Zinc finger MYM-type protein 1

Overview
NameZinc finger MYM-type protein 1
Smed IDSMED30000808
Length (bp)1393
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYM-type protein 1 (SMED30000808) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30000808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYM-type protein 1 (SMED30000808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30000808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000808SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000808SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000808SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000808SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000808SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000808 dd_Smed_v4_16935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000808SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 8.216e-16
Identity = 40/80 (50.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 1009 CFPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
            C+PN+    ++ LT  V++ SC+RSFSKL+LI +  R+SMEQ+RLS+L +LSIE     K  FD+V D F  +K+RKI L
Sbjct:  643 CYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSIEHEMARKIDFDDVIDHFAAMKARKIAL 722          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A087TIQ9 (Zinc finger MYM-type protein 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_18049 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.238e-58
Identity = 110/280 (39.29%), Postives = 160/280 (57.14%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA--------------*RAELKLKSGLDEDIGCLEN*QRTLVCRQRRNSSML*MAFXXXXXXK----FGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVF 1015
            +++FSRSTLRW++LK AL +++K ESET WSARVEAV  +++ L  LV L E +++D +   +TRS+   LL  +L F F  LL FW+T+L+KID VQK+LQD +MNF +AA D+++L+  L + R  +  K  +DA               R + K+   + +D+G     +   + +   +   + M        K    FG LLDV  L    ++  +S  Q C  +EN YDTD+ G E+  EI DC+ML + R D    TP DLL F + YGEDVF
Sbjct:  388 YVYFSRSTLRWKRLKTALGVSLKSESETRWSARVEAVKPVHDQLETLVELFENIAEDHDENADTRSDAIQLLHRILTFEFFVLLRFWNTVLAKIDRVQKRLQDPSMNFHNAARDIQALQEYLLQNRDEICMKSLEDAKELCNACDIQAERRQRKKKKMPGEIADDVGLTAENEMLRLMKSMLDKIHIEMVDRFISLKKVDSNFGFLLDVNGLMATGNE--SSLKQCCISMENFYDTDLDGLEMYTEIMDCRMLFKTRADVKLSTPEDLLRFIVQYGEDVF 665          

HSP 2 Score: 85.1149 bits (209), Expect = 1.238e-58
Identity = 43/74 (58.11%), Postives = 51/74 (68.92%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKS 1233
            FPNLR+ LQ+LLTI  SI SCERSFSKL+ I S  R SM Q+RLS L LLS+E+   +   FDE+ DKF   K 
Sbjct:  665 FPNLRVGLQILLTIGTSIASCERSFSKLKHILSYLRLSMAQERLSALALLSVEQQVAQSINFDELIDKFAAAKG 738          

HSP 3 Score: 27.335 bits (59), Expect = 1.238e-58
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  202 VTFFGTIESIYVFLS 246
            VTFF TI++IYV+ S
Sbjct:  378 VTFFSTIQAIYVYFS 392          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A087TT59 (Zinc finger MYM-type protein 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_17981 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.306e-56
Identity = 100/280 (35.71%), Postives = 146/280 (52.14%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA--------------*RAELKLKSGLDEDIGCLEN*QRTLVCRQRRNSSML*MAFXXXXXXK----FGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVF 1015
            +++FSRS LRW++LK AL +++K ESET WSARVEAV  +++ L  LV LLE +++D +   +TR                        IL+KID VQK+LQD +MNF +AA D+++L+  L + R  +  K  +DA               R + K+   + +D+G     +   + +   +   + M        K    FG LLDV  L    ++  +S  Q C  +EN YDTD+ G E+  EI DC+ML + R D    TP DLL F + YGEDVF
Sbjct:  345 YVYFSRSILRWKRLKTALGVSLKSESETRWSARVEAVKPVHDQLETLVELLENIAEDHDENADTR------------------------ILAKIDRVQKRLQDPSMNFHNAARDIQALQEYLLQNRDEICMKSLEDAKELCNACDIQAERRQRKKKKMPGEIADDVGLTAENEMLRLMKSMLDKIHIEMVDRFISLKKVDSNFGFLLDVNGLMATGNE--SSLKQCCISMENFYDTDLDGLEMYTEIMDCRMLFKTRADVKLSTPEDLLRFIVQYGEDVF 598          

HSP 2 Score: 92.8189 bits (229), Expect = 2.306e-56
Identity = 47/79 (59.49%), Postives = 57/79 (72.15%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
            FPNLR+ LQ+LLTI  SI SCERSFSKL+ I S  R SM Q+RLS L LLS+E+   +   FDE+ DKF   K+RKI+L
Sbjct:  598 FPNLRVGLQILLTIGTSIASCERSFSKLKHILSYLRLSMAQERLSALALLSVEQQVAQSINFDELIDKFAAAKARKISL 676          

HSP 3 Score: 27.7202 bits (60), Expect = 2.306e-56
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  202 VTFFGTIESIYVFLS 246
            VTFF TI++IYV+ S
Sbjct:  335 VTFFSTIQAIYVYFS 349          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A087TNS4 (Zinc finger MYM-type protein 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_13867 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.138e-55
Identity = 109/280 (38.93%), Postives = 159/280 (56.79%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA--------------*RAELKLKSGLDEDIGCLEN*QRTLVCRQRRNSSML*MAFXXXXXXK----FGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVF 1015
            +++FSRS LRW++LK AL +++K ESET WSARVEAV  +++ L  LV L E +++D +   +TRS+   LL  +L F F  LL FW+T+L+KID VQK+LQD +MNF +AA D+++L+  L + R  +  K  +DA               R + K+   + +D+G     +   + +   +   + M        K    FG LLDV  L    ++  +S  Q C  +EN YDTD+ G E+  EI DC+ML + R D    TP DLL F + YGEDVF
Sbjct:  345 YVYFSRSILRWKRLKTALGVSLKSESETRWSARVEAVKPVHDQLETLVELFENIAEDHDENADTRSDAIQLLHRILTFEFFVLLRFWNTVLAKIDRVQKRLQDPSMNFHNAARDIQALQEYLLQNRDEICMKSLEDAKELCNACDIQAERRQRKKKKMPGEIADDVGLTAENEMLRLMKSMLDKIHIEMVDRFISLKKVDSNFGFLLDVNGLMATGNE--SSLKQCCISMENFYDTDLDGLEMYTEIMDCRMLFKTRADVKLSTPEDLLRFIVQYGEDVF 622          

HSP 2 Score: 75.485 bits (184), Expect = 3.138e-55
Identity = 42/79 (53.16%), Postives = 52/79 (65.82%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
            FPNLR+ LQ+LLTI  SI SCERSFSKL+ I S  R SM Q+RLS L LLS+E+ ++     +E    FT    RK+ L
Sbjct:  622 FPNLRVGLQILLTIGTSIASCERSFSKLKHILSYLRLSMAQERLSALALLSVEQQKLSLTKTEETF--FTVPNKRKVQL 698          

HSP 3 Score: 27.335 bits (59), Expect = 3.138e-55
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  202 VTFFGTIESIYVFLS 246
            VTFF TI++IYV+ S
Sbjct:  335 VTFFSTIQAIYVYFS 349          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A087U3S3 (Zinc finger MYM-type protein 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_05054 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.146e-55
Identity = 110/280 (39.29%), Postives = 160/280 (57.14%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA--------------*RAELKLKSGLDEDIGCLEN*QRTLVCRQRRNSSML*MAFXXXXXXK----FGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVF 1015
            +++FSRSTLRW++LK AL +++K ESET WSARVEAV  +++ L  LV L E +++D +   +TRS+   LL  +L F F  LL FW+T+L+KID VQK+LQD +MNF +AA D+++L+  L + R  +  K  +DA               R + K+   + +D+G     +   + +   +   + M        K    FG LLDV  L    ++  +S  Q C  +EN YDTD+ G E+  EI DC+ML + R D    TP DLL F + YGEDVF
Sbjct:  329 YVYFSRSTLRWKRLKTALGVSLKSESETRWSARVEAVKPVHDQLETLVELFENIAEDHDENADTRSDAIQLLHRILTFEFFVLLRFWNTVLAKIDRVQKRLQDPSMNFHNAARDIQALQEYLLQNRDEICMKSLEDAKELCNACDIQAERRQRKKKKMPGEIADDVGLTAENEMLRLMKSMLDKIHIEMVDRFISLKKVDSNFGFLLDVNGLMATGNE--SSLKQCCISMENFYDTDLDGLEMYTEIMDCRMLFKTRADVKLSTPEDLLRFIVQYGEDVF 606          

HSP 2 Score: 72.7886 bits (177), Expect = 5.146e-55
Identity = 39/62 (62.90%), Postives = 45/62 (72.58%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNE--MEKC 1191
            FPNLR+ LQ+LLTI  SI SCERSFSKL+ I S  R SM Q+RLS L LLS+E+    ME C
Sbjct:  606 FPNLRVGLQILLTIGTSIASCERSFSKLKHILSYLRLSMAQERLSALALLSVEQQSERMEYC 667          

HSP 3 Score: 27.7202 bits (60), Expect = 5.146e-55
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  202 VTFFGTIESIYVFLS 246
            VTFF TI++IYV+ S
Sbjct:  319 VTFFSTIQAIYVYFS 333          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A087UGJ9 (Zinc finger MYM-type protein 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_20842 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.106e-54
Identity = 110/280 (39.29%), Postives = 160/280 (57.14%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA--------------*RAELKLKSGLDEDIGCLEN*QRTLVCRQRRNSSML*MAFXXXXXXK----FGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVF 1015
            +++FSRSTLRW++LK AL +++K ESET WSARVEAV  +++ L  LV L E +++D +   +TRS+   LL  +L F F  LL FW+T+L+KID VQK+LQD +MNF +AA D+++L+  L + R  +  K  +DA               R + K+   + +D+G     +   + +   +   + M        K    FG LLDV  L    ++  +S  Q C  +EN YDTD+ G E+  EI DC+ML + R D    TP DLL F + YGEDVF
Sbjct:  119 YVYFSRSTLRWKRLKTALGVSLKSESETRWSARVEAVKPVHDQLETLVELFENIAEDHDENADTRSDAIQLLHRILTFEFFVLLRFWNTVLAKIDRVQKRLQDPSMNFHNAARDIQALQEYLLQNRDEICMKSLEDAKELCNACDIQAERRQRKKKKMPGEIADDVGLTAENEMLRLMKSMLDKIHIEMVDRFISLKKVDSNFGFLLDVNGLMATGNE--SSLKQCCISMENFYDTDLDGLEMYTEIMDCRMLFKTRADVKLSTPEDLLRFIVQYGEDVF 396          

HSP 2 Score: 71.633 bits (174), Expect = 1.106e-54
Identity = 36/54 (66.67%), Postives = 42/54 (77.78%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIER 1173
            FPNLR+ LQ+LLTI  SI SCERSFSKL+ I S  R SM Q+RLS L LLS+E+
Sbjct:  396 FPNLRVGLQILLTIGTSIASCERSFSKLKHILSYLRLSMAQERLSALALLSVEQ 449          

HSP 3 Score: 27.335 bits (59), Expect = 1.106e-54
Identity = 10/15 (66.67%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  202 VTFFGTIESIYVFLS 246
            VTFF TI++IYV+ S
Sbjct:  109 VTFFSTIQAIYVYFS 123          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000030311.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:30949094:30950197:-1 gene:ENSAMXG00000039955.1 transcript:ENSAMXT00000030311.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.180e-10
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINLI 1251
            FP L+  +Q  LTI VS  SCERSFS LR + +  R +M Q+RL  L ++SIE+  ++  + D V D+F  +K R+  L+
Sbjct:  285 FPTLKATVQAALTIPVSSCSCERSFSALRRLHTWLRRTMGQNRLHHLAVMSIEKELLDSISPDIVIDRFANLKVRRHRLV 364          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000040801.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:3031619:3038346:1 gene:ENSAMXG00000043357.1 transcript:ENSAMXT00000040801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 2.000e-10
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINLI 1251
            FP L+  +Q  LTI VS  SCERSFS LR + +  R +M Q+RL  L ++SIE+  ++  + D V D+F  +K R+  L+
Sbjct:  641 FPTLKATVQAALTIPVSSCSCERSFSALRRLHTWLRRTMGQNRLHHLAVMSIEKELLDSISPDIVIDRFANLKVRRHRLV 720          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 7.041e-10
Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRK 1239
            +PNL I L++ LT+ V++ S ERSFSKL+LI +  R++M Q+RLS L ++SI        + D++   F   K+R+
Sbjct:  743 YPNLWIALRIALTLPVTVASAERSFSKLKLIKTYLRSTMGQERLSGLAVISINAEVAHSLSLDDLISDFAARKARR 818          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042715.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11855083:11857132:-1 gene:ENSAMXG00000035113.1 transcript:ENSAMXT00000042715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 5.121e-9
Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
            FPN+ I L++ LT+ ++    ERSFSKL  I +  R  M Q+RL+ L LL+IE + + +  FDE+ D F   KSRK ++
Sbjct:  580 FPNVYIALRLFLTVPITNCEGERSFSKLARIKNELRIRMRQNRLNSLSLLAIESDLVRQLNFDELVDDFARKKSRKKHI 658          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 6.297e-9
Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
            FPN+ I L++ LT+ ++    ERSFSKL  I +  R  M Q+RL+ L LL+IE + + +  FDE+ D F   KSRK ++
Sbjct:  782 FPNVYIALRLFLTVPITNCEGERSFSKLARIKNELRIRMRQNRLNSLSLLAIESDLVRQLNFDELVDDFARKKSRKKHI 860          

HSP 2 Score: 54.299 bits (129), Expect = 2.057e-7
Identity = 41/131 (31.30%), Postives = 60/131 (45.80%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQL--KNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL 616
            F F + ST RW ++     + +T+K  S T WSAR E+  A+++    L   L  +S D+     TRSE   L   +       + YFW TIL +  +   QLQ   ++   A   L SL   +A  R N 
Sbjct:  507 FTFCASSTHRWRKVFRDTDIKLTLKSLSGTRWSARAESTKALWKYYAQLREALNDMSKDMEEKCVTRSEASALCDKLDTLETAFMAYFWDTILQRFQASSLQLQKHDIDICTAPQLLLSLRDFVAAQRDNF 637          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO35158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB6])

HSP 1 Score: 45.8246 bits (107), Expect = 3.114e-6
Identity = 24/80 (30.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1009 CFPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
             + N+   L++L+T+ +S  SCERS S LR + +  R++M +DRL+ L L+   ++       D + D F  +  R++ +
Sbjct:   47 AYVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKD--MDLDLDRIIDSFAQLHPRRMRM 124          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO29399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB6])

HSP 1 Score: 45.8246 bits (107), Expect = 3.114e-6
Identity = 24/80 (30.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1009 CFPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
             + N+   L++L+T+ +S  SCERS S LR + +  R++M +DRL+ L L+   ++       D + D F  +  R++ +
Sbjct:   47 AYVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKD--MDLDLDRIIDSFAQLHPRRMRM 124          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO32247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL6])

HSP 1 Score: 45.8246 bits (107), Expect = 3.205e-6
Identity = 25/80 (31.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1009 CFPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
             F N+   L++L+T+ +S  SCERS S LR + +  R++M +DRL+ L L+   ++       D + D F  +  R++ +
Sbjct:   47 AFVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKD--MDLDLDRIIDLFAQLHPRRMRM 124          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO32811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU05])

HSP 1 Score: 45.4394 bits (106), Expect = 4.994e-6
Identity = 24/80 (30.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1009 CFPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
             + N+   L++L+T+ +S  SCERS S LR + +  R++M +DRL+ L L+   ++       D + D F  +  R++ +
Sbjct:   47 AYVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKD--MDLDLDRIIDLFAQLHPRRMKM 124          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO33687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRH2])

HSP 1 Score: 45.0542 bits (105), Expect = 5.825e-6
Identity = 24/80 (30.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1009 CFPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINL 1248
             + N+   L++L+T+ +S  SCERS S LR + +  R++M +DRL+ L L+   ++       D + D F  +  R++ +
Sbjct:   45 AYVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKD--MDLDLDRIIDLFAQLHPRRMRM 122          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 69.707 bits (169), Expect = 2.854e-12
Identity = 32/77 (41.56%), Postives = 55/77 (71.43%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKI 1242
            +PN    L++ LT+ V++   ERSFSKL+LI S  R++M Q+RL++L ++SI  +  E+ ++D+V D+F + K+RK+
Sbjct:  773 YPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKV 849          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 69.707 bits (169), Expect = 2.854e-12
Identity = 32/77 (41.56%), Postives = 55/77 (71.43%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKI 1242
            +PN    L++ LT+ V++   ERSFSKL+LI S  R++M Q+RL++L ++SI  +  E+ ++D+V D+F + K+RK+
Sbjct:  773 YPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKV 849          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 69.707 bits (169), Expect = 2.854e-12
Identity = 32/77 (41.56%), Postives = 55/77 (71.43%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKI 1242
            +PN    L++ LT+ V++   ERSFSKL+LI S  R++M Q+RL++L ++SI  +  E+ ++D+V D+F + K+RK+
Sbjct:  773 YPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKV 849          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000029155.1 (SMESG000029155.1)

HSP 1 Score: 176.022 bits (445), Expect = 1.226e-60
Identity = 124/316 (39.24%), Postives = 183/316 (57.91%), Query Frame = 2
Query:  134 NSMNLQIAKIHEGLNRIKDLHTLSRSLAQSKAFMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA--------------------*RAELKLKSGLDEDIGCLEN*QRTLVCRQRRNSSML*MAFXXXX--XXKFGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVF 1015
            N+ +L +A +H      +D   ++  +     +++FSRSTLRW +LKN +  TV +E ET WSAR +AV A++  + ++VGLLEKLSDD + T +TR++ E LLAN+L+FNFL LL+FWH IL KID VQ +LQD T+NF++AA+DL+ LE++L + R  L ++  Q A                       E+   +GL  +    EN  R +     R  +   + F      N KFG LL++  L   +  D     ++C +L + YD+D+ G EL NEICD +ML++ R D L  +P+DLL   + YGEDVF
Sbjct:   25 NNHSLNLAGMHSA---KQDAVAVTFFVTIESIYLYFSRSTLRWNELKNVISNTVNKECETRWSARADAVKALHNGVNEIVGLLEKLSDDNSQTQDTRADAERLLANILDFNFLVLLHFWHQILGKIDRVQNRLQDPTVNFREAASDLQFLELHLNEVRSELCEEAIQKAKDMCNKWGIAVESRVRRRRRMAGEMARDAGLYSE----ENINRIMKSIIDRLKAEFSLRFKRLQDLNFKFGFLLNINNLLRMKKVD---LEEKCLNLASFYDSDVNGIELFNEICDTKMLMKTRCDTLLSSPVDLLKLTVLYGEDVF 330          

HSP 2 Score: 77.411 bits (189), Expect = 1.226e-60
Identity = 39/62 (62.90%), Postives = 47/62 (75.81%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAF 1197
            FPNLRI LQ+LLTI VSI SC+RSFSKL+LI S  R SM Q+RL  L LLS+ER+ ++   F
Sbjct:  330 FPNLRIALQMLLTIVVSIASCQRSFSKLKLILSYLRESMGQERLDSLALLSVERDTLDSIGF 391          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000065662.1 (SMESG000065662.1)

HSP 1 Score: 177.178 bits (448), Expect = 7.276e-49
Identity = 125/211 (59.24%), Postives = 145/211 (68.72%), Query Frame = 2
Query:  407 ATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQ----NL*KKPKQDA*RAELKL------KSGLDEDIGCLEN*QRTLVC-------RQRRNSSML*MAFXXXXXXKFGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSF 988
              +ETRS+ E LLANVLNFNFLALLYFWHTIL KID VQK+LQD TMNFKDAAADLESLEINLA+  Q    N   KPK       +++      +  L +D+G     ++  V        RQ  ++ +L +   N+LNLKFG LLDVKTLF NEDQDNNS  Q CRD+ N YDTDI G ELC EIC+CQMLLRVRDDAL  TPL+LLSF
Sbjct:  403 GKNETRSDAENLLANVLNFNFLALLYFWHTILGKIDRVQKRLQDPTMNFKDAAADLESLEINLAEIHQDLCANFVGKPKTSCITWGVEVDKTKTSEGELAQDVGLSAEEEQIRVMKGVLDRLRQEISTRILRL---NDLNLKFGFLLDVKTLFNNEDQDNNSLRQHCRDVGNFYDTDIHGVELCTEICECQMLLRVRDDALSATPLNLLSF 610          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000078061.1 (SMESG000078061.1)

HSP 1 Score: 168.318 bits (425), Expect = 1.530e-47
Identity = 118/292 (40.41%), Postives = 169/292 (57.88%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA*RAELKLKSGL------------------DEDIGCLEN*QRTLVCRQRRNSSML*MAFXXXX--XXKFGILLDVKTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVFQTCESDCKFF 1045
            +++FSRSTLRW +LKN +  TVKRE ET WSAR +AV A++  + ++VGLLEKLS D + T +TR+  E LL N+L+FNFL LL+F H IL KID VQK+LQD T+NF +AA++L+SLE++L + R    ++  Q A   ++  K G+                  D  +   EN  R +     R  +   + F      N KFG LL++  L   +  D     ++C +L + YD D+ G EL NEICD +ML++ R D L  +P+ LL   + YGEDVF   +   + F
Sbjct:   21 YLYFSRSTLRWNELKNVISNTVKRECETRWSARADAVKAVHNGVNEIVGLLEKLSVDNSQTQDTRANAERLLENILDFNFLVLLHFRHQILGKIDRVQKRLQDPTVNFGEAASNLQSLELHLNEVRSESCEEAIQKA--KDMCNKWGIVVESRVRRRRRIAEEMARDAGLYSEENINRIMKSIIDRFKAEFSLRFKRLQDLNFKFGFLLNINNLLSMKKVD---LEEKCLNLASFYDNDVNGTELFNEICDTKMLMKTRCDTLLSSPVHLLKLIVLYGEDVFPNLKIALQMF 307          

HSP 2 Score: 88.5817 bits (218), Expect = 6.553e-19
Identity = 46/80 (57.50%), Postives = 58/80 (72.50%), Query Frame = 1
Query: 1012 FPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINLI 1251
            FPNL+I LQ+ LTI+VSI SCERSFSKL+LI S  R SM Q+RL  L LLS+ER  ++   FD+V + F  V+ RKI L+
Sbjct:  297 FPNLKIALQMFLTIAVSIASCERSFSKLKLILSYLRESMGQERLDSLALLSVERETLDSINFDDVINTFAGVEPRKIFLM 376          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000030834.1 (SMESG000030834.1)

HSP 1 Score: 126.716 bits (317), Expect = 3.658e-34
Identity = 75/137 (54.74%), Postives = 103/137 (75.18%), Query Frame = 2
Query:  230 FMFFSRSTLRWEQLKNALHITVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVETXXXXXXXXXXXXXXYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEINLAKFRQNL*KKPKQDA 640
            +++FSRSTLRW++LKN +  TVKRE ET WSAR + V A++  + ++ GLLEKLSDD + T +TR++ E LLAN+L+FNFL LL+FWH IL KID  Q +LQD T+NF +AA+DL+SLE++  + R  L K+  Q A
Sbjct:   21 YLYFSRSTLRWKELKNVISNTVKRECETRWSARADPVKAVHNGVNEIEGLLEKLSDDNSQTQDTRADAERLLANILDFNFLVLLHFWHQILCKIDRFQIRLQDPTVNFGEAASDLQSLELHFNEVRSELCKEAIQKA 157          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000000523.1 (SMESG000000523.1)

HSP 1 Score: 120.168 bits (300), Expect = 9.554e-34
Identity = 57/71 (80.28%), Postives = 60/71 (84.51%), Query Frame = 2
Query:  803 KTLFYNEDQDNNSPTQQCRDLENLYDTDIQGDELCNEICDCQMLLRVRDDALPITPLDLLSFFISYGEDVF 1015
            KTLF N+DQDNNS  Q CRDL NLYDTDIQG +LC EI DCQMLLRVR+DALP TPLDLL F ISYGEDVF
Sbjct:   34 KTLFKNQDQDNNSLRQHCRDLGNLYDTDIQGKKLCTEISDCQMLLRVRNDALPATPLDLLPFIISYGEDVF 104          

HSP 2 Score: 43.1282 bits (100), Expect = 9.554e-34
Identity = 20/32 (62.50%), Postives = 24/32 (75.00%), Query Frame = 1
Query:  688 MLGELTKDAGLPAEEELIHVMNGVLEQSKLEI 783
            M GEL +D GL  EEELI VMNGVL++ + EI
Sbjct:    1 MPGELAQDVGLSTEEELIRVMNGVLDRLRQEI 32          

HSP 3 Score: 102.449 bits (254), Expect = 3.294e-25
Identity = 61/95 (64.21%), Postives = 67/95 (70.53%), Query Frame = 1
Query:  967 SIGSFVFLHFLW*GCFPNLRIRLQVLLTISVSITSCERSFSKLRLIFS*FRASMEQDRLSDLPLLSIERNEMEKCAFDEVNDKFTTVKSRKINLI 1251
            S G  VFL+         LRI  Q+LLTISVSI SCERSFSKL+LI S  RA M Q RL+DL LLSI+RNEMEK  FDEV  KF TVKSRK +LI
Sbjct:   98 SYGEDVFLY---------LRIAPQILLTISVSIASCERSFSKLKLILSYLRALMGQARLTDLALLSIKRNEMEKRDFDEVTAKFATVKSRKRDLI 183          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043220.18.216e-1650.00pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087TIQ91.238e-5839.29Zinc finger MYM-type protein 1 (Fragment) OS=Stego... [more]
A0A087TT592.306e-5635.71Zinc finger MYM-type protein 1 (Fragment) OS=Stego... [more]
A0A087TNS43.138e-5538.93Zinc finger MYM-type protein 1 (Fragment) OS=Stego... [more]
A0A087U3S35.146e-5539.29Zinc finger MYM-type protein 1 (Fragment) OS=Stego... [more]
A0A087UGJ91.106e-5439.29Zinc finger MYM-type protein 1 (Fragment) OS=Stego... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030311.11.180e-1042.50pep primary_assembly:Astyanax_mexicanus-2.0:15:309... [more]
ENSAMXT00000040801.12.000e-1042.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036272.17.041e-1040.79pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000042715.15.121e-943.04pep primary_assembly:Astyanax_mexicanus-2.0:16:118... [more]
ENSAMXT00000035531.16.297e-943.04pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO351583.114e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293993.114e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322473.205e-631.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328114.994e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336875.825e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000028133.12.854e-1241.56zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.12.854e-1241.56zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.12.854e-1241.56zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029155.11.226e-6039.24SMESG000029155.1[more]
SMESG000065662.17.276e-4959.24SMESG000065662.1[more]
SMESG000078061.11.530e-4740.41SMESG000078061.1[more]
SMESG000030834.13.658e-3454.74SMESG000030834.1[more]
SMESG000000523.19.554e-3480.28SMESG000000523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000808 ID=SMED30000808|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1393bp
GTGAGACCTTGAATTTTTATGAGCTTAAACAAAAATTTTAAATTTTTGGG
ATTTTAAAAAAATTATAAAAATAAATATTTAAAATAATTACTTTTTATCT
GGTTGATTAGAAAAAAAATAAAATTGAAAGAGAAATTCAATGAACCTGCA
AATAGCAAAAATACATGAAGGACTGAATCGAATAAAAGATTTACACACTT
TGTCACGTTCTTTGGCACAATCGAAAGCATTTATGTTTTTCTCTCGTTCA
ACTCTTCGATGGGAACAACTAAAAAATGCTTTACATATCACGGTTAAACG
TGAATCTGAAACACACTGGAGTGCTAGAGTGGAAGCCGTTAATGCCATTT
ATGAAGATCTTGGTGATTTGGTTGGTTTACTAGAAAAACTATCAGATGAT
TTAAATGCGACACACGAAACAAGAAGCGAGGTAGAAACTTTGTTGGCAAA
TGTTCTAAATTTTAATTTCCTTGCTCTATTGTACTTCTGGCACACAATTC
TGAGTAAAATCGACAGTGTTCAGAAGCAGCTTCAGGATCAAACTATGAAT
TTCAAAGATGCTGCAGCTGATCTGGAATCACTGGAAATAAATCTTGCAAA
ATTTCGTCAAAACTTGTAGAAAAAGCCAAAACAAGATGCATAACGTGCGG
AGTTGAAGTTGAAAAGTGGACTAGATGAAGACATCGGATGCTTGGAGAAT
TAACAAAGGACGCTGGTCTGCCGGCAGAGGAGGAACTCATCCATGTTATG
AATGGCGTTCTAGAACAATCTAAACTTGAAATTTGGAATTTTACTCGATG
TAAAAACTTTATTTTATAACGAAGATCAAGACAATAATTCACCAACACAA
CAGTGTAGAGATCTTGAAAATTTGTATGATACTGATATCCAAGGGGACGA
ACTTTGCAATGAAATTTGTGACTGCCAAATGTTACTTCGGGTAAGAGATG
ATGCTTTACCAATAACTCCATTGGATCTTTTGTCTTTCTTCATTTCTTAT
GGTGAGGATGTTTTCCAAACCTGCGAATCAGACTGCAAGTTCTTCTAACA
ATTTCAGTATCAATCACTAGTTGTGAGCGTTCTTTCAGCAAACTGAGGTT
GATTTTCTCATAGTTTCGTGCATCGATGGAACAAGATCGTCTTAGTGACC
TTCCACTTCTTAGTATTGAAAGAAACGAAATGGAAAAGTGTGCTTTTGAT
GAAGTTAATGATAAGTTTACCACAGTCAAATCCAGGAAAATTAATCTGAT
ATGAACATTGTACATGTATTGGCACAACGTGCGTATACAGAGCTGTCCCT
GTGGATAGTAATACCATTACTTCGACTCAAAATGCGGCTTTCTTATTCAA
AAAAAGTGATTTAAAATGAATTCAAAGTTTTATGATTTTGACT
back to top

protein sequence of SMED30000808-orf-1

>SMED30000808-orf-1 ID=SMED30000808-orf-1|Name=SMED30000808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MELLVKHHLLPEVTFGSHKFHCKVRPLGYQYHTNFQDLYTVVLVNYCLDL
RYKIKFLHRVKFQISSLDCSRTPFITWMSSSSAGRPASFVNSPSIRCLHL
VHFSTSTPHVMHLVLAFSTSFDEILQDLFPVIPDQLQHL*
back to top

protein sequence of SMED30000808-orf-2

>SMED30000808-orf-2 ID=SMED30000808-orf-2|Name=SMED30000808-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MNLQIAKIHEGLNRIKDLHTLSRSLAQSKAFMFFSRSTLRWEQLKNALHI
TVKRESETHWSARVEAVNAIYEDLGDLVGLLEKLSDDLNATHETRSEVET
LLANVLNFNFLALLYFWHTILSKIDSVQKQLQDQTMNFKDAAADLESLEI
NLAKFRQNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR008906HATC_C_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding