Luc7-like protein 3

Overview
NameLuc7-like protein 3
Smed IDSMED30000794
Length (bp)1595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Luc7-like protein 3 (SMED30000794) t-SNE clustered cells

Violin plots show distribution of expression levels for Luc7-like protein 3 (SMED30000794) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Luc7-like protein 3 (SMED30000794) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Luc7-like protein 3 (SMED30000794) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000794

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000794SMESG000041410.1 SmedASXL_007129SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30000794SMESG000041410.1 dd_Smed_v4_1899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000794SMESG000041410.1 dd_Smed_v4_1899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000794SMESG000041410.1 dd_Smed_v4_1899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000794SMESG000041410.1 dd_Smed_v4_1899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000794SMESG000041410.1 dd_Smed_v4_1899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig4660newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig4660uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000074643.1 SMESG000061279.1 SMESG000041410.1 SMESG000041409.1 Contig13698newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000074643.1 SMESG000061279.1 SMESG000041410.1 SMESG000041409.1 Contig13698uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig27100newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig27100uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig37386newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig37386uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig7581newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000041410.1 Contig7581uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000069984.1 Contig4660newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794SMESG000069984.1 Contig4660uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000794 Contig32637newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cholinergic neuronSMED30000794SMESG000041410.1 dd_Smed_v6_1899_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30000794SMESG000041410.1 dd_Smed_v6_1899_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 150.984 bits (380), Expect = 1.187e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 150.984 bits (380), Expect = 1.187e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 151.369 bits (381), Expect = 1.833e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L2 (LUC7 like 2, pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:21608])

HSP 1 Score: 99.3673 bits (246), Expect = 5.670e-22
Identity = 73/229 (31.88%), Postives = 124/229 (54.15%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   A+LD+LMG +R+ DT  Q  +I +  D +CK++L   CP+++   T+ D+G C  +HD  L  +Y  +S  +   +E D    L+  + D DRR    K+RL E    +    +  +  ++ EL  +I KL+  +E+LG EG + E Q  M E E+ + +K+     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LEE+
Sbjct:    3 AQAQMRAMLDQLMGTSRDGDTTRQ--RIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEI-SAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEEL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L (LUC7 like [Source:HGNC Symbol;Acc:HGNC:6723])

HSP 1 Score: 96.6709 bits (239), Expect = 2.319e-21
Identity = 71/228 (31.14%), Postives = 121/228 (53.07%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   ALLD+LMG  R D      ++ +  D +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + + DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + E E+++ +KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE L+++
Sbjct:    3 AQAQMRALLDQLMGTAR-DGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEI-SAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: C50D2.8 (pep chromosome:WBcel235:II:96127:98027:-1 gene:WBGene00016811.1 transcript:C50D2.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.8)

HSP 1 Score: 143.665 bits (361), Expect = 1.786e-38
Identity = 84/240 (35.00%), Postives = 139/240 (57.92%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLK---ENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDI-ELHSNNA------------KEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A  A AA+LDELMG  RN    +  K+ +D  +IC  +L GFCP+++FINTKAD+G C+L+HDD L   Y +S ++ +L +E  L RFL ++  D  RRI  NK +L    ++G   +     + + +I  +   +  +I D E+ G+EG + +CQ  +   E ++ EK+  E  + +++  N             K MEVCE+CG+M + ND + R++EH  G+MH G++ +R  ++++
Sbjct:    3 ARNAMAAMLDELMGPKRNVELGKDTKVTFDDPDICPYFLVGFCPHDMFINTKADLGACQLVHDDNLRRLYPESPEYGQLGFERRLMRFLVQLDEDNQRRIRKNKDKLSGMDDSGKRKLEEEKRQVQLEINSIDDVLKNMIRDAEQAGSEGNVTKCQEIVARSEMVEAEKRGLEEKLSQMNEPNPQAMPPMLDEMAIKPMEVCEVCGSMLIVNDAQQRIEEHLTGKMHTGFQKIRTMIQQL 242          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: C50D2.8 (pep chromosome:WBcel235:II:96127:97944:-1 gene:WBGene00016811.1 transcript:C50D2.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.8)

HSP 1 Score: 143.665 bits (361), Expect = 1.786e-38
Identity = 84/240 (35.00%), Postives = 139/240 (57.92%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLK---ENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDI-ELHSNNA------------KEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A  A AA+LDELMG  RN    +  K+ +D  +IC  +L GFCP+++FINTKAD+G C+L+HDD L   Y +S ++ +L +E  L RFL ++  D  RRI  NK +L    ++G   +     + + +I  +   +  +I D E+ G+EG + +CQ  +   E ++ EK+  E  + +++  N             K MEVCE+CG+M + ND + R++EH  G+MH G++ +R  ++++
Sbjct:    3 ARNAMAAMLDELMGPKRNVELGKDTKVTFDDPDICPYFLVGFCPHDMFINTKADLGACQLVHDDNLRRLYPESPEYGQLGFERRLMRFLVQLDEDNQRRIRKNKDKLSGMDDSGKRKLEEEKRQVQLEINSIDDVLKNMIRDAEQAGSEGNVTKCQEIVARSEMVEAEKRGLEEKLSQMNEPNPQAMPPMLDEMAIKPMEVCEVCGSMLIVNDAQQRIEEHLTGKMHTGFQKIRTMIQQL 242          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: C50D2.8 (pep chromosome:WBcel235:II:96127:97753:-1 gene:WBGene00016811.1 transcript:C50D2.8b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.8)

HSP 1 Score: 99.7525 bits (247), Expect = 2.914e-23
Identity = 63/194 (32.47%), Postives = 110/194 (56.70%), Query Frame = 2
Query:  227 LFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLK---ENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDI-ELHSNNA------------KEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            +FINTKAD+G C+L+HDD L   Y +S ++ +L +E  L RFL ++  D  RRI  NK +L    ++G   +     + + +I  +   +  +I D E+ G+EG + +CQ  +   E ++ EK+  E  + +++  N             K MEVCE+CG+M + ND + R++EH  G+MH G++ +R  ++++
Sbjct:    1 MFINTKADLGACQLVHDDNLRRLYPESPEYGQLGFERRLMRFLVQLDEDNQRRIRKNKDKLSGMDDSGKRKLEEEKRQVQLEINSIDDVLKNMIRDAEQAGSEGNVTKCQEIVARSEMVEAEKRGLEEKLSQMNEPNPQAMPPMLDEMAIKPMEVCEVCGSMLIVNDAQQRIEEHLTGKMHTGFQKIRTMIQQL 194          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207264:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 86.2705 bits (212), Expect = 3.750e-18
Identity = 69/240 (28.75%), Postives = 126/240 (52.50%), Query Frame = 2
Query:  104 AALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCE-LIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVY---DADRRIVSNKRRL------KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKM-------TECEELQREKKFFENDIELHSN-------NAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFL 751
            A +L+ELMG  R+    +  +I +D   +C ++L GFC +++F NTK D+G C+   HD+ L + Y+ S    ++ +E   KRFLE++     D  R+I  ++ RL       ++     G  I+E  ++ E+LT K++ L+++    G +G +   Q  +        E EEL +E +  +++ E   N         ++M+VC+ICG   ++ND   RV +H  G++H  Y+ + + +
Sbjct:    6 AQMLNELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFE---KRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKERAINMEENVTAGNRQMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTI 242          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207346:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 86.2705 bits (212), Expect = 3.750e-18
Identity = 69/240 (28.75%), Postives = 126/240 (52.50%), Query Frame = 2
Query:  104 AALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCE-LIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVY---DADRRIVSNKRRL------KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKM-------TECEELQREKKFFENDIELHSN-------NAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFL 751
            A +L+ELMG  R+    +  +I +D   +C ++L GFC +++F NTK D+G C+   HD+ L + Y+ S    ++ +E   KRFLE++     D  R+I  ++ RL       ++     G  I+E  ++ E+LT K++ L+++    G +G +   Q  +        E EEL +E +  +++ E   N         ++M+VC+ICG   ++ND   RV +H  G++H  Y+ + + +
Sbjct:    6 AQMLNELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFE---KRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKERAINMEENVTAGNRQMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTI 242          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG3198 (gene:FBgn0029887 transcript:FBtr0070991)

HSP 1 Score: 93.5893 bits (231), Expect = 3.986e-20
Identity = 48/104 (46.15%), Postives = 69/104 (66.35%), Query Frame = 2
Query:  110 LLDELMGRNRNDTKHQA-YKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDK---LCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL 409
            +LDELMGRNRN    +A  K++W+  E C+ Y   FCP++LFINT+AD+GPC  IHD++   L ++ R S   +K +YE +  RF   M++D DR+I   K+RL
Sbjct:    8 MLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHLYEDARPS--QRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRL 109          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0344941)

HSP 1 Score: 89.3521 bits (220), Expect = 7.605e-19
Identity = 64/223 (28.70%), Postives = 114/223 (51.12%), Query Frame = 2
Query:  107 ALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKF-----FENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A+LD+LMG  RN  + Q   + +    +CK++L   CP+++  +T+ D+G C  +HD     +Y  ++  +   Y+ +    L+  + D DRR  S K+RLKE    +    + E+   +  L  +I K +   E LG  G++ +    M E EEL R KK      +   +   +   +++ VCE+C A    +D ++R+ +H  G++H G+  +RE L E+
Sbjct:   16 AMLDQLMGTTRNGDERQ---LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEEL-TAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEEL-RAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIEL 233          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0345387)

HSP 1 Score: 89.3521 bits (220), Expect = 7.605e-19
Identity = 64/223 (28.70%), Postives = 114/223 (51.12%), Query Frame = 2
Query:  107 ALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKF-----FENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A+LD+LMG  RN  + Q   + +    +CK++L   CP+++  +T+ D+G C  +HD     +Y  ++  +   Y+ +    L+  + D DRR  S K+RLKE    +    + E+   +  L  +I K +   E LG  G++ +    M E EEL R KK      +   +   +   +++ VCE+C A    +D ++R+ +H  G++H G+  +RE L E+
Sbjct:   16 AMLDQLMGTTRNGDERQ---LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEEL-TAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEEL-RAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIEL 233          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0075175)

HSP 1 Score: 89.3521 bits (220), Expect = 7.605e-19
Identity = 64/223 (28.70%), Postives = 114/223 (51.12%), Query Frame = 2
Query:  107 ALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKF-----FENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A+LD+LMG  RN  + Q   + +    +CK++L   CP+++  +T+ D+G C  +HD     +Y  ++  +   Y+ +    L+  + D DRR  S K+RLKE    +    + E+   +  L  +I K +   E LG  G++ +    M E EEL R KK      +   +   +   +++ VCE+C A    +D ++R+ +H  G++H G+  +RE L E+
Sbjct:   16 AMLDQLMGTTRNGDERQ---LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEEL-TAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEEL-RAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIEL 233          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0331842)

HSP 1 Score: 89.3521 bits (220), Expect = 7.605e-19
Identity = 64/223 (28.70%), Postives = 114/223 (51.12%), Query Frame = 2
Query:  107 ALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKF-----FENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A+LD+LMG  RN  + Q   + +    +CK++L   CP+++  +T+ D+G C  +HD     +Y  ++  +   Y+ +    L+  + D DRR  S K+RLKE    +    + E+   +  L  +I K +   E LG  G++ +    M E EEL R KK      +   +   +   +++ VCE+C A    +D ++R+ +H  G++H G+  +RE L E+
Sbjct:   16 AMLDQLMGTTRNGDERQ---LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEEL-TAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEEL-RAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIEL 233          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:ZFIN;Acc:ZDB-GENE-060616-375])

HSP 1 Score: 145.206 bits (365), Expect = 1.518e-37
Identity = 94/234 (40.17%), Postives = 137/234 (58.55%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAY-KIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL-----KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN    +    + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L   Y KSS   K  YE D  R+L+ ++ + +RRI     RL     ++N  T   G   +   + + LT KI++L+  IE+LG+EG++ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MLSAAQ--LLDELMGRDRNLAPDEKRCNVRWDDESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGT--PGPSGKNEEKAQVLTEKIEELVVQIEELGSEGRVEEAQGMMKLVEQLKEEREELSSTHSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 98.2117 bits (243), Expect = 7.606e-22
Identity = 72/228 (31.58%), Postives = 122/228 (53.51%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKF----FENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   ALLD+LMG +R D      ++ +  + +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + D DRR    K+RL E    +    + ++  ++ EL  +I KL+   E+LG EG + E Q  + E E+++  KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LE++
Sbjct:    3 AQAQMRALLDQLMGTSR-DGDESRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEI-SAEVAQKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQEVLQEVEKVRSRKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 94.7449 bits (234), Expect = 1.951e-20
Identity = 71/229 (31.00%), Postives = 122/229 (53.28%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   A+LD+LMG  R+ DT  Q  +I +  + +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  ++  +E D    L+  + D DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + + E+ +  KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LE++
Sbjct:    3 AQAQMRAMLDQLMGTGRDGDTMRQ--RIKFTDERVCKSHLLESCPHDILSGTRMDLGECVKIHDLALRADYEIASKQQEFFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEI-SAEVAAKAERVHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKVEKTRTLKKEAEDIYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHIGFIEIREKLEKL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 86.2705 bits (212), Expect = 4.713e-18
Identity = 62/203 (30.54%), Postives = 109/203 (53.69%), Query Frame = 2
Query:  164 KIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE----NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            ++ +  + +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + D DRR    K+RL E    +    + ++  ++ EL  +I KL+   E+LG EG + E Q  + E E+++  KK  E    N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LE++
Sbjct:   13 RVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEI-SAEVAQKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQEVLQEVEKVRSRKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQL 214          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 150.214 bits (378), Expect = 2.720e-40
Identity = 95/232 (40.95%), Postives = 140/232 (60.34%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   +HWD + +CK YL  FCP ELF NT++D+GPCE IHD+ L  +Y KSS + K  YE D  R+L+ ++ + +RRI     RL   +   ++   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++  +   + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MLSAAQ--LLDELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLKSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 149.443 bits (376), Expect = 3.386e-39
Identity = 95/232 (40.95%), Postives = 140/232 (60.34%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   +HWD + +CK YL  FCP ELF NT++D+GPCE IHD+ L  +Y KSS + K  YE D  R+L+ ++ + +RRI     RL   +   ++   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++  +   + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MLSAAQ--LLDELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLKSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 149.828 bits (377), Expect = 3.911e-39
Identity = 95/232 (40.95%), Postives = 140/232 (60.34%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   +HWD + +CK YL  FCP ELF NT++D+GPCE IHD+ L  +Y KSS + K  YE D  R+L+ ++ + +RRI     RL   +   ++   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++  +   + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MLSAAQ--LLDELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLKSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: cyp3a4.2 (cytochrome P450 family 3 subfamily A member 4, gene 2 [Source:Xenbase;Acc:XB-GENE-984218])

HSP 1 Score: 96.6709 bits (239), Expect = 1.617e-21
Identity = 71/226 (31.42%), Postives = 119/226 (52.65%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLE 754
            A A   ALLD+LMG  R D      ++ +  D +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + + DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + E E+++  K+     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+ ++RE LE
Sbjct:    3 AQAQMRALLDQLMGTAR-DGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEI-SAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILMEMEKVKGRKREAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFILIREKLE 226          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: cyp3a4.2 (cytochrome P450 family 3 subfamily A member 4, gene 2 [Source:Xenbase;Acc:XB-GENE-984218])

HSP 1 Score: 96.6709 bits (239), Expect = 1.832e-21
Identity = 71/226 (31.42%), Postives = 119/226 (52.65%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLE 754
            A A   ALLD+LMG  R D      ++ +  D +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + + DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + E E+++  K+     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+ ++RE LE
Sbjct:    3 AQAQMRALLDQLMGTAR-DGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEI-SAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILMEMEKVKGRKREAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFILIREKLE 226          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 151.369 bits (381), Expect = 6.155e-40
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 151.369 bits (381), Expect = 6.155e-40
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 151.369 bits (381), Expect = 1.013e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 151.754 bits (382), Expect = 1.023e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l2 (LUC7-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2183260])

HSP 1 Score: 100.908 bits (250), Expect = 5.295e-23
Identity = 73/229 (31.88%), Postives = 125/229 (54.59%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   A+LD+LMG +R+ DT  Q  +I +  D +CK++L   CP+++   T+ D+G C  +HD  L  +Y  +S  +   +E D    L+  + D DRR   +K+RL E    +    +  +  ++ EL  +I KL+  +E+LG EG + E Q  M E E+ + +K+     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LEE+
Sbjct:    3 AQAQMRAMLDQLMGTSRDGDTTRQ--RIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVSKKRLAETQEEI-SAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEEL 228          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q5SUF2|LC7L3_MOUSE (Luc7-like protein 3 OS=Mus musculus OX=10090 GN=Luc7l3 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.306e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q3SX41|LC7L3_BOVIN (Luc7-like protein 3 OS=Bos taurus OX=9913 GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.054e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q5R8W6|LC7L3_PONAB (Luc7-like protein 3 OS=Pongo abelii OX=9601 GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.700e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|O95232|LC7L3_HUMAN (Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 5.700e-39
Identity = 96/232 (41.38%), Postives = 139/232 (59.91%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE---NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L  +Y KSS   K+ YE D  R+L+ ++ + +RRI     RL   +   S+   G   +   +I+ LT KID L++ IE+LG+EGK+ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MISAAQ--LLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q54XQ8|LUC7L_DICDI (Luc7-like protein OS=Dictyostelium discoideum OX=44689 GN=crop PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 5.618e-27
Identity = 82/244 (33.61%), Postives = 121/244 (49.59%), Query Frame = 2
Query:   98 AQAALLDELMGRNRNDTKHQAYKIH--WDSDEICKNYLAGFCPNELFINTKA-DMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKEN--------GSTVXXXXXXXXXXXXXXLTXXXXXXX-------------XXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEE 757
            A  A LDE +G++RN       K+   ++  +ICK +L G CP+ELF N    D+GPC  +HD+    +Y+ + D  K  YE +  R +E ++ D D++I  NK RL +N        G  +    I +   +   L    ++               +  E+LG EG+I E Q  MTE +EL+ +K   E  IE   N  K M VCEICGA+    D E R   H  G+ H G++ +RE +EE
Sbjct:    3 AIRAQLDEFLGKDRNLLPKDRIKVENDFNDPDICKFFLCGLCPHELFTNANIRDLGPCSKLHDENCVKQYQNNKDKDKYDYEREWVRVIEGLISDNDKKIKRNKERLLQNPNGDANHHGGPIQQQSISQLDDEEGGLLPDKEQNSKITELDLKIQELLKKAEELGEEGQITEAQALMTEADELKNQKVELEK-IEQEKNENKRMSVCEICGALLFVGDKEKRSISHLEGKKHIGFQKIREVMEE 245          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A0X3P7W8 (Luc7-like protein 3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=LC7L3 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 6.667e-47
Identity = 97/227 (42.73%), Postives = 150/227 (66.08%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAYKI-HWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGST--VXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEE 757
            MA A+QAALLDELMG+NRN    ++ K  HW  +++CK++L GFCP++LF+NTK D+GPC+  HD+++ + Y+KSS + K+ YE +  R+L  ++ D D+RI     RL  + +          E++ +IE +T +I+ L+E  EKLG EGK+ + Q  +  CE+L+ E+   E D+      AKE+EVCEICGA ++K+D   RV+EH +G+MH GY  +R+++ E
Sbjct:   25 MALASQAALLDELMGKNRNACGPESMKTPHWSDEDMCKSFLCGFCPHDLFVNTKTDLGPCDKTHDERMVEMYKKSSRYGKMGYEEEFYRYLCYLLEDVDKRIRRGHDRLNVSKAVNPTDPDAAAEKKEKIESITRRINDLVEQAEKLGTEGKVDQAQGVLKLCEQLKFERSQLEGDVRPGVGQAKELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYVRE 251          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A3P7L4K4 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS8176 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.354e-46
Identity = 96/227 (42.29%), Postives = 150/227 (66.08%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAYKI-HWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGST--VXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEE 757
            MA +AQAALLDELMG+NRN    ++ K  HW  +++CK++L GFCP++LF+NTK D+GPC+  HD+++ + Y+KSS + K+ YE +  R+L  ++ D D+RI     RL  + +          E++ +IE +T +I+ L+E  EKLG EGK+ + Q  +  CE+L+ E+   E D+      +KE+EVCEICGA ++K+D   RV+EH +G+MH GY  +R+++ E
Sbjct:    1 MALSAQAALLDELMGKNRNACGPESLKTPHWSDEDMCKSFLCGFCPHDLFVNTKTDLGPCDKTHDERMLEMYKKSSRYGKMGYEEEFYRYLCYLLEDVDKRIRRGHDRLNVSKAVNPTDPDAAAEKKEKIESITRRINDLVEQAEKLGTEGKVDQAQGVLKLCEQLKFERSQLEGDVRPGVGQSKELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYVRE 227          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A5K3F9B3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 4.340e-46
Identity = 95/227 (41.85%), Postives = 145/227 (63.88%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAYK-IHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXX--XXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEE 757
            MA A+QAALLDEL+G+NR+     A K  HW  +++CK++L GFCP++LF+NTK D+GPC+ +HD++L + Y+KSS  +K+ YE +  R+L  ++ D D+RI     RL  + S           +   I  LT +I+ L+E  E+LG EG + + Q  +  CE+L+ E+   E D    +  +KE+EVCEICGA ++K+D   RV+EH AG+MH GY  +R+++ E
Sbjct:    1 MALASQAALLDELLGKNRDAVDSDAMKGPHWSDEDMCKSFLCGFCPHDLFVNTKTDLGPCDKMHDERLRENYKKSSRFEKMGYEEEFYRYLCYLLEDVDKRIRRGHERLSVSKSVAPADPEAAAEKADKIASLTRRINDLVEQAEQLGTEGNVDQAQGVLKLCEQLKFERSQLEGDARPGAGQSKELEVCEICGAFRIKDDAPQRVEEHLAGKMHLGYAKIRDYVRE 227          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A0X3PDX7 (Luc7-like protein 3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=LC7L3 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.080e-45
Identity = 97/227 (42.73%), Postives = 150/227 (66.08%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAYKI-HWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGS--TVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEE 757
            MA A+QAALLDELMG+NRN    ++ K  HW  +++CK++L GFCP++LF+NTK D+GPC+  HD+++ + Y+KSS + K+ YE +  R+L  ++ D D+RI     RL  + +          E++ +IE +T +I+ L+E  EKLG EGK+ + Q  +  CE+L+ E+   E D+      AKE+EVCEICGA ++K+D   RV+EH +G+MH GY  +R+++ E
Sbjct:   25 MALASQAALLDELMGKNRNACGPESMKTPHWSDEDMCKSFLCGFCPHDLFVNTKTDLGPCDKTHDERMVEMYKKSSRYGKMGYEEEFYRYLCYLLEDVDKRIRRGHDRLNVSKAVNPTDPDAAAEKKEKIESITRRINDLVEQAEKLGTEGKVDQAQGVLKLCEQLKFERSQLEGDVRPGVGQAKELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYVRE 251          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A5J4NN64 (Uncharacterized protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0003381 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.304e-45
Identity = 101/256 (39.45%), Postives = 150/256 (58.59%), Query Frame = 2
Query:    2 YLIFVKFLLVYWCETFLKVSNLFKIS*KMAHAAQAALLDELMGRNRNDTKHQ-AYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGST--VXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            YL+ +     + C         + +S  MA AAQ ALLDELMG+NRN    + A   HW  D++CK +L GFCP+ELF+NTK D+GPC   HDD++ D Y++S    K+ YE +   +L+ ++ D D+RI     RL  N S          E++ +I  LT +I+ L++  E+LG EGK+ + Q  +  CE+L+ E+   E D        KE+EVCEICGA ++K+D   RV+EH +G+MH GY  +R++L + 
Sbjct:   10 YLVPIHRFATFEC---------YPLS--MALAAQKALLDELMGKNRNACNGENASGPHWSDDDVCKYFLCGFCPHELFVNTKTDLGPCPKTHDDRMKDAYKRSKRCGKMGYEDEFVYYLKHLLEDVDKRIRRGHERLAVNKSVNNPDPVTATEKKEKILALTKRINDLVKQAEELGTEGKVDQAQGVLKLCEQLKFERSQLEGDARPGMAQTKELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQF 254          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:103043258])

HSP 1 Score: 143.28 bits (360), Expect = 2.280e-37
Identity = 92/232 (39.66%), Postives = 136/232 (58.62%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAY-KIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFF---ENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN    +    + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L   Y KSS   K  YE D  R+L+ ++ + +RRI     RL   +   ++   G   +   + + LT KI++L+  IE+LG+EG++ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MLSAAQ--LLDELMGRDRNLAPDEKRCNVRWDHETVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPSGKNEEKAQVLTEKIEELVIQIEELGSEGRVEEAQGMMKLVEQLKEEREELSSTPSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:103043258])

HSP 1 Score: 142.895 bits (359), Expect = 7.488e-37
Identity = 92/232 (39.66%), Postives = 136/232 (58.62%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAY-KIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFF---ENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN    +    + WD + +CK YL GFCP ELF NT++D+GPCE IHD+ L   Y KSS   K  YE D  R+L+ ++ + +RRI     RL   +   ++   G   +   + + LT KI++L+  IE+LG+EG++ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MLSAAQ--LLDELMGRDRNLAPDEKRCNVRWDHETVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPSGKNEEKAQVLTEKIEELVIQIEELGSEGRVEEAQGMMKLVEQLKEEREELSSTPSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: luc7l (LUC7 like [Source:NCBI gene;Acc:103037252])

HSP 1 Score: 97.8265 bits (242), Expect = 9.843e-22
Identity = 72/228 (31.58%), Postives = 120/228 (52.63%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   ALLD+LMG  R D      ++ +  + +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + D DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + E E+++  KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LE++
Sbjct:    3 AQAQMRALLDQLMGTAR-DGDESRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEI-SAEVAAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILQEVEKVRSRKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 97.0561 bits (240), Expect = 1.257e-21
Identity = 69/228 (30.26%), Postives = 123/228 (53.95%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   A+LD+LMG  R+D+  Q  +I +  + +CK++L   CP+++   T+ D+G C  +HD  L  +Y  +S H++  +E D    L+  + D DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + + E+ +  KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE L+++
Sbjct:    3 AQAQMRAMLDQLMGTGRDDSMRQ--RIKFTDERVCKSHLLESCPHDILSGTRMDLGECLKVHDLALRADYEIASKHQEYFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEI-SAEVAAKAERVHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKVEKTRTLKKEAEDIYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLDKL 227          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: luc7l (LUC7 like [Source:NCBI gene;Acc:103037252])

HSP 1 Score: 97.0561 bits (240), Expect = 3.854e-21
Identity = 72/227 (31.72%), Postives = 119/227 (52.42%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEE 757
            A A   ALLD+LMG  R D      ++ +  + +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + D DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + E E+++  KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LE+
Sbjct:    3 AQAQMRALLDQLMGTAR-DGDESRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEI-SAEVAAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILQEVEKVRSRKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQ 227          
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001648.1 (pep scaffold:Pmarinus_7.0:GL476581:121672:135516:-1 gene:ENSPMAG00000001483.1 transcript:ENSPMAT00000001648.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 7.813e-39
Identity = 88/228 (38.60%), Postives = 140/228 (61.40%), Query Frame = 2
Query:   98 AQAALLDELMGRNRNDTKHQAY-KIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREK---KFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            + A LLDELMGR+RN   ++    +HWD + +CK+YL  +CP ELF+NT+AD+GPC+ IHD+ L   Y KSS   ++ YE D  R+L+ ++ D +RRI     RL   +  G    G  + +   +I+ LT +I++L++DIE++G EG++ E Q  M   E+++ E+   +   + IE  +   K+MEVCE+CGA  +  D + R+ +H  G+ H GY  ++  +EEM
Sbjct:    3 SNAQLLDELMGRDRNLAPNEKRCDVHWDDERVCKHYLVEYCPAELFVNTRADLGPCDKIHDENLKKLYEKSSRFMRMGYEQDFLRYLQSIMADVERRIRRGHARLALAQTGGPMPGGASMTKNDEKIKVLTERIEELLDDIEQMGCEGRVEEAQGMMKLVEQIKDERDQLRATASTIETFAAQEKQMEVCEVCGAFLIVGDPQSRIDDHLMGKQHMGYAKIKSTIEEM 230          
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 84.3445 bits (207), Expect = 8.243e-19
Identity = 63/222 (28.38%), Postives = 110/222 (49.55%), Query Frame = 2
Query:  122 LMGRNRNDTKHQA-----YKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFE----NDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            L G+NR  +   +      +I +  D +CK++L   CP++    T+ D+G C   HD  L  +Y  +S  K   +E D  + L+  + D DRR    K+RL E    +    +  +   +  +  +I KL+   E LG  G + E Q  M E E++++ K+  E    N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE L+E+
Sbjct:    7 LQGKNRKASHSPSRDVSRQRIKFTDDVVCKSHLLDCCPHDTLAGTRMDLGDCPKTHDLALRADYEIASKKKDYFFEVDAMKHLQSFIADCDRRTEVAKKRLAETQEEI-SAEVSAKAENVHAINEEIGKLLAKAEALGAAGNVEESQNVMDEVEKVRQRKRDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLQEL 227          
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 55.8398 bits (133), Expect = 7.759e-9
Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  164 KIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKEN 418
            +I +  D +CK++L   CP++    T+ D+G C   HD  L  +Y  +S  K   +E D  + L+  + D DRR    K+RL E 
Sbjct:    7 RIKFTDDVVCKSHLLDCCPHDTLAGTRMDLGDCPKTHDLALRADYEIASKKKDYFFEVDAMKHLQSFIADCDRRTEVAKKRLAET 91          
BLAST of Luc7-like protein 3 vs. Ensembl Yeast
Match: LUC7 (Essential protein associated with the U1 snRNP complex; splicing factor involved in recognition of 5' splice site; contains two zinc finger motifs; N-terminal zinc finger binds pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002245])

HSP 1 Score: 63.5438 bits (153), Expect = 8.950e-12
Identity = 57/228 (25.00%), Postives = 103/228 (45.18%), Query Frame = 2
Query:   95 AAQAALLDELMGRN----RNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKL--RYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNA-----KEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVRE 745
            A Q  L+++LMGR+     N   HQ   +     +ICK+YL G CP +LF  TK  +G C  +H  K   +Y +     K    +E +    L + V + + +I    + LK      +    +     + ++ I +     D     +E  +    L+  + +EL  ++K     +   + N      ++++VCE+CGA   + D + R+ +H  G++H GY  +RE
Sbjct:    9 AEQRKLVEQLMGRDFSFRHNRYSHQKRDLGLHDPKICKSYLVGECPYDLFQGTKQSLGKCPQMHLTKHKIQYEREVKQGKTFPEFEREYLAILSRFVNECNGQISVALQNLKHTAEERMKIQQVTEELDVLDVRIGLMGQEIDSLIRADE--VSMGMLQSVKLQELISKRKEVAKRVRNITENVGQSAQQKLQVCEVCGAYLSRLDTDRRLADHFLGKIHLGYVKMRE 234          
BLAST of Luc7-like protein 3 vs. Ensembl Nematostella
Match: EDO31275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYE8])

HSP 1 Score: 149.828 bits (377), Expect = 5.867e-42
Identity = 90/230 (39.13%), Postives = 138/230 (60.00%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAYK-IHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFEND----IELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            MA  + AALLDELMG +R+    Q  K  HW   E+CK++L GFCP+ELF+NT++D+GPCE +HD+K+   Y +SS   ++ YE +  R+L+ ++ D +RRI    +RL  +G+            + + LT KI+ LI+ +E+LG EGK+ E Q  M   E+L+ E++           + ++  K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  LEEM
Sbjct:    1 MAVLSAAALLDELMGSDRDLAPDQKGKRAHWSDSEVCKHFLCGFCPSELFVNTRSDLGPCEKLHDEKMKTAYEQSSRCGRMGYEEEFLRYLQNIMSDVERRIRRGHQRL--DGA-----QNKPDNEKEKMLTEKINSLIDQVEQLGCEGKVEEAQGVMKLIEQLKEEREQLSGTPRDMTSMMTSQEKQMEVCEVCGAFLIVGDAQTRVDDHLMGKQHMGYAKIKNTLEEM 223          
BLAST of Luc7-like protein 3 vs. Ensembl Nematostella
Match: EDO34740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNI9])

HSP 1 Score: 68.9366 bits (167), Expect = 1.570e-14
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  167 IHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKEN 418
            + + SD +CK+YL G CP++LF NTK D+G C+ IH+  L  ++  +S  +   Y  D    L+  + D DR+I   K+RL++ 
Sbjct:    1 LKFTSDRVCKSYLMGLCPHQLFNNTKMDLGSCQKIHNPALKADFEAASKTRDYGYNMDQMEHLQSFINDCDRKIAIAKKRLEDT 84          
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:101172245])

HSP 1 Score: 146.362 bits (368), Expect = 5.150e-38
Identity = 92/232 (39.66%), Postives = 137/232 (59.05%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRN-DTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRL---KENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFF---ENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            M  AAQ  LLDELMGR+RN     +   + WD + +C+ YL GFCP ELF NT++D+GPCE IHD+ L   Y KSS  +K  YE D  R+L+ ++ + +RRI     RL   +   ++   G   +   +I+ LT KI+ L+  IE+LG+EG++ E Q  M   E+L+ E++      + IE  +   K+MEVCE+CGA  +  D + RV +H  G+ H GY  ++  +EE+
Sbjct:    1 MLSAAQ--LLDELMGRDRNLAPDEKRANVRWDDESVCRYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKTYEKSSRFQKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPTGKNEEKIQVLTEKIEDLVVQIEELGSEGRVEEAQGMMKLVEQLKDEREMLNSTPSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Match: luc7l (LUC7 like [Source:NCBI gene;Acc:101168406])

HSP 1 Score: 97.0561 bits (240), Expect = 1.618e-21
Identity = 71/228 (31.14%), Postives = 121/228 (53.07%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKF----FENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   ALLD+LMG  R D      ++ +  + +CK++L   CP+++   T+ D+G C  IHD  L  +Y  +S  + L +E D    LE  + D DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + E E+++ +KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE L+++
Sbjct:    3 AQAQMRALLDQLMGTAR-DGDETRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEI-SAEVAAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKVLQEVEKVRTKKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000005146.2 (putative RNA-binding protein Luc7-like 1 [Source:NCBI gene;Acc:101163228])

HSP 1 Score: 92.4337 bits (228), Expect = 8.814e-20
Identity = 68/228 (29.82%), Postives = 119/228 (52.19%), Query Frame = 2
Query:   89 AHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKK----FFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            A A   A+LD+LMG  R D      +I +  + +CK++L   CP+++   T+ D+G C  +HD  L  +Y  +S  ++  +E D    L+  + D DRR    K+RL E    +    +  +  ++ EL  +I KL+   E+LG EG + E Q  + + E+ +  KK     + N +   S   +++ VCE+C A    +D + R+ +H  G++H G+  +RE LE++
Sbjct:    3 AQAQMRAMLDQLMGTGR-DGDSMRQRIKFTDERVCKSHLLNSCPHDILSGTRMDLGECAKVHDLALRADYEIASKEQEYFFELDATEHLQSFIADCDRRTELAKKRLAETQDEI-SAEVAAKAERVHELNEEIGKLLAKAEQLGGEGNVDEAQQLLEKVEKTRALKKEAEDVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHIGFIEIREKLEKL 228          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000041410.1 (SMESG000041410.1)

HSP 1 Score: 400.593 bits (1028), Expect = 1.011e-137
Identity = 226/226 (100.00%), Postives = 226/226 (100.00%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEMI 763
            MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEMI
Sbjct:    1 MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEMI 226          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000041410.1 (SMESG000041410.1)

HSP 1 Score: 339.732 bits (870), Expect = 3.920e-115
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 2
Query:   86 MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQV 670
            MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQV
Sbjct:    1 MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQV 195          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 175.637 bits (444), Expect = 2.010e-51
Identity = 99/215 (46.05%), Postives = 140/215 (65.12%), Query Frame = 2
Query:  116 DELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            DELMG+NRN+      + HWD D++C  +LAG CP+ LFINTKAD+G CE IH++KL   YRKSS +KK+ +E DL R L ++V D +RRI   + RL+ NG ++ GG   ER+R++EE+T                 KI E   K  + EEL+ E+ F++ +IE+ S  +KE+EVC +CGA ++K+D   RV+EH +G+MH GY  VREFL+ M
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKRKLEEVT----------------NKINELISKAEKLEELKYEQNFYQKEIEMLSQQSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 209          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.503e-50
Identity = 99/215 (46.05%), Postives = 140/215 (65.12%), Query Frame = 2
Query:  116 DELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEM 760
            DELMG+NRN+      + HWD D++C  +LAG CP+ LFINTKAD+G CE IH++KL   YRKSS +KK+ +E DL R L ++V D +RRI   + RL+ NG ++ GG   ER+R++EE+T                 KI E   K  + EEL+ E+ F++ +IE+ S  +KE+EVC +CGA ++K+D   RV+EH +G+MH GY  VREFL+ M
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKRKLEEVT----------------NKINELISKAEKLEELKYEQNFYQKEIEMLSQQSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 209          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 165.236 bits (417), Expect = 1.037e-47
Identity = 93/205 (45.37%), Postives = 133/205 (64.88%), Query Frame = 2
Query:  116 DELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVXXXXXXXXXXXXXXLTXXXXXXXXXXXXXGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIELRVKEHEAGRMHAGY 730
            DELMG+NRN+      + HWD D++C  +LAG CP+ LFINTKAD+G CE IH++KL   YRKSS +KK+ +E DL R L ++V D +RRI   + RL+ NG ++ GG   ER+R++EE+T                 KI E   K  + EEL+ E+ F++ +IE+ S  +KE+EVC +CGA ++K+D   RV+EH +G+MH GY
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKRKLEEVT----------------NKINELISKAEKLEELKYEQNFYQKEIEMLSQQSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGY 199          
The following BLAST results are available for this feature:
BLAST of Luc7-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LUC7L31.187e-3941.38LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L31.187e-3941.38LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L31.833e-3941.38LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L25.670e-2231.88LUC7 like 2, pre-mRNA splicing factor [Source:HGNC... [more]
LUC7L2.319e-2131.14LUC7 like [Source:HGNC Symbol;Acc:HGNC:6723][more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C50D2.81.786e-3835.00pep chromosome:WBcel235:II:96127:98027:-1 gene:WBG... [more]
C50D2.81.786e-3835.00pep chromosome:WBcel235:II:96127:97944:-1 gene:WBG... [more]
C50D2.82.914e-2332.47pep chromosome:WBcel235:II:96127:97753:-1 gene:WBG... [more]
Y119D3B.123.750e-1828.75pep chromosome:WBcel235:III:1202548:1207264:1 gene... [more]
Y119D3B.123.750e-1828.75pep chromosome:WBcel235:III:1202548:1207346:1 gene... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG31983.986e-2046.15gene:FBgn0029887 transcript:FBtr0070991[more]
CG75647.605e-1928.70gene:FBgn0036734 transcript:FBtr0344941[more]
CG75647.605e-1928.70gene:FBgn0036734 transcript:FBtr0345387[more]
CG75647.605e-1928.70gene:FBgn0036734 transcript:FBtr0075175[more]
CG75647.605e-1928.70gene:FBgn0036734 transcript:FBtr0331842[more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
luc7l31.518e-3740.17LUC7-like 3 pre-mRNA splicing factor [Source:ZFIN;... [more]
luc7l7.606e-2231.58LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
zgc:1588031.951e-2031.00zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
luc7l4.713e-1830.54LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
luc7l32.720e-4040.95LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l33.386e-3940.95LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l33.911e-3940.95LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
cyp3a4.21.617e-2131.42cytochrome P450 family 3 subfamily A member 4, gen... [more]
cyp3a4.21.832e-2131.42cytochrome P450 family 3 subfamily A member 4, gen... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Luc7l36.155e-4041.38LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l36.155e-4041.38LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l31.013e-3941.38LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l31.023e-3941.38LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l25.295e-2331.88LUC7-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SUF2|LC7L3_MOUSE4.306e-3941.38Luc7-like protein 3 OS=Mus musculus OX=10090 GN=Lu... [more]
sp|Q3SX41|LC7L3_BOVIN5.054e-3941.38Luc7-like protein 3 OS=Bos taurus OX=9913 GN=LUC7L... [more]
sp|Q5R8W6|LC7L3_PONAB5.700e-3941.38Luc7-like protein 3 OS=Pongo abelii OX=9601 GN=LUC... [more]
sp|O95232|LC7L3_HUMAN5.700e-3941.38Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC... [more]
sp|Q54XQ8|LUC7L_DICDI5.618e-2733.61Luc7-like protein OS=Dictyostelium discoideum OX=4... [more]
back to top
BLAST of Luc7-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P7W86.667e-4742.73Luc7-like protein 3 (Fragment) OS=Schistocephalus ... [more]
A0A3P7L4K41.354e-4642.29Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A5K3F9B34.340e-4641.85Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PDX71.080e-4542.73Luc7-like protein 3 (Fragment) OS=Schistocephalus ... [more]
A0A5J4NN642.304e-4539.45Uncharacterized protein (Fragment) OS=Paragonimus ... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
luc7l32.280e-3739.66LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l37.488e-3739.66LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l9.843e-2231.58LUC7 like [Source:NCBI gene;Acc:103037252][more]
zgc:1588031.257e-2130.26zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
luc7l3.854e-2131.72LUC7 like [Source:NCBI gene;Acc:103037252][more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001648.17.813e-3938.60pep scaffold:Pmarinus_7.0:GL476581:121672:135516:-... [more]
luc7l8.243e-1928.38LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
luc7l7.759e-932.94LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LUC78.950e-1225.00Essential protein associated with the U1 snRNP com... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO312755.867e-4239.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347401.570e-1436.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
luc7l35.150e-3839.66LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l1.618e-2131.14LUC7 like [Source:NCBI gene;Acc:101168406][more]
ENSORLT00000005146.28.814e-2029.82putative RNA-binding protein Luc7-like 1 [Source:N... [more]
back to top
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041410.11.011e-137100.00SMESG000041410.1[more]
SMESG000041410.13.920e-115100.00SMESG000041410.1[more]
SMESG000063148.12.010e-5146.05SMESG000063148.1[more]
SMESG000063148.11.503e-5046.05SMESG000063148.1[more]
SMESG000063148.11.037e-4745.37SMESG000063148.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000794 ID=SMED30000794|Name=Luc7-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1595bp
TTACTTAATCTTTGTTAAATTTCTTTTAGTGTATTGGTGTGAAACTTTTT
TAAAAGTTAGTAACTTATTTAAAATTTCCTGAAAAATGGCACACGCTGCT
CAAGCTGCACTATTGGATGAATTGATGGGAAGAAATCGTAATGACACAAA
GCATCAAGCTTACAAAATTCACTGGGATAGCGATGAAATTTGCAAAAATT
ATTTAGCCGGATTTTGTCCTAATGAACTTTTTATTAATACAAAGGCAGAC
ATGGGTCCCTGTGAGCTGATACATGATGACAAGTTGTGTGACGAGTATAG
AAAAAGTAGTGATCATAAAAAGTTAAGATATGAAAGCGATTTAAAGAGAT
TTTTGGAAAAAATGGTGTACGATGCTGATCGAAGAATAGTTTCAAATAAA
AGGCGACTTAAGGAAAATGGTAGTACAGTAATTGGTGGAATTATTATCGA
AAGAAGAAGACAAATAGAAGAGCTTACAATTAAAATCGATAAACTAATTG
AAGATATTGAAAAACTTGGAAATGAAGGGAAAATAATGGAATGTCAATTA
AAAATGACTGAATGTGAAGAATTGCAAAGAGAGAAAAAGTTTTTTGAAAA
TGATATTGAACTACATAGCAACAATGCAAAAGAGATGGAAGTTTGCGAAA
TTTGTGGAGCAATGCAAGTGAAAAATGACATTGAACTTAGAGTTAAAGAA
CATGAAGCAGGTAGGATGCACGCAGGATATAAAATCGTTAGAGAATTTCT
CGAAGAGATGATTAAAAGTGATAGAGATTTATCTCACGAGTCTTCTTCTT
CAAGAAGACGTGGAAGATCAAGAGAAAAATCTAGATCGAGACGCTCTAAA
CGAGATGATGATAAAAACAATCACGAAGATCGGCCCAGACATAGAAGTCC
AAAACATAGAAGTCACCATGAAAGAAGTCGCAGTCGTGACAGGCATTCAT
CATCAAAGCATAAACGAAGATAAACTTAGATTATTTTAATTCATGTAGTA
TACATTTTTAATAAAACTTCATAATAATTTAGCAATATTCGTTATAACGA
AAGAAAAGTATCGAAAGATAAGAATTGTTTGTTATTTTATAATTAATTAA
CGTTCTCGATTGTTTTAAGTCATTCGTTCTCGTTGCTTGGTTAAATGGAT
TAACATTATAATCAGTTTTAATTGACGAGAAATAATTGTTTGGAACAAAT
TAAAAATATGTTCTGTTTCTAATAAATCTTGAAAATCAAAGGCGTTGTAT
GAGGATTATCAAATCCTAATATCGATATCGAGTCAAGCTAATGGGATTGA
TGAATTAGTAGTTGGTGAATGAGGTATATGTTTTAATTTTATTCGATTTG
AGTAATTTAAGATTGGAATGAGAGGTACTTTAGTTTTTCTGTCAAACATG
GATTATTGAAAAGCGGATTAGAATTATTTTGGATATCTATAATTTTTTAT
TCATAATTTGGCCAAATAATGAGAAGGTATATTTCGGAATAACTTGCAGT
AATTAACTCGAATTTGGTATGTATAATATTTATCAAAATAAATTGCTTCT
TCTTTTATCCATCAAAACATTGACGATTACATTTTTAAGTTAATT
back to top

protein sequence of SMED30000794-orf-1

>SMED30000794-orf-1 ID=SMED30000794-orf-1|Name=SMED30000794-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=296bp
MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFI
NTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRR
IVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKI
MECQLKMTECEELQREKKFFENDIELHSNNAKEMEVCEICGAMQVKNDIE
LRVKEHEAGRMHAGYKIVREFLEEMIKSDRDLSHESSSSRRRGRSREKSR
SRRSKRDDDKNNHEDRPRHRSPKHRSHHERSRSRDRHSSSKHKRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0002075pigment cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR004882Luc7-rel
Vocabulary: molecular function
TermDefinition
GO:0003729mRNA binding
Vocabulary: cellular component
TermDefinition
GO:0005685U1 snRNP
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006376mRNA splice site selection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 153..180
NoneNo IPR availableCOILSCoilCoilcoord: 120..147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..295
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 267..295
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 251..266
NoneNo IPR availablePANTHERPTHR12375:SF18LUC7-LIKE PROTEIN 3coord: 3..292
IPR004882Luc7-relatedPFAMPF03194LUC7coord: 5..241
e-value: 4.9E-67
score: 226.2
IPR004882Luc7-relatedPANTHERPTHR12375RNA-BINDING PROTEIN LUC7-RELATEDcoord: 3..292