGVRVRRCLSACSCICCGKRHGNFLVVLYFFVKLLYLLNAFGQLYLMEKFVGTTHTFFGFRVLLDILQGVHWYRSSNFPRVTFCDLQARKIGVNYRYTLQCVLPLNMFLEKIYVFLWFWVALVSVITMSSFVSWFCRMAFARRRTGFVRKYLKIMNALKDTDRLTSRKFVENYLRVDGVFILRLVSANCGDIVAGDLACELWSIYRHKRLQELEDTK 486          

HSP 2 Score: 66.2402 bits (160), Expect = 9.942e-8
Identity = 28/81 (34.57%), Postives = 53/81 (65.43%), Query Frame = 1
Query: 1090 LPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMH 1332
            LP+N F+EK+++ LWFW +I+G +T +S + W+ +++    +  +I+ YL+ M+L+  +E+   K F+ + L  DG FI+ 
Sbjct:    7 LPINHFVEKVYVFLWFWYIILGVLTLLSTIIWMLRILIPGGRVAYIKQYLRAMKLISNTEDRDCKRFVANSLGPDGGFILQ 87          
BLAST of Innexin vs. TrEMBL
Match: A0A1I8GHL0 (Innexin OS=Macrostomum lignano OX=282301 GN=inx PE=3 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 8.715e-148
Identity = 215/420 (51.19%), Postives = 310/420 (73.81%), Query Frame = 1
Query:  235 GDPTEMDATLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDR-RLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFK---SYDETNLSGYKFINVN 1482
            G  +EMDAT +W++ KLG+IGS+++R DDDF+DRLNYQF+ +++ + I L G+RQY GKPIQCWIPQEFTRGWEEYAE+YCW+++TY+  V    LP    R ++ I+YYQWA IVLAVQAL+F++PC+IWRL +  SGFNL++I+Q+A DAN +IP+ L K+++F+A +M+ C+ R++ Y  G   + K  LS  +  CC +  GN+L  +Y  IKVLYLLNV GQLY+M++FIGT+Y+F+G +VL D+V GI+W +S +FPR+TFCD + KK G+N+ YTLQCVLPLNMFLEKI++ LWFW+V++  +T  S ++W  ++   + +  FIR YLK+M ++K ++++  + F+ +YLR DG+FI  LI++N GDIVA D+ CELW++YR +R  E +  K    +  T  +G    N N
Sbjct:  562 GHGSEMDATFMWKLSKLGRIGSSKLRFDDDFADRLNYQFTGVILFLFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYAENYCWVANTYYASVQADHLPPQHIRNELMITYYQWAPIVLAVQALMFYLPCLIWRLFMNYSGFNLRKILQMATDANVVIPEALNKNVRFMARYMEGCIYRQREYRRGVGVRLKHCLSKCSCLCCGKRYGNFLVVLYFFIKVLYLLNVFGQLYIMEKFIGTTYTFFGFRVLLDIVHGIKWYQSSNFPRVTFCDLQAKKEGQNYHYTLQCVLPLNMFLEKIYVFLWFWHVLVSIVTLTSFVNWFFRMAFARRRLNFIRKYLKIMNVLKDTDKTTSRKFVENYLRVDGVFIFRLIAMNCGDIVAGDLACELWSIYRHKRLQELDDTKLEPDHRHTAFAGMNATNGN 981          

HSP 2 Score: 166.777 bits (421), Expect = 3.990e-40
Identity = 77/219 (35.16%), Postives = 142/219 (64.84%), Query Frame = 1
Query:  409 KPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTD--RQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLG 1059
            KPIQCW+PQEF++ WE++AE+YCW+S+TYF   ++ +P  T+  +Q   I+YYQW +IVLA QA++ +IP ++WR+        L  +++ A+ A+    D  +K+++ +   +++  +  +        ++ R+ + V    C  +    L+ +++I+++L++ N +GQ+YLM++F+GT+ +F+G +VL  L  G EWR++GHFPR+T+C    +K+G
Sbjct:    1 KPIQCWVPQEFSKAWEDFAENYCWVSNTYFLMPEQDIPVKTEQLKQMTFITYYQWVAIVLAGQAIITWIPHLLWRV----GARRLPVLIKNARGASIPDTDLRRKAVQCLVAALEEQAEASR--------RYSRMKNVVEKFLCCLSPSMRLTMLFLIVRILFIGNSIGQIYLMRQFLGTNDTFFGYEVLKSLTLGREWRETGHFPRVTYCHLVVRKVG 207          

HSP 3 Score: 93.2041 bits (230), Expect = 4.480e-16
Identity = 45/118 (38.14%), Postives = 69/118 (58.47%), Query Frame = 1
Query: 1072 YTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECE 1425
            + LQCVLP+N F+EK+++ LWFW +I+G +T  S L W+ K +    +  FI+ YLK M ++  +EE     F+   L  DG+FI+ ++S    D++A DV   LW  YR  +    E
Sbjct:  390 FDLQCVLPINHFVEKVYVFLWFWFIILGVLTFASTLLWVFKTLIPYRRVAFIKQYLKAMRILSNTEERDCNRFVNINLGADGVFILQVVSNLASDLIALDVASTLWKNYRQAKITGTE 507          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000055266.1 (SMESG000055266.1)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 377/377 (100.00%), Postives = 377/377 (100.00%), Query Frame = 1
Query:  406 GKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFKSYDETNLSGYKFINVNKEICAEIPGKIDTNDDIV 1536
            GKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFKSYDETNLSGYKFINVNKEICAEIPGKIDTNDDIV
Sbjct:   43 GKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFKSYDETNLSGYKFINVNKEICAEIPGKIDTNDDIV 419          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000024134.1 (SMESG000024134.1)

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 357/421 (84.80%), Postives = 375/421 (89.07%), Query Frame = 1
Query:  274 MGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFKSYDETNLSGYKFINVNKEICAEIPGKIDTNDDIV 1536
            MGKLG+IGSNRIRL DDFSDR+NYQFSSILIIVLISLTGV QYFGKPIQCWIPQEF+ GWEEY+ESYCWIS TY  PV+RRLP+LTD+QDV+ISYYQW SIVLAVQALLFFIPCM+WRLLILQSGFNLQRIMQVA DAN IIPDHLQKSIKFIAIHMDKCLK KKIYGTGYKAKFKRL                L FVYIIIKVLYLLN++GQLYLMQRFIGTSYSFYGIQVLYDL+TGI W +SG+FPR+TFCDF  KKLGKNHIYT+QCVLP NMFLEKIFI LWFWNVIIGCITAVSL  WLNKLM RK KFRFI DYLKLM L K SEESW++NFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQR NECEP KSYDETN SGYK INVNKEICAEIPGKIDTNDDI 
Sbjct:    1 MGKLGRIGSNRIRLVDDFSDRINYQFSSILIIVLISLTGVWQYFGKPIQCWIPQEFSTGWEEYSESYCWISGTY--PVNRRLPELTDKQDVQISYYQWTSIVLAVQALLFFIPCMMWRLLILQSGFNLQRIMQVAVDANVIIPDHLQKSIKFIAIHMDKCLKSKKIYGTGYKAKFKRLFCN-------------LLFVYIIIKVLYLLNIIGQLYLMQRFIGTSYSFYGIQVLYDLMTGIGWPQSGNFPRVTFCDFTAKKLGKNHIYTIQCVLPFNMFLEKIFIFLWFWNVIIGCITAVSLFCWLNKLMTRKLKFRFIGDYLKLMGLAKNSEESWKENFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRQNECEPLKSYDETNFSGYKLINVNKEICAEIPGKIDTNDDIA 406          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000060499.1 (SMESG000060499.1)

HSP 1 Score: 468.389 bits (1204), Expect = 2.354e-161
Identity = 219/402 (54.48%), Postives = 301/402 (74.88%), Query Frame = 1
Query:  259 TLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDAN-AIIPDHLQKSIKFIAIHMDKCLKRKKI--------YGTGYKAKFKRLLSYVNGGCC-ARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFK 1434
            T  WR+ KLG+IGSN++R DDDF DRLNYQF+ +L+ + I L G+RQY GKPIQCWIPQEFTRGWEEY E+YCW+S+TYF  +  R+P    R++  I YYQWA I+L +Q+LLF+IPC+IWR +  QSGFN++RI+QVA DAN ++IP+ LQKSI FIA HMD CL R +I           G ++   R L+ +   CC  +  GN+L+ +YI IK+LYL+N++GQLYLM++FIGT Y+FYGI+VL+DL+ G EW  SG+FPR+TFCD + KKLGKNH+Y+LQCVLP+NMFLEKI+I LWFW+VI+G  T  SL SW+ ++ +  ++ + IR+YL+LM ++  +++   + F   YLR+DG F++ LI+IN+GD+VA D++CE+W +YR +R  E E  K
Sbjct:   42 TFFWRLSKLGRIGSNKLRFDDDFVDRLNYQFTGLLLFMFIGLIGIRQYVGKPIQCWIPQEFTRGWEEYTENYCWVSNTYFASIQNRMPSKDARKEQMIGYYQWAPILLGLQSLLFYIPCLIWRNVSPQSGFNVRRILQVASDANCSLIPEQLQKSISFIARHMDTCLYRHRICYEHKHFMRTNGKRSTISRCLAKLRCICCLGKLQGNFLTVLYISIKILYLINIIGQLYLMEKFIGTKYAFYGIRVLWDLMRGHEWHYSGNFPRVTFCDLEAKKLGKNHLYSLQCVLPMNMFLEKIYIFLWFWHVIVGIATLFSLFSWIKRIGSPVNRIKMIRNYLRLMNILHDTDKGPSRKFAESYLRSDGCFLIQLIAINIGDLVAGDLICEMWQIYRHKRIQEFEELK 443          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000024134.1 (SMESG000024134.1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.140e-146
Identity = 221/266 (83.08%), Postives = 236/266 (88.72%), Query Frame = 1
Query:  274 MGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHI 1071
            MGKLG+IGSNRIRL DDFSDR+NYQFSSILIIVLISLTGV QYFGKPIQCWIPQEF+ GWEEY+ESYCWIS TY  PV+RRLP+LTD+QDV+ISYYQW SIVLAVQALLFFIPCM+WRLLILQSGFNLQRIMQVA DAN IIPDHLQKSIKFIAIHMDKCLK KKIYGTGYKAKFKRL        C       L FVYIIIKVLYLLN++GQLYLMQRFIGTSYSFYGIQVLYDL+TGI W +SG+FPR+TFCDF  KKLGKNHI
Sbjct:    1 MGKLGRIGSNRIRLVDDFSDRINYQFSSILIIVLISLTGVWQYFGKPIQCWIPQEFSTGWEEYSESYCWISGTY--PVNRRLPELTDKQDVQISYYQWTSIVLAVQALLFFIPCMMWRLLILQSGFNLQRIMQVAVDANVIIPDHLQKSIKFIAIHMDKCLKSKKIYGTGYKAKFKRLF-------CN------LLFVYIIIKVLYLLNIIGQLYLMQRFIGTSYSFYGIQVLYDLMTGIGWPQSGNFPRVTFCDFTAKKLGKNHI 251          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048374.1 (SMESG000048374.1)

HSP 1 Score: 427.172 bits (1097), Expect = 7.525e-146
Identity = 199/393 (50.64%), Postives = 289/393 (73.54%), Query Frame = 1
Query:  250 MDATLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFXXXXXXXXXXXTGVRQYFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVKISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAIIPDHLQKSIKFIAIHMDKCL-------KRKKIYGTGYKAKFKRLLSYVNGGCCARNSGNYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEWRKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVIIGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQ 1407
            MDATLVW++ KLG++GS+ +R DDD+ DRLNYQ +  L  + I + G+R Y GKPIQCW PQEF + WE+Y+E++CW+S+T++ P++  LP   D+    I YYQW  IVLAVQAL+F+IPC+IWRLL+  SGFN++RI+Q+A D N+++PD   K+IKFIA ++D C+       KR +I   G +  +++  +  +  CC  N G +L F+Y I+KVLY++NV+ Q+YLM+RF+GT  +F+G++VL DL+ G EW  SG+FPR+TFC+ +TKKLG+N+IY LQCVLPLNMFLEKI+I LWF+ VI+G IT  S  SWL ++   K +++FIR YLK++  +++++ +    F  + LR DG+FI++L++INVG IVA D+  ELWN+YR +
Sbjct:    1 MDATLVWKIAKLGRVGSSHLRFDDDWVDRLNYQITCFLHFLFIGVLGLRSYIGKPIQCWAPQEFNKAWEDYSENFCWVSNTFYAPINNNLPLRMDKTSKLIGYYQWTPIVLAVQALMFYIPCLIWRLLMNYSGFNVRRIIQMAGDTNSLVPDINSKNIKFIARYIDTCIDRNYRDCKRNQISVDGKQLNYRKKCNCFSRHCCHTNHGRFLFFLYGIVKVLYVINVLLQMYLMKRFLGTDSNFFGVKVLVDLINGFEWNHSGNFPRVTFCEVQTKKLGENNIYNLQCVLPLNMFLEKIYIFLWFYYVILGIITTASFCSWLLRMGYVKSRWKFIRKYLKILNAMRETDNTATLKFTENNLRPDGVFIIYLVTINVGHIVAGDLTVELWNIYRHK 393          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-11.019e-9841.05Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.019e-9841.05Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-12.444e-9840.11Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-99.008e-9638.44Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-131.655e-9137.43Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx21.497e-2526.29gene:FBgn0027108 transcript:FBtr0301860[more]
Inx21.497e-2526.29gene:FBgn0027108 transcript:FBtr0071005[more]
Inx21.497e-2526.29gene:FBgn0027108 transcript:FBtr0332314[more]
Inx21.497e-2526.29gene:FBgn0027108 transcript:FBtr0071006[more]
Inx38.817e-1723.60gene:FBgn0265274 transcript:FBtr0085350[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.146e-9438.44Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL1.939e-8437.06Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL4.228e-7135.94Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|A8WVX4|INX19_CAEBR6.845e-7132.05Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|O61715|INX19_CAEEL4.254e-6931.21Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6N15.965e-16255.17Innexin OS=Dugesia japonica OX=6161 GN=inx3 PE=2 S... [more]
A0A1I8GCN37.687e-15552.53Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A267EEW57.099e-15351.33Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A1I8GJJ55.181e-15250.99Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
A0A1I8GHL08.715e-14851.19Innexin OS=Macrostomum lignano OX=282301 GN=inx PE... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055266.10.000e+0100.00SMESG000055266.1[more]
SMESG000024134.10.000e+084.80SMESG000024134.1[more]
SMESG000060499.12.354e-16154.48SMESG000060499.1[more]
SMESG000024134.11.140e-14683.08SMESG000024134.1[more]
SMESG000048374.17.525e-14650.64SMESG000048374.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000845 ID=SMED30000845|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1615bp
TTAGAATTCCATTAAATAAAATATTTCATTTCATTTCAATTTAATTGTTT
AAATTATTTGGGGAAAATAAATGATCTTACAATTTTAAAATGTTAAATTG
CAATCGGTTGGAAATGGATTTTCGTCAAGAGACGTTATGAAAAAAGAGCC
ATACAAATATTGGACAACTACCTCCGAATCTTTTCGAACTGACATAAACT
CCAATTATCATTCACGTTCCACCGAGGCAATATTGGTGATCCGACAGAAA
TGGATGCAACTCTTGTATGGAGAATGGGCAAACTGGGAAAAATCGGCTCA
AACAGAATAAGGCTTGATGACGACTTTTCCGATAGATTAAATTACCAATT
TTCCAGCATTCTTATAATCGTGTTAATAAGTCTAACTGGGGTGAGGCAGT
ATTTTGGTAAGCCAATTCAGTGTTGGATACCCCAAGAATTTACCAGAGGT
TGGGAAGAATATGCCGAAAGTTACTGCTGGATCTCAGACACGTATTTCAA
TCCTGTTGATAGGCGTTTACCGAAGCTTACTGATAGACAAGATGTAAAAA
TAAGTTATTACCAATGGGCATCTATTGTGTTAGCAGTTCAAGCGCTTTTA
TTCTTCATTCCTTGTATGATATGGCGTTTGTTAATCTTACAATCTGGATT
TAATCTTCAACGAATAATGCAGGTGGCAAAAGATGCCAATGCAATTATTC
CTGATCATTTGCAAAAAAGCATTAAATTTATTGCAATTCATATGGATAAA
TGTTTGAAAAGAAAGAAGATTTACGGAACAGGATATAAAGCAAAATTTAA
AAGACTTCTCTCATACGTTAATGGAGGATGTTGTGCTCGAAATTCGGGAA
ATTATCTCTCATTTGTGTATATTATCATTAAAGTACTCTATTTGCTCAAC
GTTGTCGGACAACTTTATTTAATGCAAAGATTTATTGGCACTAGTTACTC
TTTCTATGGAATACAGGTTCTTTATGACTTAGTGACAGGAATCGAATGGC
GCAAATCTGGTCATTTTCCTAGAATTACATTTTGTGATTTCAAAACAAAG
AAATTAGGTAAAAATCATATCTATACTCTACAATGCGTATTGCCGTTGAA
CATGTTTCTTGAGAAAATATTCATTTTACTCTGGTTTTGGAACGTAATAA
TCGGTTGTATCACCGCTGTCAGTTTGTTGAGTTGGTTGAACAAATTAATG
AACAGAAAGCACAAGTTCCGATTTATTAGAGATTATCTTAAATTAATGGA
ATTGGTGAAGAAATCCGAAGAATCGTGGAGAAAAAATTTCATTTTCGATT
ACTTACGAACAGATGGATTATTTATAATGCATTTGATATCTATCAATGTC
GGGGACATTGTAGCAGCGGATGTAGTCTGCGAATTGTGGAATTTGTACCG
CTCCCAACGACATAACGAATGTGAACCTTTTAAATCGTATGACGAAACAA
ACTTGAGTGGATACAAATTCATAAATGTTAACAAAGAAATCTGTGCGGAA
ATACCGGGAAAAATTGACACAAATGATGACATTGTTTGATTTTGTCCGGC
ACCCTCTTTATTATTGTTGGAATTTACTGATGAATTTATAAGCTTTTATT
TTTTACTAACAATAC
back to top

protein sequence of SMED30000845-orf-1

>SMED30000845-orf-1 ID=SMED30000845-orf-1|Name=SMED30000845-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=430bp
MDATLVWRMGKLGKIGSNRIRLDDDFSDRLNYQFSSILIIVLISLTGVRQ
YFGKPIQCWIPQEFTRGWEEYAESYCWISDTYFNPVDRRLPKLTDRQDVK
ISYYQWASIVLAVQALLFFIPCMIWRLLILQSGFNLQRIMQVAKDANAII
PDHLQKSIKFIAIHMDKCLKRKKIYGTGYKAKFKRLLSYVNGGCCARNSG
NYLSFVYIIIKVLYLLNVVGQLYLMQRFIGTSYSFYGIQVLYDLVTGIEW
RKSGHFPRITFCDFKTKKLGKNHIYTLQCVLPLNMFLEKIFILLWFWNVI
IGCITAVSLLSWLNKLMNRKHKFRFIRDYLKLMELVKKSEESWRKNFIFD
YLRTDGLFIMHLISINVGDIVAADVVCELWNLYRSQRHNECEPFKSYDET
NLSGYKFINVNKEICAEIPGKIDTNDDIV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport