IPPc domain-containing protein

Overview
NameIPPc domain-containing protein
Smed IDSMED30000817
Length (bp)1687
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IPPc domain-containing protein (SMED30000817) t-SNE clustered cells

Violin plots show distribution of expression levels for IPPc domain-containing protein (SMED30000817) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IPPc domain-containing protein (SMED30000817) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IPPc domain-containing protein (SMED30000817) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000817

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000817SMESG000026603.1 dd_Smed_v4_3627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000817SMESG000026603.1 dd_Smed_v4_3627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000817SMESG000026603.1 dd_Smed_v4_3627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000817SMESG000026603.1 dd_Smed_v4_3627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000817SMESG000026603.1 dd_Smed_v4_3627_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IPPc domain-containing protein vs. Ensembl Human
Match: INPP5K (inositol polyphosphate-5-phosphatase K [Source:HGNC Symbol;Acc:HGNC:33882])

HSP 1 Score: 190.66 bits (483), Expect = 7.697e-54
Identity = 133/440 (30.23%), Postives = 204/440 (46.36%), Query Frame = 2
Query:   74 IKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY------LTHDDDKILNQ---NTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKY--FSGIP-SKSELQLIYFSKRMNCIQGISNNF 1324
            + + ++T+NV   +      D L    +    D   IGLQE+             + SW++ +       +++ V    +  I L + AK   LP++  + ++ T +G  G  GNKGGV+I  K +   +  +N H  PH      RL  +  I+  Q+    ++ NILDHD+I W GD+NFRIE+     +  +IK + +  L + DQL+ A KH  + + F+EG L F PT+KFD + + YDTS+KKRKPAWTDRIL+          D  I      +  L  Y S  +   SDH+PV   F +      S  L +   E   +WT + D +V+Y   S+                F    WDWIGL       ++ D ++Y +V      D +   S    + Y   S IP ++ E  L Y+S  +  + GIS  F
Sbjct:   14 LSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFNDSWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYGYYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPE--DLWTVENDMMVSYSSTSD----------------FPSSPWDWIGLYKVGLRDVN-DYVSYAWVG-----DSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVGISRPF 429          
BLAST of IPPc domain-containing protein vs. Ensembl Human
Match: INPP5J (inositol polyphosphate-5-phosphatase J [Source:HGNC Symbol;Acc:HGNC:8956])

HSP 1 Score: 194.126 bits (492), Expect = 1.362e-53
Identity = 128/376 (34.04%), Postives = 180/376 (47.87%), Query Frame = 2
Query:   71 NIKVKLITYNVGDKSADQSKPDELFNFVQLRKFD------FIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY--------LTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
              ++ ++T+NVG        PD++ + + L   D       I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+      ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+         +    K          Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:   55 GFRITVVTWNVGTAM----PPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSDHKPVAAQFLLQFAFRDD--MPLVRLEVADEWVRPEQAVVRYRM--------ETV--------FARSSWDWIGL 408          
BLAST of IPPc domain-containing protein vs. Ensembl Human
Match: INPP5J (inositol polyphosphate-5-phosphatase J [Source:HGNC Symbol;Acc:HGNC:8956])

HSP 1 Score: 194.126 bits (492), Expect = 1.362e-53
Identity = 128/376 (34.04%), Postives = 180/376 (47.87%), Query Frame = 2
Query:   71 NIKVKLITYNVGDKSADQSKPDELFNFVQLRKFD------FIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY--------LTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
              ++ ++T+NVG        PD++ + + L   D       I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+      ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+         +    K          Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:   55 GFRITVVTWNVGTAM----PPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSDHKPVAAQFLLQFAFRDD--MPLVRLEVADEWVRPEQAVVRYRM--------ETV--------FARSSWDWIGL 408          
BLAST of IPPc domain-containing protein vs. Ensembl Human
Match: INPP5J (inositol polyphosphate-5-phosphatase J [Source:HGNC Symbol;Acc:HGNC:8956])

HSP 1 Score: 193.741 bits (491), Expect = 1.851e-53
Identity = 128/374 (34.22%), Postives = 180/374 (48.13%), Query Frame = 2
Query:   77 KVKLITYNVGDKSADQSKPDELFNFVQLRKFD------FIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY--------LTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
            ++ ++T+NVG        PD++ + + L   D       I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+      ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+         +    K          Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:   56 RITVVTWNVGTAMP----PDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSDHKPVAAQFLLQFAFRDD--MPLVRLEVADEWVRPEQAVVRYRM--------ETV--------FARSSWDWIGL 407          
BLAST of IPPc domain-containing protein vs. Ensembl Human
Match: INPP5J (inositol polyphosphate-5-phosphatase J [Source:HGNC Symbol;Acc:HGNC:8956])

HSP 1 Score: 188.734 bits (478), Expect = 3.950e-52
Identity = 120/336 (35.71%), Postives = 163/336 (48.51%), Query Frame = 2
Query:  173 FIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY--------LTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
             I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+      ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+         +    K          Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:   23 MIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSDHKPVAAQFLLQFAFRDD--MPLVRLEVADEWVRPEQAVVRYRM--------ETV--------FARSSWDWIGL 340          
BLAST of IPPc domain-containing protein vs. Ensembl Celegans
Match: unc-26 (Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5ECL2])

HSP 1 Score: 157.147 bits (396), Expect = 2.624e-40
Identity = 94/269 (34.94%), Postives = 137/269 (50.93%), Query Frame = 2
Query:  170 DFIFIGLQEVV-------------QDTSWTALIKKCFGEHN-YVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKI 934
            D + IG++E+V                 W   I+K   E   +VL+    +  + L+L A+    P++         +G  G  GNKG V+ R      SI  +  HF   +   +DR  D+    T +  R      I  HDVIFW+GD N+RI NLS +E++NA++   ++ L ++DQL +       F GF EG+L FAPT+K+D   D YDTS+K R PAWTDRIL+     D+     T+L+  Y    ++ SDHRPV A FK+
Sbjct:  569 DIVAIGVEELVDLNASNMVKASTTNQRMWCESIRKTLSEKAPFVLIGSEQLVGVCLFLFARPRVSPYLKDFAVASVKTGMGGATGNKGSVAFRIVVFSTSICFICSHFAAGQNEIRDRNEDF--ATTLKKIRFPLGREIDSHDVIFWLGDFNYRI-NLSGDEVKNAVRNGDYAKLVENDQLTQQKALGQTFVGFNEGQLTFAPTYKYDTFSDDYDTSEKCRAPAWTDRILW----KDQRKKGKTQLLS-YDRSELKTSDHRPVGAVFKV 829          
BLAST of IPPc domain-containing protein vs. Ensembl Celegans
Match: unc-26 (Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5ECL2])

HSP 1 Score: 157.147 bits (396), Expect = 2.941e-40
Identity = 94/269 (34.94%), Postives = 137/269 (50.93%), Query Frame = 2
Query:  170 DFIFIGLQEVV-------------QDTSWTALIKKCFGEHN-YVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKI 934
            D + IG++E+V                 W   I+K   E   +VL+    +  + L+L A+    P++         +G  G  GNKG V+ R      SI  +  HF   +   +DR  D+    T +  R      I  HDVIFW+GD N+RI NLS +E++NA++   ++ L ++DQL +       F GF EG+L FAPT+K+D   D YDTS+K R PAWTDRIL+     D+     T+L+  Y    ++ SDHRPV A FK+
Sbjct:  575 DIVAIGVEELVDLNASNMVKASTTNQRMWCESIRKTLSEKAPFVLIGSEQLVGVCLFLFARPRVSPYLKDFAVASVKTGMGGATGNKGSVAFRIVVFSTSICFICSHFAAGQNEIRDRNEDF--ATTLKKIRFPLGREIDSHDVIFWLGDFNYRI-NLSGDEVKNAVRNGDYAKLVENDQLTQQKALGQTFVGFNEGQLTFAPTYKYDTFSDDYDTSEKCRAPAWTDRILW----KDQRKKGKTQLLS-YDRSELKTSDHRPVGAVFKV 835          
BLAST of IPPc domain-containing protein vs. Ensembl Celegans
Match: ocrl-1 (OCRL (Lowe's oculocerebrorenal syndrome protein) homolog [Source:UniProtKB/TrEMBL;Acc:A5Z2U3])

HSP 1 Score: 112.079 bits (279), Expect = 1.121e-25
Identity = 93/331 (28.10%), Postives = 148/331 (44.71%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQ-------SKPDELFNFVQLRKFDFIFIGLQE--------VVQDT----SWTALIKKCF--GEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGV---LGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSF---------RDDE----VNNILDHDVIFWMGDLNFRIEN----LSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKE-GELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKI 934
            +++K+ + T+NV  +S           KP+++         +F  +GLQE        ++ +T     W   I      G   + +V    +  I++ +    +    V  V  +  A+G + +   LGNKGG ++  K ++  +  VN HF       + R  D+ DI     F         RD      +  + DHDV+FW GDLN+R+      +S +E+        F+ L  H QL + +    VFK F+E   L F PT+K+D   +T+DTS+K R PAWTDRIL         L     ++   S  +I  SDH+PV A F +
Sbjct:   93 QDVKICVSTFNVNGRSPLSVFPTWFSQKPEDIA--------EFYAVGLQEMDLSVGTYIIDNTKKMEGWVDAIHCSLPGGRTQFNVVGSMRLVGIFVIVFQAVNSKVRVSDVNVKYVATGISVLVNKLGNKGGTAVSMKMNDTWVCFVNAHFAAGNNELERRNQDFRDIYNDMVFYPRSQQEGLRDRPLEVPIMCLYDHDVVFWFGDLNYRLNTDMYGISNDEVRRIASSDKFADLLQHCQLREQMARGTVFKDFEEPSTLPFRPTYKYDCGTNTWDTSEKGRVPAWTDRILTFKKYPQVGLESIRPMV---SIDTITISDHKPVRAMFNL 412          
BLAST of IPPc domain-containing protein vs. Ensembl Celegans
Match: cil-1 (Inositol polyphosphate 5-phosphatase [Source:UniProtKB/Swiss-Prot;Acc:P34370])

HSP 1 Score: 109.383 bits (272), Expect = 1.184e-25
Identity = 105/425 (24.71%), Postives = 174/425 (40.94%), Query Frame = 2
Query:   77 KVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQD-------TSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRL-PHVDSVESEVTASGYAGVLGNKGGVSIRFKYHE-ISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNF 1324
            K+ + TYN+  K++D      + N +       + IGLQEV           +W   I      +  +++  +   A    L+  R +L   +  ++     +   G+ G+KG + +R +     SI+ V+ HF    E +  R+  Y       SF +D+          FW GD NFR+E      I          +L   +QL +A+   + F GF E  + F PT++        D    KR P+WTDRILY     D I       + Y +      SDH PV A F+++  +    +  + F  +   W      +  +Q   N    KE       +G ++    DWIG+ PS+    +  T  ++Y     E  ++     KF    F+ IP+    +L YFS  ++C+ G+S  F
Sbjct:    4 KITIFTYNLAMKASDSEAVHNMLNGMIDDHTHLVAIGLQEVAHSETIGGAVLTWATTIASWMNTNGRMVLLAKTFQATNQVLIFGRKQLIGQIKRIDYRFQRNTMGGLTGHKGSIGVRLQLASPYSIVFVDSHFIHGPENYGKRVEQY-HTNRNCSFPEDK-----SVRAAFWFGDFNFRVEEDVNTVIRKIKNGTHLELLDTREQLKRALVERDAFIGFHEQPVTFEPTYRVTVGTTEQD---GKRVPSWTDRILY---KGDGITG-----LSYTNNKKAVASDHLPVVAMFRVTAPAAPKPQWEVIFEHLP-TWYTSIPLVGRFQV--NELYYKE-------NGSYR----DWIGVFPSSINDCTTAT-NWIYAATCFEQVIE---GSKFLACEFNNIPA-GNYRLGYFSCHLHCLVGLSKVF 392          
BLAST of IPPc domain-containing protein vs. Ensembl Celegans
Match: inpp-1 (INositol Polyphosphate-5-Phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EBY9])

HSP 1 Score: 85.8853 bits (211), Expect = 1.089e-17
Identity = 80/305 (26.23%), Postives = 133/305 (43.61%), Query Frame = 2
Query:   74 IKVKLITYNVGDKSAD--QSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWT------ALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASG-YAGVLGNKGGVSIRFKYHE--ISIIGVN-GHFTPHEEGFKDRLNDYLDIVTG------QSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENA--IKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEF 928
            +KV  +T+N+ +K          ++    Q    D  FI LQE+   T+ T       +++     H   L      W+  + +  ++  L +    +    ASG  A  +  KG +++  + ++  I +IG +  H TP +     R+ DY  +V          F     + I   DV+ W+GDLNFR+   S  +  +   I EK+F  + + ++L    K    F  FKE  + F PT KF+ D D Y     KR P++TDR+L+   + + + N     I+Y        SDH+ V A F
Sbjct:  107 LKVCTVTWNINEKGVKILSHLAQKIAERGQEMDSDIFFISLQEI-PSTAPTFHEEALRILEPVLNGHRLYLS--HRAWSQMVIVFIRQKHLRYAIQPQVSFIASGAMAKPVRTKGAIAVCLRLYQRFIVLIGCHLSHATPQQ-----RIQDYAKVVRTLRFPQLARFHAHAKDEIFGSDVVLWIGDLNFRVTVESNVDWRDPEKITEKTFRDVFETEELASHRKKQLAFTDFKEAPIKFPPTHKFEPDTDNY---VPKRIPSFTDRVLFWVRNSEWLQN-----IQYDCMRGTTPSDHKAVFATF 395          
BLAST of IPPc domain-containing protein vs. Ensembl Fly
Match: CG9784 (gene:FBgn0030761 transcript:FBtr0330409)

HSP 1 Score: 167.548 bits (423), Expect = 4.557e-45
Identity = 116/399 (29.07%), Postives = 178/399 (44.61%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNF-----------VQLRKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENL-SKEEIENAIKEKS-FSVLTDHDQLNKAV-KHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKI--LNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLP-IEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYV 1177
            +E  +V ++T+NVG +  D      L                    D   +GLQEV            ++  WT   K+    ++YV VK   +  + L +  +R  + H+  +E+E T +G+ G+ GNKG VS+RF  +   +  V  H T H+    +R+ DY  I+    +       I DHD +FW GDLNFR++   S  E+   ++++S    L   DQL +   K    F+  +E    F PTFKF +    YD    KR+PAWTDRI+Y     ++   +  + E   Y S P    SDH+PV ++F I      + R P + F+ +S +W    +  V Y                H    F     DWIG+ PS +  L+ D + Y YV
Sbjct:   28 LETYRVYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDL---KRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLYP--NVRAPGVVFSPLS-LWKIGDENTVEY----------------HKQAEFDEGSNDWIGIFPSEYASLA-DYVAYEYV 403          
BLAST of IPPc domain-containing protein vs. Ensembl Fly
Match: CG9784 (gene:FBgn0030761 transcript:FBtr0074289)

HSP 1 Score: 167.162 bits (422), Expect = 4.639e-45
Identity = 116/399 (29.07%), Postives = 178/399 (44.61%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNF-----------VQLRKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENL-SKEEIENAIKEKS-FSVLTDHDQLNKAV-KHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKI--LNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLP-IEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYV 1177
            +E  +V ++T+NVG +  D      L                    D   +GLQEV            ++  WT   K+    ++YV VK   +  + L +  +R  + H+  +E+E T +G+ G+ GNKG VS+RF  +   +  V  H T H+    +R+ DY  I+    +       I DHD +FW GDLNFR++   S  E+   ++++S    L   DQL +   K    F+  +E    F PTFKF +    YD    KR+PAWTDRI+Y     ++   +  + E   Y S P    SDH+PV ++F I      + R P + F+ +S +W    +  V Y                H    F     DWIG+ PS +  L+ D + Y YV
Sbjct:   28 LETYRVYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDL---KRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLYP--NVRAPGVVFSPLS-LWKIGDENTVEY----------------HKQAEFDEGSNDWIGIFPSEYASLA-DYVAYEYV 403          
BLAST of IPPc domain-containing protein vs. Ensembl Fly
Match: CG9784 (gene:FBgn0030761 transcript:FBtr0310319)

HSP 1 Score: 167.162 bits (422), Expect = 4.639e-45
Identity = 116/399 (29.07%), Postives = 178/399 (44.61%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNF-----------VQLRKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENL-SKEEIENAIKEKS-FSVLTDHDQLNKAV-KHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKI--LNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLP-IEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYV 1177
            +E  +V ++T+NVG +  D      L                    D   +GLQEV            ++  WT   K+    ++YV VK   +  + L +  +R  + H+  +E+E T +G+ G+ GNKG VS+RF  +   +  V  H T H+    +R+ DY  I+    +       I DHD +FW GDLNFR++   S  E+   ++++S    L   DQL +   K    F+  +E    F PTFKF +    YD    KR+PAWTDRI+Y     ++   +  + E   Y S P    SDH+PV ++F I      + R P + F+ +S +W    +  V Y                H    F     DWIG+ PS +  L+ D + Y YV
Sbjct:   28 LETYRVYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLFKEDPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENHHYHVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAFQVLQERLPAFPPTFKFREGTSEYDL---KRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPLYTISDHKPVTSDFTIKLYP--NVRAPGVVFSPLS-LWKIGDENTVEY----------------HKQAEFDEGSNDWIGIFPSEYASLA-DYVAYEYV 403          
BLAST of IPPc domain-containing protein vs. Ensembl Fly
Match: CG6805 (gene:FBgn0034179 transcript:FBtr0306574)

HSP 1 Score: 145.976 bits (367), Expect = 1.058e-38
Identity = 93/305 (30.49%), Postives = 144/305 (47.21%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKF------DFIFIGLQEV---------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIE-NLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDD-KILNQNTELIKYYSEPSIRGSDHRPVCAEF 928
            + ++ + L+T+NVG  +        L +             D   IG QEV           D  W   I     +H +V V  + +  I + + A+   +PH+  +E+E T +G  G+ GNKG VSIR   +   +  V  H   H+E  K+R+ DY  IV    +       I DHD +FW GDLNFR+  ++S  ++   ++ + ++ L   DQLN   +  N F   +E + NFAPTFKF +  + Y+    KR+PAW DRIL+    +    +  +   + Y S      SDH+PV A F
Sbjct:    7 IADLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFNDDPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNL---KRRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATF 308          
BLAST of IPPc domain-containing protein vs. Ensembl Fly
Match: CG6805 (gene:FBgn0034179 transcript:FBtr0086966)

HSP 1 Score: 145.591 bits (366), Expect = 1.618e-38
Identity = 93/305 (30.49%), Postives = 144/305 (47.21%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKF------DFIFIGLQEV---------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIE-NLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDD-KILNQNTELIKYYSEPSIRGSDHRPVCAEF 928
            + ++ + L+T+NVG  +        L +             D   IG QEV           D  W   I     +H +V V  + +  I + + A+   +PH+  +E+E T +G  G+ GNKG VSIR   +   +  V  H   H+E  K+R+ DY  IV    +       I DHD +FW GDLNFR+  ++S  ++   ++ + ++ L   DQLN   +  N F   +E + NFAPTFKF +  + Y+    KR+PAW DRIL+    +    +  +   + Y S      SDH+PV A F
Sbjct:    7 IADLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFNDDPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNL---KRRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATF 308          
BLAST of IPPc domain-containing protein vs. Ensembl Zebrafish
Match: inpp5ja (inositol polyphosphate-5-phosphatase Ja [Source:ZFIN;Acc:ZDB-GENE-091117-4])

HSP 1 Score: 209.92 bits (533), Expect = 5.280e-60
Identity = 145/438 (33.11%), Postives = 205/438 (46.80%), Query Frame = 2
Query:   77 KVKLITYNVGDKSADQSKPDELFNF----VQLRKFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY-LTHDDDKILNQNTELIK----YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNFSF 1330
            K+ ++T+NVG        PD++ +     ++    D   +GLQEV       ++D      W+ L         YVLV  + +  ++L + +K   LP +  V+++ T +G  G  GNKGGVS R       +  +N H   H    + R+ D+  I+  Q F       +LDHDV+FW GDLNFRIE      +++AI+     +L + DQLN A K  +V +GF EG L F PT+KFD    TYDTS KKRKPAWTDRIL+ L      + + N+ L      Y S      SDH+PV A F + F  + +  LP+   E+ K WT   D  V                    HG F+   WDW+GL    +    +D   YV+  A  EH  Q    V F  +     P   E  L Y+S  MN I G++  F  
Sbjct:   40 KLHIVTWNVGSGMP----PDDITSLFGPGIENGSTDMFVVGLQEVNSMINKRLKDALFTDQWSELCMDTLSRFGYVLVASQRMQGVFLLVFSKFCHLPFLRGVQTQSTRTGLGGYWGNKGGVSARMMVFGHPVCFLNCHLPAHMRNLEQRMEDFESILQQQQFEGSNAVGVLDHDVVFWFGDLNFRIEGYDIHVVKSAIENDKLPLLWEKDQLNMAKKSESVLEGFIEGPLKFPPTYKFDVGTHTYDTSAKKRKPAWTDRILWRLRRTGSPVPSHNSALQVSQHFYCSHMGFTISDHKPVSALFSLHFPFKVT--LPLVTLEVEKEWTKFSDATVKLTM---------------AHG-FQRSSWDWVGLYKVGFK-HHKDYAAYVW--AKSEHSTQ----VVFSEEDLPRDP--GEYILGYYSNNMNSIAGVTEPFQL 446          
BLAST of IPPc domain-containing protein vs. Ensembl Zebrafish
Match: inpp5ja (inositol polyphosphate-5-phosphatase Ja [Source:ZFIN;Acc:ZDB-GENE-091117-4])

HSP 1 Score: 204.912 bits (520), Expect = 5.799e-60
Identity = 143/430 (33.26%), Postives = 202/430 (46.98%), Query Frame = 2
Query:   86 LITYNVGDKSADQSKPDELFNF----VQLRKFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY-LTHDDDKILNQNTELIK----YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGIS 1315
            ++T+NVG        PD++ +     ++    D   +GLQEV       ++D      W+ L         YVLV  + +  ++L + +K   LP +  V+++ T +G  G  GNKGGVS R       +  +N H   H    + R+ D+  I+  Q F       +LDHDV+FW GDLNFRIE      +++AI+     +L + DQLN A K  +V +GF EG L F PT+KFD    TYDTS KKRKPAWTDRIL+ L      + + N+ L      Y S      SDH+PV A F + F  + +  LP+   E+ K WT   D  V                    HG F+   WDW+GL    +    +D   YV+  A  EH  Q    V F  +     P   E  L Y+S  MN I G++
Sbjct:    1 IVTWNVGSGMP----PDDITSLFGPGIENGSTDMFVVGLQEVNSMINKRLKDALFTDQWSELCMDTLSRFGYVLVASQRMQGVFLLVFSKFCHLPFLRGVQTQSTRTGLGGYWGNKGGVSARMMVFGHPVCFLNCHLPAHMRNLEQRMEDFESILQQQQFEGSNAVGVLDHDVVFWFGDLNFRIEGYDIHVVKSAIENDKLPLLWEKDQLNMAKKSESVLEGFIEGPLKFPPTYKFDVGTHTYDTSAKKRKPAWTDRILWRLRRTGSPVPSHNSALQLSQHFYCSHMGFTISDHKPVSALFSLHFPFKVT--LPLVTLEVEKEWTKFSDATVKLTMA---------------HG-FQRSSWDWVGLYKVGFK-HHKDYAAYVW--AKSEHSTQ----VVFSEEDLPRDP--GEYILGYYSNNMNSIAGVT 399          
BLAST of IPPc domain-containing protein vs. Ensembl Zebrafish
Match: inpp5jb (inositol polyphosphate-5-phosphatase Jb [Source:ZFIN;Acc:ZDB-GENE-081104-46])

HSP 1 Score: 204.527 bits (519), Expect = 3.284e-58
Identity = 138/449 (30.73%), Postives = 205/449 (45.66%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQLR----KFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIK--------------YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKS-ELQLIYFSKRMNCIQGISNNF 1324
            E+ ++ ++T+NVG        P+++ N + L       D   IGLQEV       ++D      W+ +         YVL   + +  + L + AK   LP +  ++++ T +G  G+ GNKGGVS R      SI  +N H   H E  + R+ D+  I+  Q F       +LDHDV+FW GDLNFRIE+L  + ++ AI     SVL + DQLN A     V +GF EG L F PT+KFD   DTYDTS KKR PAWTDRIL+      ++ N  ++                 Y S      SDH+PV + F + F  +    L   F E    W    D +  ++   N                F    WDWIG+    +    +D + Y +   +    L+++  V F  +    +P +S +  L Y+S   + I GI+  F
Sbjct:  144 EDFRIHIVTWNVGSAM----PPEDITNLLGLNVGDGNTDMYIIGLQEVNSMINKRLKDVLFTDQWSEVCMDALSPFGYVLATSQRMQGMLLLVFAKYFHLPFLRGIQTQTTRTGLGGIWGNKGGVSARMTVFGHSICFLNCHLPAHMENTEQRMEDFESILQQQQFDGQAATGVLDHDVVFWFGDLNFRIEDLEMQVVKGAIDNNKLSVLWEKDQLNIAKDSETVLEGFHEGPLKFPPTYKFDVGTDTYDTSGKKRMPAWTDRILWRLRPMAQVSNSTSKRSSLSGLTSGTRVSQHFYRSHMEYTVSDHKPVSSVFTLQFPYKVDMPLVTIFVE--DEWREISDAVAKFKVAPN----------------FARSSWDWIGIYKVGFK-HHKDYVAYTWAKQEESDFLRQEHQVNFTEEE---LPKESGDFILGYYSNNTSSIVGITEPF 566          
BLAST of IPPc domain-containing protein vs. Ensembl Zebrafish
Match: inpp5ka (inositol polyphosphate-5-phosphatase Ka [Source:ZFIN;Acc:ZDB-GENE-070410-101])

HSP 1 Score: 197.593 bits (501), Expect = 2.507e-56
Identity = 141/461 (30.59%), Postives = 207/461 (44.90%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQL---RKFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELI-------------------KYYSEPSIRG-SDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQ-------LIYFSKRMNCIQGISNNF 1324
            MEN  + ++T+NV    A    PD++   +QL   +K D   IGLQEV       V D     SW+ L        +Y+ V    +  + L   +K   +P +  ++   T +G  G  GNKGGV+IR  ++   +  +N H T H      R++++  I+  Q+F      ++LDH V+FW GDLNFRIE+     + N I  + F++L   DQL    +   + + F+EG L+F PT+KFD + D YDTS KKRKPAW DRIL+       +     E                     +YY+     G SDH+PV   F++    R  +  P+        W+AD D ++TY+                    F    WDWIGL    +  +S D ITY +V  D          V F  + F    +K E+        L Y+S  + CI GIS  F
Sbjct:   21 MENFGLYVVTWNV----ATAEPPDDVNALLQLNSPKKPDLYVIGLQEVRAAPLKFVSDLAFEDSWSHLFMDTLSPLHYIKVSSIRMQGLLLLFFSKLEHVPFIRDIQVTYTRTGLYGYWGNKGGVTIRLSFYGHMLCFLNCHLTAHMNYASQRVDEFEHILDAQNFNTKNTPHVLDHKVVFWFGDLNFRIEDHGMLFVRNCITSQRFNLLWPKDQLTMMKQKEVILQKFEEGPLDFQPTYKFDLNSDNYDTSGKKRKPAWCDRILWRVKPKASLTENTNEEEPEKQQEEEREDEFPLKMTQEYYTSKMEYGISDHKPVIGIFRLEL--RKMYETPLVQVFAEGEWSADFDAVITYRLLQ----------------AFASSAWDWIGLYKVGFKSVS-DYITYAWVKDD---------QVSFNEELFQVYMNKDEIPVLGGECVLCYYSSNLQCIVGISQPF 449          
BLAST of IPPc domain-containing protein vs. Ensembl Zebrafish
Match: inpp5kb (inositol polyphosphate-5-phosphatase Kb [Source:ZFIN;Acc:ZDB-GENE-100408-3])

HSP 1 Score: 187.963 bits (476), Expect = 5.134e-53
Identity = 132/451 (29.27%), Postives = 209/451 (46.34%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQL---RKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYL-----------------THDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIP-SKSELQLIYFSKRMNCIQGISNNF 1324
            +  ++ ++T+NVG        P ++ + +QL      D   IGLQEV           + + +W+ L+ +      Y+ V    +  + L L AK+  LP +  ++S  T +G  G  GNKGG+S+RF ++   +  +N H   H      R++++  I+  Q F       +LDH V+FW GDLNFRI +     + ++I    F++L D DQL+   K   + + F+EG L F PT+KFD   +TY+TS KKRKPAWTDRIL+                  + DDD+   + T+ + Y  + S   SDH+PV   F +    R     P+    +  +W+AD+D + TY    N                F+   +DWIGL    +   S D  T+ +V  D   ++     V   +   + +P    +  L YFS  M  +   S NF
Sbjct:   13 QAFRLHMVTWNVGTAEP----PADVRSLLQLDSQPTTDLYVIGLQEVNATPVRYISDLIAEDTWSHLLMETLAPEGYIKVTSVRMQGLLLILFAKQVHLPFIRDIQSTYTRTGLFGYWGNKGGISVRFSFYGEMLCFLNCHLAAHMNYALQRMDEFEYILDTQEFDMFNTPQVLDHKVVFWFGDLNFRIADHGMHFLRSSINNSRFNLLWDRDQLSMLKKKEPILQEFEEGPLRFKPTYKFDRFSETYNTSGKKRKPAWTDRILWRIKPKATEIEDEKSSTASSADDDEFSVKVTQDM-YTCDVSYGVSDHKPVIGTFNLEM--RKKVETPLVALTVEGIWSADEDAIFTYTILEN----------------FESSTFDWIGLYKIGFKSAS-DYSTFAWVKDD---EVAANGEVVMVQMNKNELPLLAGDYVLGYFSTNMQTLIAFSPNF 436          
BLAST of IPPc domain-containing protein vs. Ensembl Xenopus
Match: inpp5k (inositol polyphosphate-5-phosphatase K [Source:NCBI gene;Acc:100127685])

HSP 1 Score: 197.208 bits (500), Expect = 2.494e-56
Identity = 143/449 (31.85%), Postives = 198/449 (44.10%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQL----RKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHD-DDKILNQNT----------ELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSG--IP-SKSELQLIYFSKRMNCIQGISNNF 1324
            ++++KV LIT+NV    A QS P ++ + +Q        D   IGLQEV             D  W+  +        YV +    +  + L    K   +P +  + +    +G  G  GNKGGV +R   +   +  +N H   H E    RL+D+  ++  Q F DD   NILDHD++F  GDLNFRI +     I  AI    +++L + DQLN A K     +GF EG L F PT+KFD + D YDTS KKRKPAWTDRIL+   D  D    + T           L KY S  S   SDH+PV   F +    +     P    +    W AD D L++Y    +                F    WDWIGL    +   + D +TY +V  D     +   S    + Y +   IP    E  L Y    + C+ GIS  F
Sbjct:    1 IDSLKVHLITWNV----ATQSPPRDVSSLLQFDIPGSDIDMYIIGLQEVNSKVLNFLSDLAFDDPWSIYLMDILAPLGYVKLSSIRLQGLLLLTFVKHQHIPFIQDIRTNYIRTGLFGYWGNKGGVIVRMSVYGHMVCFMNCHLPAHMENTNQRLDDFERMLDTQQFDDDNTGNILDHDLVFCFGDLNFRITDFGIHFIREAINSNKYNLLWEKDQLNIAKKKEPFLQGFLEGPLKFKPTYKFDQNSDVYDTSSKKRKPAWTDRILWKLKDVSDSDPGETTGLDFEQFLKVRLDKYTSHMSYGISDHKPVTGTFTLQL--KPLILSPSVTLKPEGEWNADHDSLISYSVAKD----------------FPSSTWDWIGLYRVGFR-HTNDYVTYAWVKDD-----EISFSEDCNQVYINADDIPLDGGEFLLCYHCHNLQCLAGISQPF 421          
BLAST of IPPc domain-containing protein vs. Ensembl Xenopus
Match: cacna1i (calcium channel, voltage-dependent, T type, alpha 1I subunit [Source:Xenbase;Acc:XB-GENE-983863])

HSP 1 Score: 195.282 bits (495), Expect = 3.797e-56
Identity = 132/401 (32.92%), Postives = 190/401 (47.38%), Query Frame = 2
Query:   77 KVKLITYNVGDKSADQSKPDELFNFVQLR----KFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY-----LTHDDDKILNQ--------NTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQ-CPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCE 1192
            ++ +IT+NVG        P +L + + L     K D   IGLQEV       ++D      W+ +        +YVLV    +    L + +K   LP +  ++++ T +G  G  GNKGGVSIR       +  +N H   H E    R++++  I+  Q F+    N +LDHD++FW GDLNFRIE+L    +++AI+    ++L + DQLN A     V  GF EG L F PT+KFD   +TYDTS KKRKPAWTDRIL+     +T    K L          +  L+ Y S      SDH+PV A F + F S      P+    +   W    D  V Y+ CP                  +    WDWIGL    +    +D ++YV+  +D E
Sbjct:   13 RIYVITWNVGCAVP----PSDLTSLLCLNARDDKIDMFVIGLQEVNSMINKRLKDALFSDQWSEVFMDVLSPFSYVLVSSVRMQGCLLLVFSKYFHLPFLRDIQTDCTRTGLGGYWGNKGGVSIRLSLFGHMVCFLNCHLPAHMENTDQRVDNFESILQLQQFQGPLANGVLDHDLVFWFGDLNFRIEDLDLHFVKSAIQGNKLALLWEKDQLNMAKIFEPVLNGFMEGSLTFPPTYKFDVGTNTYDTSSKKRKPAWTDRILWKMKCPITQSPAKQLGTISTRSKELSVTLLSYGSHMQYTESDHKPVSAIFSLQFAS--CLAAPLVQLLVRDEWLQPDDAHVIYRWCPG-----------------YMKSSWDWIGLYRVGFR-HHKDYVSYVWAKSDEE 389          
BLAST of IPPc domain-containing protein vs. Ensembl Xenopus
Match: inpp5k (inositol polyphosphate-5-phosphatase K [Source:NCBI gene;Acc:100127685])

HSP 1 Score: 196.052 bits (497), Expect = 4.608e-56
Identity = 146/451 (32.37%), Postives = 199/451 (44.12%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQL----RKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYV--LVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHD-DDKILNQNT----------ELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSG--IP-SKSELQLIYFSKRMNCIQGISNNF 1324
            +EN+ V LIT+NV    A QS P ++ + +Q        D   IGLQEV             D  W+  +        YV  L  +R +  + L    K   +P +  + +    +G  G  GNKGGV +R   +   +  +N H   H E    RL+D+  ++  Q F DD   NILDHD++F  GDLNFRI +     I  AI    +++L + DQLN A K     +GF EG L F PT+KFD + D YDTS KKRKPAWTDRIL+   D  D    + T           L KY S  S   SDH+PV   F +    +     P    +    W AD D L++Y    +                F    WDWIGL    +   + D +TY +V  D     +   S    + Y +   IP    E  L Y    + C+ GIS  F
Sbjct:    1 IENVLVHLITWNV----ATQSPPRDVSSLLQFDIPGSDIDMYIIGLQEVNSKVLNFLSDLAFDDPWSIYLMDILAPLGYVKVLSSIR-LQGLLLLTFVKHQHIPFIQDIRTNYIRTGLFGYWGNKGGVIVRMSVYGHMVCFMNCHLPAHMENTNQRLDDFERMLDTQQFDDDNTGNILDHDLVFCFGDLNFRITDFGIHFIREAINSNKYNLLWEKDQLNIAKKKEPFLQGFLEGPLKFKPTYKFDQNSDVYDTSSKKRKPAWTDRILWKLKDVSDSDPGETTGLDFEQFLKVRLDKYTSHMSYGISDHKPVTGTFTLQL--KPLILSPSVTLKPEGEWNADHDSLISYSVAKD----------------FPSSTWDWIGLYRVGFR-HTNDYVTYAWVKDD-----EISFSEDCNQVYINADDIPLDGGEFLLCYHCHNLQCLAGISQPF 422          
BLAST of IPPc domain-containing protein vs. Ensembl Xenopus
Match: cacna1i (calcium channel, voltage-dependent, T type, alpha 1I subunit [Source:Xenbase;Acc:XB-GENE-983863])

HSP 1 Score: 202.601 bits (514), Expect = 6.015e-56
Identity = 143/449 (31.85%), Postives = 210/449 (46.77%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQLR----KFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY-----LTHDDDKILNQ--------NTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQ-CPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQR-QASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNF 1324
            ++ ++ +IT+NVG        P +L + + L     K D   IGLQEV       ++D      W+ +        +YVLV    +    L + +K   LP +  ++++ T +G  G  GNKGGVSIR       +  +N H   H E    R++++  I+  Q F+    N +LDHD++FW GDLNFRIE+L    +++AI+    ++L + DQLN A     V  GF EG L F PT+KFD   +TYDTS KKRKPAWTDRIL+     +T    K L          +  L+ Y S      SDH+PV A F + F S      P+    +   W    D  V Y+ CP                  +    WDWIGL    +    +D ++YV+  +D E +  + Q  V F  +        SE  L YFS  +  + G++  F
Sbjct:  181 KDFRIYVITWNVGCAVP----PSDLTSLLCLNARDDKIDMFVIGLQEVNSMINKRLKDALFSDQWSEVFMDVLSPFSYVLVSSVRMQGCLLLVFSKYFHLPFLRDIQTDCTRTGLGGYWGNKGGVSIRLSLFGHMVCFLNCHLPAHMENTDQRVDNFESILQLQQFQGPLANGVLDHDLVFWFGDLNFRIEDLDLHFVKSAIQGNKLALLWEKDQLNMAKIFEPVLNGFMEGSLTFPPTYKFDVGTNTYDTSSKKRKPAWTDRILWKMKCPITQSPAKQLGTISTRSKELSVTLLSYGSHMQYTESDHKPVSAIFSLQFAS--CLAAPLVQLLVRDEWLQPDDAHVIYRWCPG-----------------YMKSSWDWIGLYRVGFR-HHKDYVSYVWAKSDEETERGKHQHEVVFSEELLPK--GTSEYLLGYFSNNLGTLIGVTEPF 603          
BLAST of IPPc domain-containing protein vs. Ensembl Xenopus
Match: cacna1i (calcium channel, voltage-dependent, T type, alpha 1I subunit [Source:Xenbase;Acc:XB-GENE-983863])

HSP 1 Score: 196.052 bits (497), Expect = 7.706e-56
Identity = 132/405 (32.59%), Postives = 192/405 (47.41%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLR----KFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY-----LTHDDDKILNQ--------NTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQ-CPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCE 1192
            + + ++ +IT+NVG        P +L + + L     K D   IGLQEV       ++D      W+ +        +YVLV    +    L + +K   LP +  ++++ T +G  G  GNKGGVSIR       +  +N H   H E    R++++  I+  Q F+    N +LDHD++FW GDLNFRIE+L    +++AI+    ++L + DQLN A     V  GF EG L F PT+KFD   +TYDTS KKRKPAWTDRIL+     +T    K L          +  L+ Y S      SDH+PV A F + F S      P+    +   W    D  V Y+ CP                  +    WDWIGL    +    +D ++YV+  +D E
Sbjct:   28 LPSPRIYVITWNVGCAVP----PSDLTSLLCLNARDDKIDMFVIGLQEVNSMINKRLKDALFSDQWSEVFMDVLSPFSYVLVSSVRMQGCLLLVFSKYFHLPFLRDIQTDCTRTGLGGYWGNKGGVSIRLSLFGHMVCFLNCHLPAHMENTDQRVDNFESILQLQQFQGPLANGVLDHDLVFWFGDLNFRIEDLDLHFVKSAIQGNKLALLWEKDQLNMAKIFEPVLNGFMEGSLTFPPTYKFDVGTNTYDTSSKKRKPAWTDRILWKMKCPITQSPAKQLGTISTRSKELSVTLLSYGSHMQYTESDHKPVSAIFSLQFAS--CLAAPLVQLLVRDEWLQPDDAHVIYRWCPG-----------------YMKSSWDWIGLYRVGFR-HHKDYVSYVWAKSDEE 408          
BLAST of IPPc domain-containing protein vs. Ensembl Mouse
Match: Inpp5j (inositol polyphosphate 5-phosphatase J [Source:MGI Symbol;Acc:MGI:2158663])

HSP 1 Score: 196.052 bits (497), Expect = 3.372e-55
Identity = 127/376 (33.78%), Postives = 183/376 (48.67%), Query Frame = 2
Query:   71 NIKVKLITYNVGDKSADQSKPDELFNFVQLRK------FDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY---LTHDDDKILNQNTELIK-----YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
              ++ ++T+NVG        PD++ + + L         D I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+    + ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+             + +  ++     Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:   48 GFRITVVTWNVGTAM----PPDDVTSLLHLGSGHDNDGADMIAIGLQEVNSMINKRLKDALFTDQWSELFMDALGPFNFVLVSTVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAHGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDD--VPLVRLEVADEWARPEQAVVRYRV--------ETV--------FARSSWDWIGL 401          
BLAST of IPPc domain-containing protein vs. Ensembl Mouse
Match: Inpp5j (inositol polyphosphate 5-phosphatase J [Source:MGI Symbol;Acc:MGI:2158663])

HSP 1 Score: 196.438 bits (498), Expect = 1.954e-53
Identity = 127/377 (33.69%), Postives = 183/377 (48.54%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQLRK------FDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY---LTHDDDKILNQNTELIK-----YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
               ++ ++T+NVG        PD++ + + L         D I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+    + ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+             + +  ++     Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:  418 PGFRITVVTWNVGTAM----PPDDVTSLLHLGSGHDNDGADMIAIGLQEVNSMINKRLKDALFTDQWSELFMDALGPFNFVLVSTVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAHGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDD--VPLVRLEVADEWARPEQAVVRYRV--------ETV--------FARSSWDWIGL 772          
BLAST of IPPc domain-containing protein vs. Ensembl Mouse
Match: Inpp5j (inositol polyphosphate 5-phosphatase J [Source:MGI Symbol;Acc:MGI:2158663])

HSP 1 Score: 195.282 bits (495), Expect = 7.712e-53
Identity = 127/377 (33.69%), Postives = 183/377 (48.54%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQLRK------FDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY---LTHDDDKILNQNTELIK-----YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
               ++ ++T+NVG        PD++ + + L         D I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+    + ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+             + +  ++     Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:  418 PGFRITVVTWNVGTAM----PPDDVTSLLHLGSGHDNDGADMIAIGLQEVNSMINKRLKDALFTDQWSELFMDALGPFNFVLVSTVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAHGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDD--VPLVRLEVADEWARPEQAVVRYRV--------ETV--------FARSSWDWIGL 772          
BLAST of IPPc domain-containing protein vs. Ensembl Mouse
Match: Inpp5k (inositol polyphosphate 5-phosphatase K [Source:MGI Symbol;Acc:MGI:1194899])

HSP 1 Score: 186.037 bits (471), Expect = 4.037e-52
Identity = 132/441 (29.93%), Postives = 200/441 (45.35%), Query Frame = 2
Query:   74 IKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQE-------VVQDTS----WTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTE----------LIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKY--FSGIP-SKSELQLIYFSKRMNCIQGISNNF 1324
            + V ++T+NV   +      D L    Q    D   IGLQE       ++ D +    W++L        N+V +    +  + L + AK   LP++  + ++ T +G  G  GNKGGV++  K +   +  +N H  PH      RL  +  I+   +F   +V NILDHD+I W GD+NFRIE+     ++ +I  K +  L + DQL  A K+  + + F+EG L F PT+KFD   + YDTS+KKRKPAWTDRIL+         +              L  Y S  +   SDH+PV   F +  N   S  +P+       +WT + D L++Y                     F    WDWIGL       ++ D + YV+V      D Q        + Y   S IP ++ +  L Y+S  ++ + GIS  F
Sbjct:   32 LSVHVVTWNVASAAPTVDLSDLLQLNNQDLNLDIYIIGLQEMNFGIISLLSDAAFEDPWSSLFMDMLSPLNFVKISQVRMQGLLLLVFAKYQHLPYIQIISTKSTPTGLYGYWGNKGGVNVCLKLYGYYVSIINCHLPPHMYNNDQRLEHFDRILESLTFEGYDVPNILDHDLILWFGDMNFRIEDFGLLFVQESITRKYYKELWEKDQLFIAKKNDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRKPAWTDRILWRLKRQPSQASPLASSVPTSYFLLTLKNYVSHMAYSISDHKPVTGTFDLELNPLMS--VPLITMMPEHLWTMENDMLISYTSTP----------------EFLSSSWDWIGLYKVGMRHIN-DYVAYVWVG-----DNQVSYGNNPNQVYINISAIPDTEDQFLLCYYSNNLHSVVGISQPF 448          
BLAST of IPPc domain-containing protein vs. Ensembl Mouse
Match: Inpp5b (inositol polyphosphate-5-phosphatase B [Source:MGI Symbol;Acc:MGI:103257])

HSP 1 Score: 177.563 bits (449), Expect = 4.325e-47
Identity = 107/309 (34.63%), Postives = 156/309 (50.49%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQS----------KPDEL---FNFVQLRKFDFIFIGLQEVVQDTSW-TALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNN----ILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKIS 937
            ++N +  + TYNV  +S  +            PD     F  + L K  F F    +  ++  W  A+ +    +  Y  VK   +  I L L  K+    ++  VE+E   +G  G +GNKGGV+IRF+ H  SI  VN H   H E ++ R  DY DI +   F   + +     I  HDVI W+GDLN+RIE L   +++  ++EK+F  L  HDQL   V    +F GF EGE+ F PT+K+D   D +DTS+K R PAW DRIL+          +N   + Y S  +++ SDH+PV + F I 
Sbjct:  342 IQNFRFFVGTYNVNGQSPKECLRPWLSHSALAPDVYCVGFQELDLSKEAFFF---HDTPKEEEWFKAVSESLHPDAKYAKVKFVRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQLHNTSICVVNSHLAAHTEEYERRNQDYRDICSRMQFPQVDPSQPPLTINKHDVILWLGDLNYRIEELDVGKVKKLVEEKAFQTLYAHDQLKIQVAARTIFDGFTEGEITFQPTYKYDTGSDDWDTSEKCRAPAWCDRILW--------KGKNITQLSYQSHMALKTSDHKPVSSVFDIG 639          
BLAST of IPPc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BT40|INP5K_HUMAN (Inositol polyphosphate 5-phosphatase K OS=Homo sapiens OX=9606 GN=INPP5K PE=1 SV=3)

HSP 1 Score: 190.66 bits (483), Expect = 3.696e-53
Identity = 133/440 (30.23%), Postives = 204/440 (46.36%), Query Frame = 2
Query:   74 IKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY------LTHDDDKILNQ---NTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKY--FSGIP-SKSELQLIYFSKRMNCIQGISNNF 1324
            + + ++T+NV   +      D L    +    D   IGLQE+             + SW++ +       +++ V    +  I L + AK   LP++  + ++ T +G  G  GNKGGV+I  K +   +  +N H  PH      RL  +  I+  Q+    ++ NILDHD+I W GD+NFRIE+     +  +IK + +  L + DQL+ A KH  + + F+EG L F PT+KFD + + YDTS+KKRKPAWTDRIL+          D  I      +  L  Y S  +   SDH+PV   F +      S  L +   E   +WT + D +V+Y   S+                F    WDWIGL       ++ D ++Y +V      D +   S    + Y   S IP ++ E  L Y+S  +  + GIS  F
Sbjct:   14 LSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFNDSWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYGYYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPE--DLWTVENDMMVSYSSTSD----------------FPSSPWDWIGLYKVGLRDVN-DYVSYAWVG-----DSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVGISRPF 429          
BLAST of IPPc domain-containing protein vs. UniProt/SwissProt
Match: sp|P59644|PI5PA_MOUSE (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus OX=10090 GN=Inpp5j PE=1 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 5.395e-52
Identity = 127/377 (33.69%), Postives = 183/377 (48.54%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQLRK------FDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY---LTHDDDKILNQNTELIK-----YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
               ++ ++T+NVG        PD++ + + L         D I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+    + ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+             + +  ++     Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:  418 PGFRITVVTWNVGTAM----PPDDVTSLLHLGSGHDNDGADMIAIGLQEVNSMINKRLKDALFTDQWSELFMDALGPFNFVLVSTVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAHGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDD--VPLVRLEVADEWARPEQAVVRYRV--------ETV--------FARSSWDWIGL 772          
BLAST of IPPc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JMC1|PI5PA_RAT (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Rattus norvegicus OX=10116 GN=Inpp5j PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 9.477e-52
Identity = 127/377 (33.69%), Postives = 182/377 (48.28%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQLRK------FDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY---LTHDDDKILNQNTELIK-----YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
               ++ ++T+NVG        PD++ + + L         D I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+    + ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+             + +  ++     Y S      SDH+PV A F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:  416 PGFRITVVTWNVGTAM----PPDDVTSLLHLGGGHDSDGADMIAIGLQEVNSMINKRLKDALFTDQWSELFMDALGPFNFVLVSTVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAHGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPSGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAARFLLQFAFRDD--VPLVRLEVADEWARPEQAVVRYRV--------ETV--------FARSSWDWIGL 770          
BLAST of IPPc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C5L6|INP5K_MOUSE (Inositol polyphosphate 5-phosphatase K OS=Mus musculus OX=10090 GN=Inpp5k PE=1 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 2.824e-51
Identity = 132/441 (29.93%), Postives = 200/441 (45.35%), Query Frame = 2
Query:   74 IKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQE-------VVQDTS----WTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTE----------LIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKY--FSGIP-SKSELQLIYFSKRMNCIQGISNNF 1324
            + V ++T+NV   +      D L    Q    D   IGLQE       ++ D +    W++L        N+V +    +  + L + AK   LP++  + ++ T +G  G  GNKGGV++  K +   +  +N H  PH      RL  +  I+   +F   +V NILDHD+I W GD+NFRIE+     ++ +I  K +  L + DQL  A K+  + + F+EG L F PT+KFD   + YDTS+KKRKPAWTDRIL+         +              L  Y S  +   SDH+PV   F +  N   S  +P+       +WT + D L++Y                     F    WDWIGL       ++ D + YV+V      D Q        + Y   S IP ++ +  L Y+S  ++ + GIS  F
Sbjct:   32 LSVHVVTWNVASAAPTVDLSDLLQLNNQDLNLDIYIIGLQEMNFGIISLLSDAAFEDPWSSLFMDMLSPLNFVKISQVRMQGLLLLVFAKYQHLPYIQIISTKSTPTGLYGYWGNKGGVNVCLKLYGYYVSIINCHLPPHMYNNDQRLEHFDRILESLTFEGYDVPNILDHDLILWFGDMNFRIEDFGLLFVQESITRKYYKELWEKDQLFIAKKNDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRKPAWTDRILWRLKRQPSQASPLASSVPTSYFLLTLKNYVSHMAYSISDHKPVTGTFDLELNPLMS--VPLITMMPEHLWTMENDMLISYTSTP----------------EFLSSSWDWIGLYKVGMRHIN-DYVAYVWVG-----DNQVSYGNNPNQVYINISAIPDTEDQFLLCYYSNNLHSVVGISQPF 448          
BLAST of IPPc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15735|PI5PA_HUMAN (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3)

HSP 1 Score: 192.586 bits (488), Expect = 4.338e-51
Identity = 128/377 (33.95%), Postives = 180/377 (47.75%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFD------FIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY--------LTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
               ++ ++T+NVG        PD++ + + L   D       I IGLQEV       ++D      W+ L     G  N+VLV    +  + L L AK   LP +  V+++ T +G  G  GNKGGVS+R       +  +N H   H +  + R +++  I++ Q F+      ILDHD++FW GDLNFRIE+     ++ AI       L + DQLN A     + KGF+EG LNFAPTFKFD   + YDTS KKRKPAWTDRIL+         +    K          Y S      SDH+PV A+F + F  R    +P+   E++  W   +  +V Y+         ET         F    WDWIGL
Sbjct:  421 PGFRITVVTWNVGTAM----PPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSDHKPVAAQFLLQFAFR--DDMPLVRLEVADEWVRPEQAVVRYRM--------ETV--------FARSSWDWIGL 775          
BLAST of IPPc domain-containing protein vs. TrEMBL
Match: A0A183N4H7 (IPPc domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS23202 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.598e-91
Identity = 196/527 (37.19%), Postives = 264/527 (50.09%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDD---DKILN--------------------------------------QNTE--LIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEI-SKVWTADKDQLVTYQC--P-----------------------------------SNSAGDKETADQPHDHGRFKPD-----RWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASV-----------KFERKYFSGIPSK-------SELQLIYFSKRMNCIQGISNNFSFT 1333
            M ++ V   T+NVGD+         L         D I + LQEV  D +W   + +    H YVL+K RN WAIW++   KR+ LP V ++ESEVTASGYAGV+GNKGGVS RF+   I++I ++ HFT H E  +DRLNDY+DI+  QSFRD++VN I+DHD +FWMGDLNFRI++L K E+E  +KEK F+ L  HDQL    K   +F  F EG ++F PTFKFD   DTYD+SKK+R PAWTDRILY+ H D   D  LN                                      Q+ E  L+KY S    + SDHRPV A FK+S   R    LP++F E  SK ++ + +  ++YQ   P                                   S+ +G  E+ +   D G   P       +DWI L P+ +  L +D ITYVY +++      R+ SV           KF+  Y + I S            L+Y S+  +C QG S  F  +
Sbjct:    1 MPSLIVHCCTWNVGDEKPGSEDLSTLLGVNAKPSPDVISVALQEVCGDDAWRQKLLEHLYPHGYVLIKSRNCWAIWIFSFLKRNLLPAVTNIESEVTASGYAGVMGNKGGVSARFELCGINMIFLSCHFTAHRENKQDRLNDYIDIIDHQSFRDEDVNVIIDHDYVFWMGDLNFRIDHLKKSEVELMVKEKRFNELLQHDQLLNMKKEKLLFHDFNEGTISFPPTFKFDKGTDTYDSSKKQRVPAWTDRILYMVHRDFALDHHLNLPESDRQRPASPSRRLPVRGSPSEVEEKFPANKSIKGRQHPEAVLLKYTSLNEYKTSDHRPVIAVFKLSVPPRW-FSLPVKFIEPDSKAYSFNANLEISYQVLDPPGLLRLSETNSLLSSKQYVPVSDFAKLLLLNTLGHSSKSGKSESTNN-DDLGPLAPPTLQTTSFDWIALYPAEFADLEKDYITYVYASSNVSQAKHRKNSVSSALLQPSNTAKFQELYKARIESSRLKDLPGQSFCLVYMSRNKHCPQGYSLPFKVS 525          
BLAST of IPPc domain-containing protein vs. TrEMBL
Match: A0A4E0S412 (Phosphatidylinositol 45 bisphosphate OS=Fasciola hepatica OX=6192 GN=D915_000682 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 2.623e-90
Identity = 183/526 (34.79%), Postives = 269/526 (51.14%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDD---DKILNQNTE-----------------------------------------LIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTE---------------------ISKVWTADKDQLVTY--QCPSNS--------AGDKETADQPHDHG------RFKPDRWDWIGLVPSNWTVLSEDTITYVYV----TADC--------EHDLQRQASV---------------KFERKYFSGIPSKSELQLIYFSKRMNCIQGISN 1318
            M  + ++ +T+NVGD++  Q+   +L      ++ D I + LQEVV D +W   +        YVL+K RN WAIW+Y+  +R+ LP + ++ESE T SGYAGV+GNKGGVS+RF+   +++I ++ HFT H+E  +DRLNDYLDI+  QSFRD++VN ILDHD +FWMGDLNFR+EN++K E E  I +     L  HDQLN       +F+ F EGE++F PTFKFD   + YD+SKK+R PAWTDRILY+ H D   D  LN N                                           L++Y S P  R SDHRPV   F+ +  SR    LPI+F E                      S +  +D D ++    + P  S        A +K   ++  + G        +   +DWIG+ P+++  L +D +TYVY     + DC        EH    +A+                +   ++ +G+ ++S + L+Y+S++  C QG S+
Sbjct:    1 MPFLNIRCVTWNVGDEAPPQADFRKLLGITAEKQPDVIGVALQEVVSDDAWRKALIAHTHPSGYVLIKSRNCWAIWMYVFVRRNLLPAITNIESESTPSGYAGVMGNKGGVSVRFEICGVNLIILSCHFTAHKENQRDRLNDYLDIINHQSFRDEDVNVILDHDYVFWMGDLNFRLENITKNEAEQLIVQNRLPELWKHDQLNIMKNKKLIFQDFNEGEISFPPTFKFDKGTEIYDSSKKRRIPAWTDRILYMAHRDYAIDHHLNVNPNGNRRSPSPSRRTPVRGPPSEVERKYPSGSFKTKIAHHPEIVLVEYTSLPEYRHSDHRPVVGTFQFAIPSRW-FSLPIDFVEPKIDRHPRSEDLKFVYSISDPPSLLNLSDTDPILLSRPRLPGQSMAQLTVLTALNKAVMEKTEESGPSLTPSAMQVAMFDWIGVYPADFANLEDDYLTYVYAPPATSTDCHGSSTSGTEHADSNKATASDKSSLPTHVSCHSGRVSARFITGLKNQS-IVLVYWSRKKKCPQGYSS 524          
BLAST of IPPc domain-containing protein vs. TrEMBL
Match: A0A3Q0KFR4 (Putative synaptojanin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 4.538e-89
Identity = 192/523 (36.71%), Postives = 257/523 (49.14%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDD---DKILN--------------------------------------QNTE--LIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEI-SKVWTADKDQLVTYQ----------------------CPSNSAGDKETADQP--------------HDHGRFKPD-----RWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASV-----------KFERKYFSGIPSK-------SELQLIYFSKRMNCIQGISNNF 1324
            M ++ V   T+NVGD+         L         D I + LQEV  D +W   + +    H YVL+K RN WAIW++   KR+ LP V ++ESEVTASGYAGV+GNKGGVS RF+   I++I ++ HFT H E  +DRLNDY+DI+  QSFRD++VN I+DHD +FWMGDLNFRI++L K E+E  ++EK FS L  HDQL        +F  F EG ++F PTFKFD   DTYD+SKK+R PAWTDRILY+ H D   D  LN                                      Q+ E  L+KY S    + SDHRPV A FK+S   R    LP++F E   K ++ + +  ++YQ                       P +        + P               D G   P       +DWI L P+ +  L +D ITYVY +++      R+ SV           KF+  Y + I S            L+Y S+  +C QG S  F
Sbjct:    1 MPSLIVHCCTWNVGDEKPGSEDLSSLLGVNSKPSPDVISVALQEVCGDDAWRQKLLEHLYPHGYVLIKSRNCWAIWIFSFLKRNLLPAVTNIESEVTASGYAGVMGNKGGVSARFELCGINMIFLSCHFTAHRENKQDRLNDYIDIIDHQSFRDEDVNVIIDHDYVFWMGDLNFRIDHLQKSEVELMVREKRFSELLQHDQLLNMKNDKLLFHDFNEGTISFPPTFKFDKGTDTYDSSKKQRVPAWTDRILYMVHRDFALDHHLNLPETNRQRQASPSRRLPVRGSPSEVEEKFPANKSIKGRQHPEAVLLKYTSLNEYKTSDHRPVIAVFKLSVPPRW-FSLPVKFIEPDGKAYSFNTNLEISYQVLDPPGLLRLSETNSLLSSKQYVPVSDFAKLLLLNTPGHSSKSGKSGSTNDDDLGPLAPPTLQTTSFDWIALYPAEFADLEKDYITYVYASSNVSQTKHRKNSVSSALLQPPNKAKFQEFYKARIESSRLKDLPGQSFCLVYMSRNKHCPQGYSLPF 522          
BLAST of IPPc domain-containing protein vs. TrEMBL
Match: G4VIB3 (Putative synaptojanin OS=Schistosoma mansoni OX=6183 GN=Smp_050830 PE=4 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 6.890e-89
Identity = 192/525 (36.57%), Postives = 257/525 (48.95%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDD---DKILN--------------------------------------QNTE--LIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEI-SKVWTADKDQLVTYQ----------------------CPSNSAGDKETADQP--------------HDHGRFKPD-----RWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASV-----------KFERKYFSGIPSK-------SELQLIYFSKRMNCIQGISNNFSF 1330
            M ++ V   T+NVGD+         L         D I + LQEV  D +W   + +    H YVL+K RN WAIW++   KR+ LP V ++ESEVTASGYAGV+GNKGGVS RF+   I++I ++ HFT H E  +DRLNDY+DI+  QSFRD++VN I+DHD +FWMGDLNFRI++L K E+E  ++EK FS L  HDQL        +F  F EG ++F PTFKFD   DTYD+SKK+R PAWTDRILY+ H D   D  LN                                      Q+ E  L+KY S    + SDHRPV A FK+S   R    LP++F E   K ++ + +  ++YQ                       P +        + P               D G   P       +DWI L P+ +  L +D ITYVY +++      R+ SV           KF+  Y + I S            L+Y S+  +C QG S  F  
Sbjct:    1 MPSLIVHCCTWNVGDEKPGSEDLSSLLGVNSKPSPDVISVALQEVCGDDAWRQKLLEHLYPHGYVLIKSRNCWAIWIFSFLKRNLLPAVTNIESEVTASGYAGVMGNKGGVSARFELCGINMIFLSCHFTAHRENKQDRLNDYIDIIDHQSFRDEDVNVIIDHDYVFWMGDLNFRIDHLQKSEVELMVREKRFSELLQHDQLLNMKNDKLLFHDFNEGTISFPPTFKFDKGTDTYDSSKKQRVPAWTDRILYMVHRDFALDHHLNLPETNRQRQASPSRRLPVRGSPSEVEEKFPANKSIKGRQHPEAVLLKYTSLNEYKTSDHRPVIAVFKLSVPPRW-FSLPVKFIEPDGKAYSFNTNLEISYQVLDPPGLLRLSETNSLLSSKQYVPVSDFAKLLLLNTPGHSSKSGKSGSTNDDDLGPLAPPTLQTTSFDWIALYPAEFADLEKDYITYVYASSNVSQTKHRKNSVSSALLQPPNKAKFQEFYKARIESSRLKDLPGQSFCLVYMSRNKHCPQGYSLPFKL 524          
BLAST of IPPc domain-containing protein vs. TrEMBL
Match: A0A4S2KZS2 (IPPc domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010443 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 1.574e-87
Identity = 178/520 (34.23%), Postives = 254/520 (48.85%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKI------------------------------------------LNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTE-----------------------ISKVWTADKDQLVTYQCPSNS--------------AGDK---ETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYV---TADCEHDLQRQASVKFERKYFSGI--------PSKSELQLIYFSKRMNCIQGISNNFSFTRTGN 1345
            M  + V+  T+NVGD    +   + L     +   D + +GLQEV+  + W   + K      YVL+K RN WAIW+++  +R+ L  + ++ESEVT  GYAGV+GNKGGVS+RF+   +++I ++ HF  H E  +DRLND+ DI+  QSFRDD+V+ ILDHD +FWMGDLNFR++ L K  +E  I +K FS L  HDQL+++ +   +F  F EG+++F PTFKFD   D YD+S K+R PAWTDRILY+ H D                                             L    +L++Y S P  + SDHRPV   F+ +  SR    LP+ F E                       +  +  +DK  +     P+ S               GDK    T + P      +  R DWIGL P+++  L    +TYV      +    D+  +AS K    Y+ G              +QLIY+S++ NC QG S+  S  RT N
Sbjct:    1 MPLLNVRCCTWNVGDDGPPEDNLNTLLGLNDVNPPDILAVGLQEVIDPSDWRKALIKHAHPAGYVLMKSRNCWAIWMFVFIRRNLLSAITNIESEVTPVGYAGVMGNKGGVSVRFEICGVNVIFLSCHFAAHAERTQDRLNDFWDIIKLQSFRDDDVHTILDHDYVFWMGDLNFRLDGLDKPTVEKLIDQKRFSKLISHDQLSRSRRKKLIFIDFLEGDIDFPPTFKFDKGTDQYDSSSKQRIPAWTDRILYMAHRDFATEHYATLLRDLNSLNIPRRSAVRGSPSNVEQHFPSNSRESIGELQPEIKLLEYTSLPEYKSSDHRPVVGSFEFAVPSRW-FSLPVSFIEPMGKDYPFGVDLEFSYTVMDPPALLHMTESDKILMARPAVPTVSFIQLMLISAMGKLAVGDKNEGSTNESPLAPASLEQARRDWIGLYPADFADLERGYLTYVQAPKTVSSIAKDVHAEASKKPMPSYYKGAILAQYLNQLKNQSVQLIYWSQKKNCPQGYSS--SVLRTAN 517          
BLAST of IPPc domain-containing protein vs. Ensembl Cavefish
Match: inpp5kb (inositol polyphosphate 5-phosphatase K-like [Source:NCBI gene;Acc:103045760])

HSP 1 Score: 188.734 bits (478), Expect = 7.028e-53
Identity = 140/472 (29.66%), Postives = 214/472 (45.34%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQL---RKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTH-----------DDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIP-SKSELQLIYFSKRMNCIQGISNNFSFTRTGN*RNGRLSFCRTLPSGQIEGL 1405
            E  ++ ++T+NV    A    PD++ + +QL      D   IGLQEV           + + SW+ L     G + +V V    +  + L + AK++ LP +  +ES  T +G  G  GNKGGVS+RF  +   +  +N H   H      R++++  I+  Q F      N+LDH V+FW GDLNFRI +     + ++I    F++L   DQL    K   + + F+EG L F PT+KFD   +TYDTS KKRKPAWTDRIL+              DD+++  + T+ + Y  + S   SDH+PV + F I    +     P+        W+AD+D ++TY                    RF     DWIGL    + +  +  + Y       EH++     V         +P    +  L YFS+ M  + G+S  F    +      RL+    L    + GL
Sbjct:   66 EFFRLHIVTWNV----ATSEPPDDVRSLLQLDSDSPTDLYVIGLQEVRATPVKYISDLLAEDSWSHLFMNTLGPNGFVKVTSVRMQGLLLIVFAKQTHLPFIRDIESTYTRTGILGYWGNKGGVSVRFSLYGHMLCFLNCHLAAHMNYAVQRVDEFEYILDSQDFDFHNTPNVLDHKVVFWFGDLNFRIADHGLHFLRSSINSGRFNLLWSKDQLMMMKKKEPLLQEFEEGPLKFKPTYKFDRFSETYDTSGKKRKPAWTDRILWRIKPSNNEQSGSIADDEEVSIKVTQDL-YTCDASYGVSDHKPVISSFNIELQKQVDT--PLVCVSAEGEWSADEDAVLTYFI----------------QERFDTCTSDWIGL----YKIGFKSALDYTAFAWVPEHEIPGVNEVVQLSMKKDDLPLLAGDYILGYFSRNMQSLVGLSPTFQIMES------RLALLEGLVPENVNGL 504          
BLAST of IPPc domain-containing protein vs. Ensembl Cavefish
Match: inpp5ka (inositol polyphosphate 5-phosphatase K-like [Source:NCBI gene;Acc:103044237])

HSP 1 Score: 188.348 bits (477), Expect = 1.765e-52
Identity = 141/463 (30.45%), Postives = 217/463 (46.87%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQL---RKFDFIFIGLQEVVQ-----------DTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY-------------LTHDDDKILNQNTELIK--------------YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTAD--CEHDLQRQASVKFERKYFSGIPSK-SELQLIYFSKRMNCIQGISNNF 1324
            +  ++ ++T+NV    A    P+++ + +QL   +K D   IGLQEV             D SW+ L         Y+ V    +  + L + +K   +P V  ++   T +G  G  GNKG V+IR   +   +  +N H   H     +R++++  I+  Q+F+  +  ++LDH ++FW GDLNFR+E+     I N I  ++F++L   DQL    K     + F+EG L+F PT+KFD + +TYD+S KKRKPAW DRIL+                DDD +  +  +L++              Y S+     SDH+PV   F +    R  + +P+        W+AD D +VTY           +  QP     F    WDWIGL    +  +S D ITY +V  D    +D + Q  V  E      IP + +E  L Y+S  + CI GIS  F
Sbjct:   78 DQFRLYMVTWNV----ATAEPPEDVSSLLQLHSSKKADLYVIGLQEVRAAPLKFVTDLAFDDSWSHLFMNMLAPLGYIKVSSIRMQGLLLLIFSKLEHVPFVRDIQVTYTRTGIFGYWGNKGAVTIRLSLYGHLMCFLNCHLAAHMNYASERVDEFEYILESQTFQGKKPVSVLDHKIVFWFGDLNFRVEDHGMHFIRNCITSQNFNLLWSKDQLTIMKKKVPKLQEFEEGPLDFQPTYKFDLNSETYDSSGKKRKPAWCDRILWRIKPRQSPPEDVFEEDDDDTVKEKKKQLLEDLMEKYPLKVKQDLYTSKMEYGVSDHKPVIGVFTLEL--RKMYDIPLVRLCAEGDWSADLDAMVTY-----------SPLQP-----FPSSAWDWIGLYKVGFRSIS-DYITYTWVKDDQVAFNDERIQVYVSKEE-----IPVRGAECVLCYYSSNLQCIVGISEPF 512          
BLAST of IPPc domain-containing protein vs. Ensembl Cavefish
Match: inpp5ja (inositol polyphosphate-5-phosphatase Ja [Source:ZFIN;Acc:ZDB-GENE-091117-4])

HSP 1 Score: 186.808 bits (473), Expect = 6.914e-52
Identity = 136/438 (31.05%), Postives = 195/438 (44.52%), Query Frame = 2
Query:   86 LITYNVGDKSADQSKPDELFNFVQLRKFDF---IFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY-LTHDDDKILNQNTELIK---YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTAD-------CEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNF 1324
            ++T+NVG        PD++      R  D    +FI  QEV       ++D      W+ L  +      YVLV  + +  + L + +K   LP +  V+++ T +G  G  GNKGGVS R       +  +N H   H    + R+ D+  I+  Q F       +LDH V+FW GDLNFRI++     +++AI+     +L + DQLN A    ++  GF EG LNF PT+KFD    TYDT+ KKRKPAWTDRIL+ L      + + +  L+    Y+S      SDH+PV A F +         LP+   E+ K WT   D    +   S                 F+   WDW+GL    +    +D   YV+  +D        E DL R A                E  L Y+S   N I GI+  F
Sbjct:    2 IVTWNVGSAMP----PDDISGLFVPRLGDGSVDMFIVFQEVNSMINKRLKDVLFTDQWSELCMETLSRFGYVLVASQRMQGVLLLVFSKFFHLPFLRGVQTQSTRTGLGGYWGNKGGVSARLMAFGHPVCFLNCHLPAHMRNLEQRVEDFESILQQQQFEGGAAVGVLDH-VVFWFGDLNFRIDDYDIHVVKSAIENNKLPLLWERDQLNMAKNSESILDGFLEGPLNFPPTYKFDVGTHTYDTA-KKRKPAWTDRILWRLRSTGSPVPSHSAALVTQHYYHSHMGFTVSDHKPVSALFSLHLQFPFKVNLPLVQLEVEKEWTKVSDATARFTIISG----------------FQRSSWDWVGLYKVGFKHY-KDYAAYVWAKSDHSTQVTFPEEDLPRDA---------------GEYILGYYSNNTNSIVGITEPF 401          
BLAST of IPPc domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036573.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000126.1:14588:25933:1 gene:ENSAMXG00000035124.1 transcript:ENSAMXT00000036573.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.267 bits (469), Expect = 7.742e-52
Identity = 120/368 (32.61%), Postives = 173/368 (47.01%), Query Frame = 2
Query:  263 VKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY----LTHDDDKI--------LNQNTELIK--YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNF 1324
            V  + +  + L + AK   LP +  V++E T +G  G+ GNKGGVS R      SI  +N H   H E    R+ D+  I+  Q F       +LDHDV+FW GDLNFRIE+L  + I+ AI      +L + DQLN A     V +GF+EG L F PT+KFD   DTYDTS KKRKPAWTDRIL+    +    + +        L   T + +  Y S      SDH+PV + F + F  +    +P+    +   W    D +  ++   N A                   WDWIGL    +    +D + Y +   +    L+++  V F  +     P   +  L Y+S  M+ I G++  F
Sbjct:   31 VTSQRMQGVLLLIFAKYYHLPFIRGVQTENTRTGLGGIWGNKGGVSARMNVFGHSICFLNCHLPAHMENSDQRMEDFESILQQQQFEGQAAMGVLDHDVVFWFGDLNFRIEDLEMQVIKTAIDNNKLPLLWEKDQLNLAKDSETVLEGFEEGPLKFPPTYKFDVGTDTYDTSGKKRKPAWTDRILWRLRPMAPPSNNMSKRSSVSGLTSGTRVTQHFYRSHMEYTVSDHKPVSSIFTLQFPYKVD--VPLVTIIVEDEWREIADAVAKFKITPNYARSS----------------WDWIGLYKVGFK-HHKDYVGYTWAKQEESDFLRQEHQVTFSEEELPKEP--GDFILGYYSNNMSSIVGVTEPF 377          
BLAST of IPPc domain-containing protein vs. Ensembl Cavefish
Match: inpp5kb (inositol polyphosphate 5-phosphatase K-like [Source:NCBI gene;Acc:103045760])

HSP 1 Score: 180.644 bits (457), Expect = 2.486e-50
Identity = 139/478 (29.08%), Postives = 213/478 (44.56%), Query Frame = 2
Query:   77 KVKLITYNVGDKSADQSKPDELFNFVQL---RKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSK---------KKRKPAWTDRILYLTH-----------DDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIP-SKSELQLIYFSKRMNCIQGISNNFSFTRTGN*RNGRLSFCRTLPSGQIEGL 1405
            ++ ++T+NV    A    PD++ + +QL      D   IGLQEV           + + SW+ L     G + +V V    +  + L + AK++ LP +  +ES  T +G  G  GNKGGVS+RF  +   +  +N H   H      R++++  I+  Q F      N+LDH V+FW GDLNFRI +     + ++I    F++L   DQL    K   + + F+EG L F PT+KFD   +TYDTS          KKRKPAWTDRIL+              DD+++  + T+ + Y  + S   SDH+PV + F I    +     P+        W+AD+D ++TY                    RF     DWIGL    + +  +  + Y       EH++     V         +P    +  L YFS+ M  + G+S  F    +      RL+    L    + GL
Sbjct:   16 RLHIVTWNV----ATSEPPDDVRSLLQLDSDSPTDLYVIGLQEVRATPVKYISDLLAEDSWSHLFMNTLGPNGFVKVTSVRMQGLLLIVFAKQTHLPFIRDIESTYTRTGILGYWGNKGGVSVRFSLYGHMLCFLNCHLAAHMNYAVQRVDEFEYILDSQDFDFHNTPNVLDHKVVFWFGDLNFRIADHGLHFLRSSINSGRFNLLWSKDQLMMMKKKEPLLQEFEEGPLKFKPTYKFDRFSETYDTSPQRTWFGFTGKKRKPAWTDRILWRIKPSNNEQSGSIADDEEVSIKVTQDL-YTCDASYGVSDHKPVISSFNIELQKQVD--TPLVCVSAEGEWSADEDAVLTYFI----------------QERFDTCTSDWIGL----YKIGFKSALDYTAFAWVPEHEIPGVNEVVQLSMKKDDLPLLAGDYILGYFSRNMQSLVGLSPTFQIMES------RLALLEGLVPENVNGL 460          
BLAST of IPPc domain-containing protein vs. Ensembl Sea Lamprey
Match: synj1 (synaptojanin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9180])

HSP 1 Score: 155.221 bits (391), Expect = 3.773e-40
Identity = 92/285 (32.28%), Postives = 141/285 (49.47%), Query Frame = 2
Query:  170 DFIFIGLQEVVQ-------------DTSWTALIKKCFG-EHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTH--------DDDKILNQ------------NTELIKYYSEPSIRGSDHRPVCA 922
            D   IG QE+V+                W+  ++K    +H Y+L+    +  + L++  +    PHV  V  +   +G  G  GNKGGV+IR + +  S+  V  HF   +   ++R  DY +I    SF       +  HD +FW GD N+RI+ LS +E++  +++K++  L   DQL +      VF+GF EG  NF PT+K+D   D YDTS+K R PAWTDR+L+  H        D+  ++N             N   + +YS   ++ SDHRPV A
Sbjct:  589 DVFAIGFQEMVELNAGNIVSASTENQKRWSVELQKTISRDHKYILLTSEQLVGVCLFVFLRPHHAPHVRDVAVDTVKTGMGGATGNKGGVAIRLQMYSSSLCFVCSHFAAGQSHTRERNEDYAEIARKLSFPMGR--GLFSHDYVFWCGDFNYRID-LSGDEVKELVRQKNWETLQQADQLVQQRNLGAVFRGFHEGRTNFPPTYKYDIFSDDYDTSEKCRIPAWTDRVLWYRHKWAFEKSADELDLVNLPAGVEPRLPHLWNPGTLIHYSRAELKTSDHRPVIA 870          
BLAST of IPPc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008151.1 (pep scaffold:Pmarinus_7.0:GL492242:1419:4886:1 gene:ENSPMAG00000007370.1 transcript:ENSPMAT00000008151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 3.104e-32
Identity = 59/170 (34.71%), Postives = 92/170 (54.12%), Query Frame = 2
Query:  278 IWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVN----NILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDT 775
            +  + L + A+      +  VE+E   +G  G +GNKGGV++RF  H  S+  VN H   H E  + R  DY DIV+  SF   +      +I +HD+I W+GDLN+R+  +  E+++  I+++ F  L  HDQL+        F G+ EG + F PT+K+D     +DT
Sbjct:    3 LVGMMLLVFAREEHASFISEVEAETVGTGIMGKMGNKGGVAVRFLLHSSSVCVVNAHLAAHTEEVERRNQDYRDIVSRLSFPQIDATLPRLSIPNHDIILWLGDLNYRLTEVDVEKVKLLIEDQDFQTLQQHDQLSLQRGKKLAFSGYSEGAVTFQPTYKYDTGSSKWDT 172          
BLAST of IPPc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010915.1 (pep scaffold:Pmarinus_7.0:GL482779:12:3705:-1 gene:ENSPMAG00000009891.1 transcript:ENSPMAT00000010915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 2.520e-18
Identity = 55/200 (27.50%), Postives = 96/200 (48.00%), Query Frame = 2
Query:   77 KVKLITYNVGDK----------SADQSKPDELFNFVQLRKFDF-IFIGLQEVVQDTSWTALIKKCFGEHNYVLVK--VRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIEN----LSKEEIENA 625
            ++++IT+NVG            + DQ  P      + L++    + + L++ + D  W+  +        Y + +  VR +  + L +  + S LP V  V +  T +G  G  GNKGGVS+R     +S+  VN H  PHE G   RL+    I+  Q +    V+++  H ++  +GDLNFRI +     +++ I+N 
Sbjct:    5 RLRVITWNVGTAEPPEEADALLALDQEGPPPHLYIIGLQELSARVDLFLRDSLVDDPWSCFLMDVLAPRGYCVQRESVR-LQGLLLLVFVQNSLLPLVRDVHTAYTRTGLGGYWGNKGGVSVRMSLCGLSLCFVNCHLPPHEGGHLQRLDALERILDEQRYLGVSVSHL--HSIVLCLGDLNFRIADHGLRFTRDSIDNG 201          
BLAST of IPPc domain-containing protein vs. Ensembl Yeast
Match: INP53 (Polyphosphatidylinositol phosphatase; dephosphorylates multiple phosphatidylinositol phosphates; involved in trans Golgi network-to-early endosome pathway; hyperosmotic stress causes translocation to actin patches; contains Sac1 and 5-ptase domains; INP53 has a paralog, INP52, that arose from the whole genome duplication [Source:SGD;Acc:S000005635])

HSP 1 Score: 167.933 bits (424), Expect = 1.594e-44
Identity = 108/312 (34.62%), Postives = 163/312 (52.24%), Query Frame = 2
Query:   71 NIKVKLITYNV--GDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTS-------------WTALIKKCFGEHN--YVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAI---KEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEF--KISF 940
            NI + + ++NV    K  D SK   LF   +  K D + +GLQEV++ ++             W  L+  C  +++  Y+L++V  + ++ +    K  +  +V  VE     +G+ G+ GNKG VSIRF+Y   S   VN H        ++R +DY  IV G +F   ++  I  HD IFW+GD+N+RI NL  E++   +   +E     L   DQL   +   +VF+GFKE  L F PT+K+D    TYD+S+K+R P+WTDRI+Y   +          L   YS+  I  SDHRPV A +  KI+F
Sbjct:  565 NINLLIGSFNVNGATKKVDLSK--WLFPIGEKFKPDIVVLGLQEVIELSAGSILNADYSKSSFWENLVGDCLNQYDDKYLLLRVEQMTSLLILFFVKADKAKYVKQVEGATKKTGFRGMAGNKGAVSIRFEYGATSFCFVNSHLAAGATNVEERRSDYESIVRGITFTRTKM--IPHHDSIFWLGDMNYRI-NLPNEDVRRELLNQEEGYIDKLLHFDQLTLGINSGSVFEGFKEPTLKFRPTYKYDPGTGTYDSSEKERTPSWTDRIIYKGEN---------LLPLSYSDAPIMISDHRPVYAAYRAKITF 862          
BLAST of IPPc domain-containing protein vs. Ensembl Yeast
Match: INP52 (Polyphosphatidylinositol phosphatase; dephosphorylates a number of phosphatidylinositol phosphates (PtdInsPs, PIPs) to PI; involved in endocytosis; hyperosmotic stress causes translocation to actin patches; synaptojanin-like protein with a Sac1 domain; INP52 has a paralog, INP53, that arose from the whole genome duplication [Source:SGD;Acc:S000005050])

HSP 1 Score: 162.54 bits (410), Expect = 8.776e-43
Identity = 103/307 (33.55%), Postives = 156/307 (50.81%), Query Frame = 2
Query:   71 NIKVKLITYNVGDKS--ADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTS-------------WTALIKKCFG--EHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIEN---AIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFK 931
            NI + + T+NV   S  AD SK   LF      K D + +GLQEV++ T+             W  ++  C    E  Y+L++V  + ++ +   A+  R  ++  V      +G+ G+ GNKG V+IRF Y   S   VN H +       +R NDY +I    +F   +   I  HD +FW+GDLN+RI  L+ +E+     A K+     L  +DQL + +    VF+GFKE  L F PT+K+D   D YDTS+K R P+WTDRI+Y   +   +          YS+  ++ SDH+PV A ++
Sbjct:  590 NINLFVGTFNVNGNSRRADLSK--WLFPIGDKFKPDVVVLGLQEVIELTAGSILNADYTKSSFWETMVTDCLNQYEEKYLLLRVEQMSSLLILFFARSDRAYNIKEVGGSTKKTGFGGITGNKGAVAIRFDYGATSFCFVNTHLSAGASNIDERRNDYNNIYRNITFPRSKT--IPHHDSLFWLGDLNYRI-TLTNDEVRRELRAQKDGYIDRLLQYDQLTQEINEGVVFQGFKEPTLQFRPTYKYDYGTDNYDTSEKARTPSWTDRIIYKGENLHPLA---------YSDAPLKISDHKPVYAAYR 882          
BLAST of IPPc domain-containing protein vs. Ensembl Yeast
Match: INP51 (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth [Source:SGD;Acc:S000001264])

HSP 1 Score: 135.191 bits (339), Expect = 8.643e-34
Identity = 93/271 (34.32%), Postives = 128/271 (47.23%), Query Frame = 2
Query:  170 DFIFIGLQEVVQDTSWTALI----------KKCFGEHN-------YVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFK 931
            D   IGL+EVV+ T    L           KK     N       Y+ +    +  I L L    +    V  +E +V  +G+ G+  NKG V++ FKY       +  H     E  + R NDY  I   +S R  +   I DHD I WMGD N+RI  +S E++   I  K ++ L + DQLN+ +     F  F E  ++F PT+KFD     YDTS+K R PAWTDRIL       ++L Q    ++Y     I  SDHRPV A F+
Sbjct:  562 DLYVIGLEEVVELTPGHMLATDPYVRQFWEKKILTLLNGPGRKKKYIRLWSTQLGGILLLLFMNETEYSKVKHIEGDVKKTGFGGMASNKGAVAVSFKYSATRFCVLVSHLAAGLENVEQRHNDYKTI--AKSIRFSKGLRIKDHDAIIWMGDFNYRIL-MSNEDVRRKIVSKEYASLFEKDQLNQQMIAGESFPYFHEMAIDFPPTYKFDPGTKNYDTSEKMRIPAWTDRIL----SRGEVLEQ----LEYKCCEDILFSDHRPVYAIFR 821          
BLAST of IPPc domain-containing protein vs. Ensembl Yeast
Match: INP54 (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; role in secretion; localizes to the endoplasmic reticulum via the C-terminal tail; lacks the Sac1 domain and proline-rich region found in the other 3 INP proteins [Source:SGD;Acc:S000005426])

HSP 1 Score: 70.0922 bits (170), Expect = 2.283e-13
Identity = 89/327 (27.22%), Postives = 142/327 (43.43%), Query Frame = 2
Query:   71 NIKVKLITYNVGDK-SADQSKP---DELFNF----VQLRKFDFIFIGLQEVVQ--DTSWTALIK-----------KCF--------GEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGN--KGGVSIRFK--------YHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHN--VFKGFKEGELNFAPTFKFDD-DCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEP---SIRGSDHRPV 916
            N KV + T+N G +   + SK      LF +     QL   D   +G QEVV     S+ A+ +            C         G+  Y  + V ++ AI + +L   + L   D +   +  +G  G  G   KGG  I F+        +   S I  + +          R++DY  I++     D EV      D  F++GDLNFR+ +        +       +L +H++LN   K  +  + KGF+E ++ F PT+KF   + +TY+T   KR P+W DRILY ++       + T    Y+S P   ++  SDH+PV
Sbjct:    5 NWKVSVTTFNCGKEFPVENSKAIVKQLLFPYDDGISQLELQDLYVLGFQEVVPIWQGSFPAVNRDLIDRITTTAVNCLNEKVSATQGDEQYSCLGVNSLGAITIIVLYNNNALKVKDDI---LKRNGKCGWFGTHLKGGTLISFQMTRNGEENWERFSYICAHLNANEGVNNRNQRIDDYKRIMS--EVCDSEV---AKSDHFFFLGDLNFRVTSTYDPTTNYSSTTTLRRLLENHEELNLLRKGEDEPLCKGFQELKITFPPTYKFKLFEKETYNT---KRIPSWCDRILYKSYAVPTFAQEGT----YHSVPRSNALLFSDHQPV 316          
BLAST of IPPc domain-containing protein vs. Ensembl Nematostella
Match: EDO32085 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW33])

HSP 1 Score: 173.326 bits (438), Expect = 1.181e-46
Identity = 91/228 (39.91%), Postives = 131/228 (57.46%), Query Frame = 2
Query:  263 VKVRNIWAIWLYLLA--KRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSF-RDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKIS 937
            +KVR+I  + ++LL   K   +PH+  V +E  A+G  G++GNKGGV+IR  +H  ++  VN H   H+E ++ R  DY DI++  +F R  EV  ILDHDV FW+GDLN+R+ N+  E  +  I +     L   DQL K  +    F GF E  + F PT+K+D   D +D+S+K R PAW DR+LY  H          + I Y S PS++ SDH+PV   F + 
Sbjct:   92 IKVRSIRLVGIFLLVYTKTLHMPHIKDVAAEYVATGIMGMMGNKGGVAIRMSFHNSTLCFVNSHLAAHQEEYERRNQDYRDILSKLNFTRVSEVLTILDHDVTFWLGDLNYRV-NMECELSKGLIDQGRLEELLKCDQLIKQKEVKKCFSGFHEPPITFRPTYKYDPGTDNWDSSEKGRAPAWCDRVLYRGH--------GVKQIAYRSHPSLKVSDHKPVSGLFSVG 310          
BLAST of IPPc domain-containing protein vs. Ensembl Nematostella
Match: EDO33968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ5])

HSP 1 Score: 163.31 bits (412), Expect = 1.912e-42
Identity = 88/240 (36.67%), Postives = 131/240 (54.58%), Query Frame = 2
Query:  110 KSADQSKPDELF--NFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFG-EHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY 820
            K  D S P ++F   F +L   +   +      Q   W   +++    +  YVL+    +  + L++ A+   +P++  V      +G  G  GNKGGV+IR   H  SI  +  H    + G +DR NDYLDI T  +F       I  HD +FW GD N+RI ++  +E+++ I+ K +  L  +DQLNK  + H VF+G+ EGEL FAPT+K+D   D YDTS+K R PAWTDR+L+
Sbjct:  574 KDVDYSLPTDIFAIGFEELVDLNASNMVSTSSTQRKEWGEELRRVISRDFPYVLLTCEQLVGVCLFVFARPHLVPYIRDVAVSTVKTGLGGSAGNKGGVAIRLLLHATSICFICSHLAAGQSGVQDRNNDYLDIATRTAF--PMGRTIRSHDYVFWCGDFNYRI-DMPMDEVKSLIQLKDWDALAQNDQLNKQRQEHKVFRGYVEGELRFAPTYKYDLFSDDYDTSEKMRIPAWTDRVLW 810          
BLAST of IPPc domain-containing protein vs. Ensembl Nematostella
Match: EDO43425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV8])

HSP 1 Score: 132.494 bits (332), Expect = 2.862e-34
Identity = 89/307 (28.99%), Postives = 157/307 (51.14%), Query Frame = 2
Query:   74 IKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFI----FIGLQEVVQDTS-WTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDE---VNNILD----HDVIFWMGDLNFRIENLSKEEIENAI------KEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISF 940
            + V + T+N+ +   ++  P  L +F+     DF+     IGLQE     S W   +++  G  ++VL+   +   + L +  +R  +    +V  E  A+    ++  KGG+++ F     S + +N H T  E   +DR+NDY  I    + + +E   V+N  D     D +FW+GD NFR+ ++ + E++  I      +   +  L   DQL++ +    VF GF E  ++FAPT+K D   D YDTS K R P+WTDR+LY +  ++ +      +++Y +  S++ SDHRPV   ++++ 
Sbjct:   20 VGVFVATWNMHE---EKEVPGFLDDFLLPENVDFLQDIYVIGLQESTSSRSEWEIRLQETLGP-SHVLMHSCSFGVLHLAIFVRRELVWFCSAVTQESIATRPGHMIKTKGGLAVGFSLFGTSFLFINSHLTSDEGKARDRVNDYNKIRKSLNLQGEEKPWVDNSPDVTDRFDRVFWLGDFNFRV-DMERTEVDKLIATYQEQESPDYKELLKKDQLSRLMSKEEVFIGFSEHPISFAPTYKLDIQTDDYDTSSKMRVPSWTDRVLYKSRTENTV-----NVVRYDACTSVKTSDHRPVFGIYEVTL 316          
BLAST of IPPc domain-containing protein vs. Ensembl Nematostella
Match: EDO29183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4D0])

HSP 1 Score: 108.997 bits (271), Expect = 2.310e-25
Identity = 108/410 (26.34%), Postives = 180/410 (43.90%), Query Frame = 2
Query:  188 LQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWL-YLLAKRSR-LPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDE----------VNNILDHDVIFW-MGDLNFRIEN--------LSKEEIENAIKEKSFSV-----LTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDT-SKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISF-NSRGSHRLPIEFTE--ISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSK-SELQLIYFSKRMNCIQGISNNF 1324
            L E +++ SW  L++   G   Y LVK+R+I  + + +L++   R LPHV  +      + + G+LG KG VS+RF  ++ S   +N HF  H E  + R +D L +    +++              ++I D+++  W +GD +   EN        L +E     +   S+ +     +++  +L ++      F  FKEG L F PT+K++     +DT S K RKPAWTDR+L+    +        +LI Y S      SDHRPV A   +   +S      PI++    +S  W  ++D L  Y                     +K   WDWIGL    +  +  D   Y +   D +   +   +V F+      +P +     + Y+S +M  I  +S  F
Sbjct:   84 LIEYIKENSWVKLLQAYLGA--YGLVKLRSIRMLGMVHLVSVHLRHLPHVREIRQAFCKTAFLGLLGTKGAVSLRFTLYDQSFCFINSHFAAHAEYTEYRNSDGLCVYVVSNYKTYSWDWIGLYRVGFHHIWDYEMYEWAVGDGDEYGENGCAVLFDCLPEEPGHYVMAYYSYKMEAIISVSEAFELLQSKDAKLSFIDFKEGPLVFKPTYKYNPGSSDWDTESGKYRKPAWTDRVLWREKPEKA---DTAQLITYKSHDQYMTSDHRPVSALLSLDLPDSALKIEDPIDWKMDLMSMPWYGNEDGLCVYVV-----------------SNYKTYSWDWIGLYRVGFHHIW-DYEMYEWAVGDGDEYGENGCAVLFD-----CLPEEPGHYVMAYYSYKMEAIISVSEAF 465          
BLAST of IPPc domain-containing protein vs. Ensembl Nematostella
Match: EDO25917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDD5])

HSP 1 Score: 81.2629 bits (199), Expect = 8.577e-19
Identity = 43/105 (40.95%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  383 NKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNV 697
            NKGGV+IR   H  SI  +  H    + G +DR NDYLDI T  +F       I  HD +FW GD N+RI+ +  +E+++ I+ K +  L  +DQLNK  + H V
Sbjct:    1 NKGGVAIRLLLHATSICFICSHLAAGQSGVQDRNNDYLDIATRTAFPMGR--TIRSHDYVFWCGDFNYRID-MPMDEVKSLIQLKDWDALAQNDQLNKQRQEHKV 102          
BLAST of IPPc domain-containing protein vs. Ensembl Medaka
Match: inpp5ka (inositol polyphosphate 5-phosphatase K [Source:NCBI gene;Acc:101165165])

HSP 1 Score: 199.904 bits (507), Expect = 3.564e-57
Identity = 142/466 (30.47%), Postives = 217/466 (46.57%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQL---RKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILY--------------------------LTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQ-------LIYFSKRMNCIQGISNNF 1324
            E+ ++ ++T+NV    A    P+++ + + L   +  D   IGLQEV           V D  W+ L        + V V    +  + L   +K   +P +  + +  T +G  G  GNKGGVSIRF ++  ++  +N H TPH E    R++++  IV  Q+F   + + I+DH ++F  GDLNFRI++     I + +  K++++L   DQLN   K   + + F+EG L+FAPT+KFD + D+YD+S KKRKPAWTDRIL+                          L  D++  L    EL     E SI  SDH+PV   F +    +     P+   +    W+AD D ++ Y           +  QP     F    WDWIGL    ++ +S D ITY +V         +   V F ++      SK E+        L YFS  + CI G+S  F
Sbjct:   28 ESFRLHMVTWNV----ATADPPEDVTSLLHLNSSKPADLYIIGLQEVYSGPVRFLSDMVFDDPWSHLFMSTLAPRSCVKVSSIRMQGLLLLFFSKLEHVPFIRDIRATYTRTGIFGYWGNKGGVSIRFSFYGHTLCFLNCHLTPHIEYATHRVDEFESIVDTQTFDCKKASKIMDHRLVFLFGDLNFRIQDHGMHFIRSCLTNKTYNLLWSKDQLNMMKKKEALLQEFEEGPLDFAPTYKFDLNSDSYDSSGKKRKPAWTDRILWRIRPKAPPPDEQEEDGSRPDVKRIRQLEEDEEFPLKVRQELYSSSMEFSI--SDHKPVLGIFSVELKKK--FDTPLVRLQTEGDWSADIDSMILY-----------SPLQP-----FPSSSWDWIGLYKVGFSSVS-DYITYTWV---------KDNEVAFNQEVMQVYISKEEIPVRGGDCVLCYFSSILQCIIGVSEPF 459          
BLAST of IPPc domain-containing protein vs. Ensembl Medaka
Match: inpp5jb (phosphatidylinositol 4,5-bisphosphate 5-phosphatase A [Source:NCBI gene;Acc:101173869])

HSP 1 Score: 192.971 bits (489), Expect = 3.087e-55
Identity = 125/377 (33.16%), Postives = 175/377 (46.42%), Query Frame = 2
Query:   80 VKLITYNVGDKSADQSKPDELFNFVQLR----KFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKI------------LNQNTELIK--YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
            + +IT+NVG        PD++   + L       D   IGLQEV       ++D      W+ L  +      YVLV  + +  + L + AK   LP +  V++E T +G  G  GNKGGV  R      +I  VN H   H E    R+ D+  I+  Q F     + +LDHDV+FW GDLNFRI +L  + +++AI    FS L + DQLN A     V +GF EG L F PT+KFD   +TYDTS KKRKPAWTDRIL+                    L   T++ +  Y S      SDH+PV + F + F  +    +P+    +   W +  D  V ++                   ++    WDWIGL
Sbjct:   13 IHIITWNVGSAEP----PDDITALLGLNVGDGNTDMYIIGLQEVNSMINKRLKDALFTDQWSELCMERLSPFGYVLVTSQRMQGLLLLVFAKYFHLPFLRGVQTETTRTGLGGYWGNKGGVGARMSVFGHTICFVNCHLPAHMENSDQRMEDFESILQQQQFEGQAASGVLDHDVVFWFGDLNFRINDLDIQAVKSAIDNNKFSALLEKDQLNMAKDSETVLEGFHEGPLKFPPTYKFDVGTNTYDTSGKKRKPAWTDRILWRLRATAPAAQSSEKRGSFSGLTSGTKVTQHSYQSHMEYTISDHKPVSSIFTLQFPYK--LDIPLVTIIVEDEWNSVADAKVIFKMAP----------------KYSRSSWDWIGL 367          
BLAST of IPPc domain-containing protein vs. Ensembl Medaka
Match: inpp5ka (inositol polyphosphate 5-phosphatase K [Source:NCBI gene;Acc:101165165])

HSP 1 Score: 190.274 bits (482), Expect = 1.312e-53
Identity = 141/475 (29.68%), Postives = 217/475 (45.68%), Query Frame = 2
Query:   68 ENIKVKLITYNVGDKSADQSKPDELFNFVQL---RKFDFIFIGLQEV-----------VQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDT---------SKKKRKPAWTDRILY--------------------------LTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQ-------LIYFSKRMNCIQGISNNF 1324
            E+ ++ ++T+NV    A    P+++ + + L   +  D   IGLQEV           V D  W+ L        + V V    +  + L   +K   +P +  + +  T +G  G  GNKGGVSIRF ++  ++  +N H TPH E    R++++  IV  Q+F   + + I+DH ++F  GDLNFRI++     I + +  K++++L   DQLN   K   + + F+EG L+FAPT+KFD + D+YD+         + KKRKPAWTDRIL+                          L  D++  L    EL     E SI  SDH+PV   F +    +     P+   +    W+AD D ++ Y           +  QP     F    WDWIGL    ++ +S D ITY +V         +   V F ++      SK E+        L YFS  + CI G+S  F
Sbjct:   28 ESFRLHMVTWNV----ATADPPEDVTSLLHLNSSKPADLYIIGLQEVYSGPVRFLSDMVFDDPWSHLFMSTLAPRSCVKVSSIRMQGLLLLFFSKLEHVPFIRDIRATYTRTGIFGYWGNKGGVSIRFSFYGHTLCFLNCHLTPHIEYATHRVDEFESIVDTQTFDCKKASKIMDHRLVFLFGDLNFRIQDHGMHFIRSCLTNKTYNLLWSKDQLNMMKKKEALLQEFEEGPLDFAPTYKFDLNSDSYDSRFYQTWFGFNGKKRKPAWTDRILWRIRPKAPPPDEQEEDGSRPDVKRIRQLEEDEEFPLKVRQELYSSSMEFSI--SDHKPVLGIFSVELKKK--FDTPLVRLQTEGDWSADIDSMILY-----------SPLQP-----FPSSSWDWIGLYKVGFSSVS-DYITYTWV---------KDNEVAFNQEVMQVYISKEEIPVRGGDCVLCYFSSILQCIIGVSEPF 468          
BLAST of IPPc domain-containing protein vs. Ensembl Medaka
Match: inpp5jb (phosphatidylinositol 4,5-bisphosphate 5-phosphatase A [Source:NCBI gene;Acc:101173869])

HSP 1 Score: 187.193 bits (474), Expect = 3.547e-53
Identity = 125/373 (33.51%), Postives = 172/373 (46.11%), Query Frame = 2
Query:   92 TYNVGDKSADQSKPDELFNFVQLR----KFDFIFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKI------------LNQNTELIK--YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGL 1123
            T+NVG        PD++   + L       D   IGLQEV       ++D      W+ L  +      YVLV  R +  + L + AK   LP +  V++E T +G  G  GNKGGV  R      +I  VN H   H E    R+ D+  I+  Q F     + +LDHDV+FW GDLNFRI +L  + +++AI    FS L + DQLN A     V +GF EG L F PT+KFD   +TYDTS KKRKPAWTDRIL+                    L   T++ +  Y S      SDH+PV + F + F  +    +P+    +   W +  D  V ++                   ++    WDWIGL
Sbjct:   15 TWNVGSAEP----PDDITALLGLNVGDGNTDMYIIGLQEVNSMINKRLKDALFTDQWSELCMERLSPFGYVLVSDR-MQGLLLLVFAKYFHLPFLRGVQTETTRTGLGGYWGNKGGVGARMSVFGHTICFVNCHLPAHMENSDQRMEDFESILQQQQFEGQAASGVLDHDVVFWFGDLNFRINDLDIQAVKSAIDNNKFSALLEKDQLNMAKDSETVLEGFHEGPLKFPPTYKFDVGTNTYDTSGKKRKPAWTDRILWRLRATAPAAQSSEKRGSFSGLTSGTKVTQHSYQSHMEYTISDHKPVSSIFTLQFPYK--LDIPLVTIIVEDEWNSVADAKVIFKMAP----------------KYSRSSWDWIGL 364          
BLAST of IPPc domain-containing protein vs. Ensembl Medaka
Match: inpp5jb (phosphatidylinositol 4,5-bisphosphate 5-phosphatase A [Source:NCBI gene;Acc:101173869])

HSP 1 Score: 184.496 bits (467), Expect = 9.916e-52
Identity = 139/446 (31.17%), Postives = 205/446 (45.96%), Query Frame = 2
Query:   77 KVKLITYNVGDKSADQSKPDELFNFVQLRKFDF---IFIGLQEV-------VQDT----SWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHD-QLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKI------------LNQNTELIK--YYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKS-ELQLIYFSKRMNCIQGISNNF 1324
            K+ +IT+NVG        PD++   + L   D    ++I LQEV       ++D      W+ L  +      YVLV  + +  + L + AK   LP +  V++E T +G  G  GNKGGV  R      +I  VN H   H E    R+ D+  I+  Q F     + +LDH V+FW GDLNFRI +L  + +++AI    FS L + D QLN A     V +GF EG L F PT+KFD   +TYDT  KKRKPAWTDRIL+                    L   T++ +  Y S      SDH+PV + F + F  +    +P+    +   W +  D  V ++                   ++    WDWIGL    +    +D + YV+   +    L+++  V F  +    +P  S +  L Y+S  MN I G++  F
Sbjct:   52 KIHIITWNVGSAEP----PDDITALLGLNVGDGNTDMYIILQEVNSMINKRLKDALFTDQWSELCMERLSPFGYVLVTSQRMQGLLLLVFAKYFHLPFLRGVQTETTRTGLGGYWGNKGGVGARMSVFGHTICFVNCHLPAHMENSDQRMEDFESILQQQQFEGQAASGVLDH-VVFWFGDLNFRINDLDIQAVKSAIDNNKFSALLEKDQQLNMAKDSETVLEGFHEGPLKFPPTYKFDVGTNTYDTG-KKRKPAWTDRILWRLRATAPAAQSSEKRGSFSGLTSGTKVTQHSYQSHMEYTISDHKPVSSIFTLQFPYK--LDIPLVTIIVEDEWNSVADAKVIFKMAP----------------KYSRSSWDWIGLYKVGFK-HPKDYVGYVWAKQEEADFLRQEHEVTFIEEE---LPKGSGDYILGYYSNNMNTIVGVTEPF 469          
BLAST of IPPc domain-containing protein vs. Planmine SMEST
Match: SMESG000026603.1 (SMESG000026603.1)

HSP 1 Score: 887.486 bits (2292), Expect = 0.000e+0
Identity = 427/427 (100.00%), Postives = 427/427 (100.00%), Query Frame = 2
Query:   65 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNFSFTRTGN 1345
            MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNFSFTRTGN
Sbjct:    1 MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRLPIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDWIGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSELQLIYFSKRMNCIQGISNNFSFTRTGN 427          
BLAST of IPPc domain-containing protein vs. Planmine SMEST
Match: SMESG000043682.1 (SMESG000043682.1)

HSP 1 Score: 153.68 bits (387), Expect = 4.396e-39
Identity = 99/273 (36.26%), Postives = 142/273 (52.01%), Query Frame = 2
Query:  170 DFIFIGLQEVVQDTS-------------WTA-LIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYL----THDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKI 934
            D   IG QE++  T+             W A L++      +YVL+    +  I L++  K S  P +  V +    +G+ G  GNKG V +RF+    S   V  HF   +   K+R +DY DIV    F  D   +I  HD IFW GD N+RI+ L   +++  I  + +  L   DQL    ++ +VF+GF EG+  FAPT+K+D  CD YDTS+K R PAWTDRIL+     T+ +   L Q  +LI  Y+   ++ SDHRPV A F +
Sbjct:  592 DIYAIGFQEIIDLTASNIVNAKSGNQQQWAAFLLENISRLADYVLLSSIQLVGICLFVFIKASLAPFITEVSTSSVKTGFKGTAGNKGAVGVRFQLFNSSFCYVCSHFAAGQSNVKERNDDYEDIVRQLKFSRDR--SIDCHDFIFWCGDFNYRID-LGNADVKYLIANREWGQLEQADQLAVQKRNGHVFRGFNEGQKRFAPTYKYDLFCDDYDTSEKCRVPAWTDRILWKVNMPTNSEYGPLCQ--QLI--YNRAELKTSDHRPVAAIFDV 857          
BLAST of IPPc domain-containing protein vs. Planmine SMEST
Match: SMESG000022768.1 (SMESG000022768.1)

HSP 1 Score: 128.642 bits (322), Expect = 7.687e-31
Identity = 72/198 (36.36%), Postives = 112/198 (56.57%), Query Frame = 2
Query:  353 TASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRD--DEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISF 940
              +G   ++GNKGGV IRF+    ++  +N H    E     R  D+ +I     FR+  D++  + +HD++F MGDLN+R+ N+   E +  I +K+  VL  +D+L K  + + VF  F EG +NF PT+KFD + D YDTS+K R P++ DRI++          ++ +L  Y S  S++ SDH+PV A F I  
Sbjct:  413 VPTGMLNLMGNKGGVGIRFQAWNSNLCFINCHLAAGESNRLRRDQDFREIEKNMIFRNYNDKLITMYNHDLVFLMGDLNYRLVNIEASEAKEYILKKNIDVLMANDELTK--ESNFVFAHFHEGTINFLPTYKFDPNTDDYDTSEKNRVPSYCDRIMW--------KGEHCKLQGYTSHSSLKSSDHKPVSAWFNIGL 600          
BLAST of IPPc domain-containing protein vs. Planmine SMEST
Match: SMESG000056307.1 (SMESG000056307.1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.760e-20
Identity = 73/256 (28.52%), Postives = 121/256 (47.27%), Query Frame = 2
Query:  239 FGEHNYVLVKVRNIWAIWLYLLAKRSR----LPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSF------RDDEVNNI-LDHDVIFWMGDLNFRIENLSKEEIENAIKE---KSFSVLTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRL 964
            F   NY L+  ++   + L++  ++        HV ++       G  G + NKG +SI F+  E +I  +N H     E  + R      ++           R  ++N +  D DV+F  GDLNFR++NL+   +  +IK    K+ + L   D+L    +   ++K F E +++F PT+KF  + D Y++   KR P++ DRIL++    +  LN     I Y S P    SDH+P+  +F I      S RL
Sbjct:  103 FINKNYTLLVSKSYAGLSLFVFLRKYLNKVIANHVSNLLVGTVPIGTLG-MANKGALSISFRIGEFTICFINCHLPAGGENLERRQFGLQAVIQKLQLHQYNKTRSKKINFLEADIDVVFLFGDLNFRLQNLTASAVIESIKTNKVKAINELIKFDELIVLRETDALYKNFFEAQIDFLPTYKFVINSDAYES---KRVPSYCDRILWM---GNSCLN-----ISYQSYPEFLFSDHKPISGDFLIDIRD-ASRRL 345          
BLAST of IPPc domain-containing protein vs. Planmine SMEST
Match: SMESG000008580.1 (SMESG000008580.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.417e-19
Identity = 84/315 (26.67%), Postives = 146/315 (46.35%), Query Frame = 2
Query:   77 KVKLITYNVGDKSADQSKPDELFNFVQLRKF-DFIFIGLQE-VVQDTSWTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASGYAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQSFRDD----------EVNNILDH-DVIFWMGDLNFRIENLSKEEIENAIKE---KSFSV--LTDHDQLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRILYLTHDDDKILN-QNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRL 964
            ++ ++T+N+ +K+       E  + +  R+  D +    QE  +  +     I+   G  NYV+        I++ L+  +  + ++ ++  +V ++    +   KG  ++ F +   SI+ +  H +        RL DY  I+  +   +           E NNI D+ D  FW GD NFR+ NL   ++   I +   KS  +  L +HD+L        +F+ F+EG + F PT+KFD + + Y+   K R PA+TDRIL+      K LN Q  + + Y S  S+  SDH+PV A  +I    +    L
Sbjct:  266 RIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVG-LNYVIYDEIENKKIYVVLVGHKKFIWNIGAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSSDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRL-NLEDVKVRRIISQEHSKSIKIENLLEHDELINGQIDSVIFQDFQEGRIVFMPTYKFDINTNEYN---KNRTPAYTDRILF------KNLNEQGLDYLHYSSVESVVASDHKPVYAIIEIKIEKQNEEYL 567          
The following BLAST results are available for this feature:
BLAST of IPPc domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
INPP5K7.697e-5430.23inositol polyphosphate-5-phosphatase K [Source:HGN... [more]
INPP5J1.362e-5334.04inositol polyphosphate-5-phosphatase J [Source:HGN... [more]
INPP5J1.362e-5334.04inositol polyphosphate-5-phosphatase J [Source:HGN... [more]
INPP5J1.851e-5334.22inositol polyphosphate-5-phosphatase J [Source:HGN... [more]
INPP5J3.950e-5235.71inositol polyphosphate-5-phosphatase J [Source:HGN... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-262.624e-4034.94Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5E... [more]
unc-262.941e-4034.94Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5E... [more]
ocrl-11.121e-2528.10OCRL (Lowe's oculocerebrorenal syndrome protein) h... [more]
cil-11.184e-2524.71Inositol polyphosphate 5-phosphatase [Source:UniP... [more]
inpp-11.089e-1726.23INositol Polyphosphate-5-Phosphatase [Source:UniP... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG97844.557e-4529.07gene:FBgn0030761 transcript:FBtr0330409[more]
CG97844.639e-4529.07gene:FBgn0030761 transcript:FBtr0074289[more]
CG97844.639e-4529.07gene:FBgn0030761 transcript:FBtr0310319[more]
CG68051.058e-3830.49gene:FBgn0034179 transcript:FBtr0306574[more]
CG68051.618e-3830.49gene:FBgn0034179 transcript:FBtr0086966[more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5ja5.280e-6033.11inositol polyphosphate-5-phosphatase Ja [Source:ZF... [more]
inpp5ja5.799e-6033.26inositol polyphosphate-5-phosphatase Ja [Source:ZF... [more]
inpp5jb3.284e-5830.73inositol polyphosphate-5-phosphatase Jb [Source:ZF... [more]
inpp5ka2.507e-5630.59inositol polyphosphate-5-phosphatase Ka [Source:ZF... [more]
inpp5kb5.134e-5329.27inositol polyphosphate-5-phosphatase Kb [Source:ZF... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5k2.494e-5631.85inositol polyphosphate-5-phosphatase K [Source:NCB... [more]
cacna1i3.797e-5632.92calcium channel, voltage-dependent, T type, alpha ... [more]
inpp5k4.608e-5632.37inositol polyphosphate-5-phosphatase K [Source:NCB... [more]
cacna1i6.015e-5631.85calcium channel, voltage-dependent, T type, alpha ... [more]
cacna1i7.706e-5632.59calcium channel, voltage-dependent, T type, alpha ... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inpp5j3.372e-5533.78inositol polyphosphate 5-phosphatase J [Source:MGI... [more]
Inpp5j1.954e-5333.69inositol polyphosphate 5-phosphatase J [Source:MGI... [more]
Inpp5j7.712e-5333.69inositol polyphosphate 5-phosphatase J [Source:MGI... [more]
Inpp5k4.037e-5229.93inositol polyphosphate 5-phosphatase K [Source:MGI... [more]
Inpp5b4.325e-4734.63inositol polyphosphate-5-phosphatase B [Source:MGI... [more]
back to top
BLAST of IPPc domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BT40|INP5K_HUMAN3.696e-5330.23Inositol polyphosphate 5-phosphatase K OS=Homo sap... [more]
sp|P59644|PI5PA_MOUSE5.395e-5233.69Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
sp|Q9JMC1|PI5PA_RAT9.477e-5233.69Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
sp|Q8C5L6|INP5K_MOUSE2.824e-5129.93Inositol polyphosphate 5-phosphatase K OS=Mus musc... [more]
sp|Q15735|PI5PA_HUMAN4.338e-5133.95Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
back to top
BLAST of IPPc domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183N4H71.598e-9137.19IPPc domain-containing protein OS=Schistosoma marg... [more]
A0A4E0S4122.623e-9034.79Phosphatidylinositol 45 bisphosphate OS=Fasciola h... [more]
A0A3Q0KFR44.538e-8936.71Putative synaptojanin OS=Schistosoma mansoni OX=61... [more]
G4VIB36.890e-8936.57Putative synaptojanin OS=Schistosoma mansoni OX=61... [more]
A0A4S2KZS21.574e-8734.23IPPc domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5kb7.028e-5329.66inositol polyphosphate 5-phosphatase K-like [Sourc... [more]
inpp5ka1.765e-5230.45inositol polyphosphate 5-phosphatase K-like [Sourc... [more]
inpp5ja6.914e-5231.05inositol polyphosphate-5-phosphatase Ja [Source:ZF... [more]
ENSAMXT00000036573.17.742e-5232.61pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
inpp5kb2.486e-5029.08inositol polyphosphate 5-phosphatase K-like [Sourc... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
synj13.773e-4032.28synaptojanin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-91... [more]
ENSPMAT00000008151.13.104e-3234.71pep scaffold:Pmarinus_7.0:GL492242:1419:4886:1 gen... [more]
ENSPMAT00000010915.12.520e-1827.50pep scaffold:Pmarinus_7.0:GL482779:12:3705:-1 gene... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
INP531.594e-4434.62Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
INP528.776e-4333.55Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
INP518.643e-3434.32Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
INP542.283e-1327.22Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320851.181e-4639.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339681.912e-4236.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434252.862e-3428.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291832.310e-2526.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259178.577e-1940.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of IPPc domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5ka3.564e-5730.47inositol polyphosphate 5-phosphatase K [Source:NCB... [more]
inpp5jb3.087e-5533.16phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
inpp5ka1.312e-5329.68inositol polyphosphate 5-phosphatase K [Source:NCB... [more]
inpp5jb3.547e-5333.51phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
inpp5jb9.916e-5231.17phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
back to top
BLAST of IPPc domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026603.10.000e+0100.00SMESG000026603.1[more]
SMESG000043682.14.396e-3936.26SMESG000043682.1[more]
SMESG000022768.17.687e-3136.36SMESG000022768.1[more]
SMESG000056307.13.760e-2028.52SMESG000056307.1[more]
SMESG000008580.11.417e-1926.67SMESG000008580.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000817 ID=SMED30000817|Name=IPPc domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1687bp
TGACCTTAGATTAATGTAAATGAACATTATTTAAACTGCATTTAAATAAT
TTTTCATAAATTAAATGGAAAATATCAAAGTTAAGCTAATCACTTATAAC
GTTGGAGATAAAAGTGCAGATCAATCCAAACCAGATGAATTGTTTAATTT
TGTTCAATTGAGAAAATTCGATTTCATATTTATTGGACTTCAAGAAGTTG
TCCAGGACACTTCATGGACTGCATTGATCAAGAAATGCTTTGGCGAACAC
AACTATGTTCTGGTAAAAGTAAGAAATATTTGGGCAATTTGGCTGTATTT
ATTGGCAAAACGTTCACGACTGCCACACGTGGACAGTGTGGAATCTGAGG
TGACCGCTTCGGGCTATGCCGGAGTCTTGGGCAACAAGGGTGGCGTTTCC
ATTCGGTTCAAATATCACGAAATAAGCATCATTGGAGTGAATGGGCATTT
TACTCCCCACGAAGAAGGATTCAAAGATCGATTGAATGATTACCTAGATA
TCGTTACAGGCCAATCGTTCCGTGATGACGAAGTGAACAATATTCTCGAT
CATGACGTCATTTTCTGGATGGGCGATCTCAACTTCAGGATTGAAAATCT
GTCGAAAGAAGAAATTGAAAATGCGATCAAAGAGAAATCATTTTCAGTGC
TGACGGATCACGATCAGCTTAACAAGGCAGTTAAGCACCACAATGTGTTC
AAGGGATTCAAGGAAGGTGAGCTCAATTTCGCTCCAACGTTCAAGTTTGA
TGACGACTGCGACACGTACGACACTAGCAAAAAGAAGAGAAAACCCGCAT
GGACCGATCGGATCCTTTACTTGACGCACGATGACGACAAGATTCTGAAT
CAAAATACTGAGCTCATCAAATATTACAGCGAGCCTTCTATTCGCGGATC
CGATCACCGACCAGTTTGTGCTGAGTTCAAAATATCATTCAATTCTCGAG
GCTCTCATCGGCTACCAATAGAATTCACTGAGATATCGAAAGTTTGGACT
GCTGATAAGGATCAATTGGTTACGTATCAATGTCCCAGTAACTCGGCTGG
TGACAAGGAGACCGCAGATCAACCCCATGACCACGGTCGGTTCAAGCCAG
ACCGATGGGATTGGATAGGTCTGGTGCCTAGCAATTGGACAGTGCTATCG
GAGGATACAATTACGTACGTTTATGTGACAGCCGATTGTGAGCATGACCT
GCAACGGCAGGCCTCAGTGAAGTTCGAACGGAAATATTTCAGTGGGATCC
CATCAAAATCCGAATTGCAGTTGATTTATTTCAGCAAAAGGATGAATTGC
ATTCAGGGAATTTCCAACAATTTCTCGTTCACTCGAACTGGCAATTGACG
AAATGGGCGACTCAGTTTCTGTCGAACGCTTCCTTCAGGACAAATCGAAG
GCCTTTTTAATTTTATCAACTTTATCGCTCAATTCATTTCTTATGAATTT
TGCTTTGACTTTATCGGCTTCTAGACTTCTTTTCTTTTCTCTTTTCTGCA
TCCCATGCTCGATGACGCAATTCGGGCGATTTCGCTATCATTATTACTAT
TATTATTATTAGTCTCGATGTTACTGTCGGCAATAATTCCTTCTTGATTT
TATATGAAGATTTTATTTCAACTTAGCTGTGAGTTTAGATATCTTTGTCG
CTTTTATTACTGTGACTGACATTTATTTCAATATAGA
back to top

protein sequence of SMED30000817-orf-1

>SMED30000817-orf-1 ID=SMED30000817-orf-1|Name=SMED30000817-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MENIKVKLITYNVGDKSADQSKPDELFNFVQLRKFDFIFIGLQEVVQDTS
WTALIKKCFGEHNYVLVKVRNIWAIWLYLLAKRSRLPHVDSVESEVTASG
YAGVLGNKGGVSIRFKYHEISIIGVNGHFTPHEEGFKDRLNDYLDIVTGQ
SFRDDEVNNILDHDVIFWMGDLNFRIENLSKEEIENAIKEKSFSVLTDHD
QLNKAVKHHNVFKGFKEGELNFAPTFKFDDDCDTYDTSKKKRKPAWTDRI
LYLTHDDDKILNQNTELIKYYSEPSIRGSDHRPVCAEFKISFNSRGSHRL
PIEFTEISKVWTADKDQLVTYQCPSNSAGDKETADQPHDHGRFKPDRWDW
IGLVPSNWTVLSEDTITYVYVTADCEHDLQRQASVKFERKYFSGIPSKSE
LQLIYFSKRMNCIQGISNNFSFTRTGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041611SKICH
IPR036691Endo/exonu/phosph_ase_sf
IPR000300IPPc
IPR005135Endo/exonuclease/phosphatase
Vocabulary: biological process
TermDefinition
GO:0046856phosphatidylinositol dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000300Inositol polyphosphate-related phosphataseSMARTSM00128i5p_5coord: 2..297
e-value: 2.9E-69
score: 246.1
IPR041611SKICH domainPFAMPF17751SKICHcoord: 342..422
e-value: 1.1E-12
score: 48.3
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 1..320
e-value: 1.5E-86
score: 292.5
IPR036691Endonuclease/exonuclease/phosphatase superfamilySUPERFAMILYSSF56219DNase I-likecoord: 2..292
NoneNo IPR availableGENE3DG3DSA:2.60.40.2840coord: 339..427
e-value: 2.5E-8
score: 36.0
NoneNo IPR availablePANTHERPTHR11200INOSITOL 5-PHOSPHATASEcoord: 2..319