Protocadherin-1

Overview
NameProtocadherin-1
Smed IDSMED30000785
Length (bp)3406
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 (SMED30000785) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30000785) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 (SMED30000785) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30000785) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000785

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000785h1SMcG0019152 SmedASXL_016616SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30000785h1SMcG0019152 dd_Smed_v4_6467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000785h1SMcG0019152 dd_Smed_v4_6467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000785h1SMcG0019152 dd_Smed_v4_6467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000785h1SMcG0019152 dd_Smed_v6_6467_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30000785h1SMcG0019152 dd_Smed_v4_6467_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 213.772 bits (543), Expect = 4.613e-56
Identity = 232/785 (29.55%), Postives = 366/785 (46.62%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDC--TSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D    +D++  +      S F   + T  L      D E +    F++   + G     L S  +  +T++D NDN+P        F ++E+    S +G I   D+D   N  V    +N +      +NF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+DVD   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR--------YIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP--NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP--LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDN------DNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 89.3521 bits (220), Expect = 2.472e-17
Identity = 148/595 (24.87%), Postives = 250/595 (42.02%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN   F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 72.4034 bits (176), Expect = 4.008e-12
Identity = 83/316 (26.27%), Postives = 139/316 (43.99%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNG 1197
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   DRE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG 759          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 212.616 bits (540), Expect = 1.768e-55
Identity = 231/783 (29.50%), Postives = 363/783 (46.36%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  +        S F   + T  L      D E +    F++   + G     L S  +  +T++D NDN+P        F ++E+    S +G I   D+D   N  V    +N +      +NF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+DVD   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR--------YIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP--LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDN------DNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 90.1225 bits (222), Expect = 1.916e-17
Identity = 148/595 (24.87%), Postives = 250/595 (42.02%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN   F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 72.0182 bits (175), Expect = 6.980e-12
Identity = 86/328 (26.22%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   DRE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKSLHTLVLV 770          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 212.616 bits (540), Expect = 1.901e-55
Identity = 232/783 (29.63%), Postives = 365/783 (46.62%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +        I+   P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  +        S F   + T  L      D E +    F++   + G     L S  +  +T++D NDN+P        F ++E+    S +G I   D+D   N  V    +N +      +NF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+DVD   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR------YIIS--PINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP--LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDN------DNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 89.7373 bits (221), Expect = 2.147e-17
Identity = 148/595 (24.87%), Postives = 250/595 (42.02%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN   F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 72.0182 bits (175), Expect = 6.592e-12
Identity = 86/328 (26.22%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   DRE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKSLHTLVLV 770          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 212.616 bits (540), Expect = 1.998e-55
Identity = 231/783 (29.50%), Postives = 363/783 (46.36%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  +        S F   + T  L      D E +    F++   + G     L S  +  +T++D NDN+P        F ++E+    S +G I   D+D   N  V    +N +      +NF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+DVD   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR--------YIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP--LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDN------DNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 90.1225 bits (222), Expect = 1.819e-17
Identity = 148/595 (24.87%), Postives = 250/595 (42.02%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN   F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 72.0182 bits (175), Expect = 6.708e-12
Identity = 86/328 (26.22%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   DRE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKSLHTLVLV 770          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 200.675 bits (509), Expect = 6.673e-52
Identity = 201/787 (25.54%), Postives = 352/787 (44.73%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSGTC------SVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVI--------YLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNI-TDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            + + V E  P NT+IG ++A     +     +  +Y +E +G        ++D   G I     ++DRE +  C Q       C      S+T LV   +  +    I V + NDN P FA+  I + + E+T +G+   +  A+D D+  NGV  Y L +    +     + L V          L V+  LD E  D+Y LT+ V D G+P   SS L+R+ +LD NDN P F++P Y   ++E+ P+G  ++QV A D D      ++Y F       +R  ++D  TG I +  P+  +     +F + A+D G  P   R  + + VKD+N++ P I+I        I        + +  E+    T +  + V+D+D  EN  V C +       L        ++K  Y L   +  + E  K+  + I   DSG  P SST+++ +Q++D+N+   VF +S   ++  EN     V   +  S  D    ++++ ++  +  A+  F     T ++ + + LD E + S    +   ++G   +   + T     +   +++   +L    F + E+    S +G +   D D+  N+ V   +++V  +     +F I++  GTI  +   DRE++S Y   + A D G P  S    +TI+VLD NDN P    P    +K+  +  TR+G  ++++ A D D   +  + Y I   N    F +    G ++    +     G + L +   D G P R     + LY+++   N
Sbjct:   60 VVYKVPEEQPPNTLIGSLAADYGFPD-----VGHLYKLE-VG----APYLRVDGKTGDIFTTETSIDREGLREC-QNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQEL---FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIR------GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRG-SPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQV---QLSVEQDNG---DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 818          

HSP 2 Score: 59.3066 bits (142), Expect = 4.211e-8
Identity = 94/363 (25.90%), Postives = 161/363 (44.35%), Query Frame = 1
Query: 1606 IQILDLNEFPAVFNKSTYSLSVKENT---VSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQ----------QLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP----QWIFPI-QNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII--------------SDNAKYFYLHPIKGELSFLTTPRQGENILD----IVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            I++ D+N+    F     +L++ ENT     F +PL+  D+D   + + +  +L A    + L   Q          QL++  +LD E   S + +I++ + G P R    S+    +T++D NDNAP    P+    ++E++  G ++  +KANDSD+  N+ + +         R L   R++ + G I +   +DRE  S     +LA D G    S    + ++V D+NDN P    + I  +   D   N S      T +  +   D D+  +  +T  +               SD+ K ++L          TTP   E + D    IVA+D+GNP  S+   L + + D  +ND
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLA-SDRDAGPNGVASY-ELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPR---ASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQ--------TTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVD--VND 501          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 163.31 bits (412), Expect = 3.499e-40
Identity = 198/782 (25.32%), Postives = 340/782 (43.48%), Query Frame = 1
Query:  328 PKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYIN-NKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFS--------------------HLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHI----ISDNAKYFYLHPIKGEL---SFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            P++T I  + A  K S  SS  +   YS+ +  + + ++LF +D  +G I+ + ++DREV+   +   +    V   ++    +V  ++ +    DN P+F   +    ++E  P+GT +    A D DS +NG  EY L         ++     VI  +    LD ET    +L +   D GTPK  S+ +V I ++DVNDN P+F    Y   I E+  +  +I  V ATD D    G V Y  AS++        ID +TG + L   +  +      VI A+D G  P ++ T+ +TI+V DIN+H P +   +               +++  EN     ++  +   D+DS  NG ++ SME  + D++I      I   K++ R         E+     + ++  D G    +++ TI + + D+N+    F+K  Y++++ E     +  + L   D D    +   I +   R  F  L    Q  + S                        + +  +N  I+ +N  P+ N                        P +  I E +  G  + ++KA D D   N+ +V+  I+ S      + FRI+ S G I ++ +LDRE  + + + + A+D  +P L+T+  I + + D+NDN+PQ+         I+E I   VGT   ++ AID D   +  + Y +     S + + F L    G L   S L   +    +L I A D G P  S  + + L +SD  +ND
Sbjct:  175 PEDTPIETIIASVKASHASSQPL--YYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDV---QDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVI--QTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--LTIDYSTGEVTLRERIDAKNSPITAVIRAKD-GAQPALSSTVPLTINVIDINDHAPTLIAAQ--------------KMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG-SEDFIIDEDSGLIKTTKLLDR---------ETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFN----------------------DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYS-IDSS------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT-SSSYAATISEDI--PVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD--VND 887          

HSP 2 Score: 127.872 bits (320), Expect = 2.345e-29
Identity = 175/691 (25.33%), Postives = 319/691 (46.16%), Query Frame = 1
Query:  418 SIGNEQVKDLFQIDPTNGIIKASLNVDREVIC----PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVC----DIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVN-RTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKE---VMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT-VSF---NLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINES--IYTRVGTVITRLHAIDVDDLSHTNITYHIISD-NAKYF 2424
            S+G    K+L  I+  +G+I+ +  +DRE +       +++  GT               + I +VD NDN P+FA+ +  + + E+  +   +    ATD D   NG   Y + S       ++ Y+   + L        E  DA    ++      D   P   S+  + IN++D+ND+ P     +    + E+  +G+ + +V A D DS   G++KY    + +     F ID  +G I   + L  +    +   + ARD G  P++N  T I + +KDIN++ P       TF+ K       +  V+  E  P  + II +   D D D+  ++   +E+ + +   +L         I    A+ S + E +++   V V IS +D G         + I   D+N  P  FN   +S+ + E++ + +    L    HD+   + ++ +I    +   FR   ++  + + S LD E +++  FS+ +         L ++T   + + DINDN+P     +    I+ED   G++   + A D+D   N IV +  +N S++   ++ FR++ + GT++++ +LDRE+ ++  LPI A D G P LS    IT+++ DVNDN P +   +  D  I E+  + + VGT++ R    D D+  + +I++ I    +AK F
Sbjct:  308 SLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGT-------PKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR-------ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMG-TPSLNTSTTIAVVLKDINDNAP-------TFDKK-------EYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILD--------IGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID--DVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID---SSQFFRIDPSSGDISVSSDLDREDRAT--FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF-EQLSYDLYIAENSPVGSTVGTIVAR----DADEGDNADISFRIFGGADAKLF 940          

HSP 3 Score: 110.153 bits (274), Expect = 6.629e-24
Identity = 147/580 (25.34%), Postives = 260/580 (44.83%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDIN-----NHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRL------VALSS-ANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN---TVSFNLPLSIHDQDCTSDVIVNITDLYARSH-----FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD----GTIK-LTK-ELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP 2268
            ND+ P    +  +I ++E+  +G  +   +A D DS  NG+ +Y +     ++ F +  +  +I  +   +LD ET   Y L ++  D+GTP   +S  + + + D+NDN P F K +Y   I+E+ P G  I+ + A D D  +   + Y+    + E      I      + +   L  Q    +  I A D G +    R ++ + + D+N     N +P        F+ KI             E++P    +I +   D D  +N R+  S                I++   +R+      +++SS  + E R    V+++ SD    P +++  I + + D+N+    F  S+Y+ ++ E+     SF L +S  D D   + IV+     + S      FR  + +  L + S LD E  + I   I   ++G     L++ +   +T+ D+NDNAP   + +   +I E++  GS +G+I A D+DE  N+ + F+    ++ K     F IE D    G ++ LT+ E D E ++  +   L    G   LS+T  + I V DVNDN P
Sbjct:  473 NDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG---SEDFIIDEDSGLI--KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK--ITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQ--GRCVVNVFIDDVNSAPYFNDHP--------FSVKIP------------EHSPIGYPVITLKAEDHDRGDNARIVYS----------------IDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSF-LQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS--LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKL----FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKP 998          

HSP 4 Score: 77.0258 bits (188), Expect = 7.568e-14
Identity = 77/303 (25.41%), Postives = 125/303 (41.25%), Query Frame = 1
Query:  403 IYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXE-----NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-------TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIK 1272
            +YSI+S         F+IDP++G I  S ++DRE           T SV +  +            ++      NDN P F +S+    + E  P+GT      A D D   NG+ +Y L     +    L R + +   L V   LD E      L +   D GTP   ++  + + + DVNDN P F++  Y   I E+ PVG  +  + A D D      + ++     +   + F I+       ++R L+        +   F F ++A        V    + IHV D+N++ P +K
Sbjct:  718 VYSIDS------SQFFRIDPSSGDISVSSDLDRE--------DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGAD--AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVP---VRIHVSDVNDNKPALK 1001          

HSP 5 Score: 60.4622 bits (145), Expect = 1.023e-8
Identity = 59/220 (26.82%), Postives = 100/220 (45.45%), Query Frame = 1
Query: 1972 HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINE-SIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSY 2613
             + EDT   + I S+KA+    + +S  ++  +    + R    F +++  G I+L K +DRE    + L + A +  +P +S + T+ + VLDV DN+P  IF  + D+   E      +GT +  + A D+D   +  I Y +   N K       K  +     P   E +    LD++A D G P R +   + + + D  +ND       AS SY
Sbjct:  173 ELPEDTPIETIIASVKAS----HASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSP--IF--EKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVD--VND--NAPVFASDSY 380          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 122.865 bits (307), Expect = 7.074e-28
Identity = 160/623 (25.68%), Postives = 290/623 (46.55%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVC----DIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVN-RTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKE---VMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT-VSF---NLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINES--IYTRVGTVITRLHAIDVDDLSHTNITYHIISD-NAKYF 2424
            NDN P+FA+ +  + + E+  +   +    ATD D   NG   Y + S       ++ Y+   + L        E  DA    ++      D   P   S+  + IN++D+ND+ P     +    + E+  +G+ + +V A D DS   G++KY    + +     F ID  +G I   + L  +    +   + ARD G  P++N  T I + +KDIN++ P       TF+ K       +  V+  E  P  + II +   D D D+  ++   +E+ + +   +L         I    A+ S + E +++   V V IS +D G         + I   D+N  P  FN   +S+ + E++ + +    L    HD+   + ++ +I    +   FR   ++  + + S LD E +++  FS+ +         L ++T   + + DINDN+P     +    I+ED   G++   + A D+D   N IV +  +N S++   ++ FR++ + GT++++ +LDRE+ ++  LPI A D G P LS    IT+++ DVNDN P +   +  D  I E+  + + VGT++ R    D D+  + +I++ I    +AK F
Sbjct:   10 NDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR-------ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMG-TPSLNTSTTIAVVLKDINDNAP-------TFDKK-------EYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILD--------IGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID--DVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID---SSQFFRIDPSSGDISVSSDLDREDRAT--FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE-QLSYDLYIAENSPVGSTVGTIVAR----DADEGDNADISFRIFGGADAKLF 581          

HSP 2 Score: 113.62 bits (283), Expect = 5.165e-25
Identity = 147/590 (24.92%), Postives = 251/590 (42.54%), Query Frame = 1
Query:  904 LVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYIN-NKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFS--------------------HLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHI----ISDNAKYFYLHPIKGEL---SFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +V I ++DVNDN P+F    Y   I E+  +  +I  V ATD D    G V Y  AS++        ID +TG + L   +  +      VI A+D G  P ++ T+ +TI+V DIN+H P +   +               +++  EN     ++  +   D+DS  NG ++ SME  + D++I      I   K++ R         E+     + ++  D G    +++ TI + + D+N+    F+K  Y++++ E     +  + L   D D    +   I +   R  F  L    Q  + S                        + +  +N  I+ +N  P+ N                        P +  I E +  G  + ++KA D D   N+ +V+  I+ S      + FRI+ S G I ++ +LDRE  + + + + A+D  +P L+T+  I + + D+NDN+PQ+         I+E I   VGT   ++ AID D   +  + Y +     S + + F L    G L   S L   +    +L I A D G P  S  + + L +SD  +ND
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--LTIDYSTGEVTLRERIDAKNSPITAVIRAKD-GAQPALSSTVPLTINVIDINDHAPTLIAAQ--------------KMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG-SEDFIIDEDSGLIKTTKLLDR---------ETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFN----------------------DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYS-IDSS------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT-SSSYAATISEDI--PVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD--VND 528          

HSP 3 Score: 109.383 bits (272), Expect = 1.027e-23
Identity = 147/580 (25.34%), Postives = 260/580 (44.83%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDIN-----NHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRL------VALSS-ANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN---TVSFNLPLSIHDQDCTSDVIVNITDLYARSH-----FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD----GTIK-LTK-ELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP 2268
            ND+ P    +  +I ++E+  +G  +   +A D DS  NG+ +Y +     ++ F +  +  +I  +   +LD ET   Y L ++  D+GTP   +S  + + + D+NDN P F K +Y   I+E+ P G  I+ + A D D  +   + Y+    + E      I      + +   L  Q    +  I A D G +    R ++ + + D+N     N +P        F+ KI             E++P    +I +   D D  +N R+  S                I++   +R+      +++SS  + E R    V+++ SD    P +++  I + + D+N+    F  S+Y+ ++ E+     SF L +S  D D   + IV+     + S      FR  + +  L + S LD E  + I   I   ++G     L++ +   +T+ D+NDNAP   + +   +I E++  GS +G+I A D+DE  N+ + F+    ++ K     F IE D    G ++ LT+ E D E ++  +   L    G   LS+T  + I V DVNDN P
Sbjct:  114 NDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG---SEDFIIDEDSGLI--KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK--ITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQ--GRCVVNVFIDDVNSAPYFNDHP--------FSVKIP------------EHSPIGYPVITLKAEDHDRGDNARIVYS----------------IDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSF-LQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS--LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKL----FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKP 639          

HSP 4 Score: 77.0258 bits (188), Expect = 8.396e-14
Identity = 77/303 (25.41%), Postives = 125/303 (41.25%), Query Frame = 1
Query:  403 IYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXE-----NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-------TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIK 1272
            +YSI+S         F+IDP++G I  S ++DRE           T SV +  +            ++      NDN P F +S+    + E  P+GT      A D D   NG+ +Y L     +    L R + +   L V   LD E      L +   D GTP   ++  + + + DVNDN P F++  Y   I E+ PVG  +  + A D D      + ++     +   + F I+       ++R L+        +   F F ++A        V    + IHV D+N++ P +K
Sbjct:  359 VYSIDS------SQFFRIDPSSGDISVSSDLDRE--------DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGAD--AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVP---VRIHVSDVNDNKPALK 642          

HSP 5 Score: 62.7734 bits (151), Expect = 1.940e-9
Identity = 104/449 (23.16%), Postives = 176/449 (39.20%), Query Frame = 1
Query:  406 YSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDA--------------YQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT 1683
            YS+E  G+E     F ID  +G+IK +  +DRE        V    +   S   S T+ V + +            NDN P F      + + E  P G+ +    A D D             +K+T      Y +     EV  +LD     A               ++ +S  D G  +     +V + I DVN + P F    +   I E  P+G  ++ + A D D      + Y   S+     ++F+IDP++G I +   L  + +  F  ++ A D+   P    T I + + DIN++ P  + T S++ A I             E+ P  T  + +   D D   NG V   + + +S   I L   +  ++    L   S  + E    +++ I   D G    S+   I + + D+N+    F + +Y L + EN+
Sbjct:  157 YSME--GSED----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDI-----------NDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE-----------DQKIT------YRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQ--GRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-----QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP--QFTSSSYAATI------------SEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQL---FRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENS 546          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 112.464 bits (280), Expect = 1.442e-24
Identity = 155/606 (25.58%), Postives = 264/606 (43.56%), Query Frame = 1
Query:  619 PPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLE----VVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCS-DSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSI-----HDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYH 2397
            PP F  +   + + E TP+GT L    A +    ++    Y L ++          +L+V  +     +    DFE   +YQ T+   +  +    S+ L+ I + DVNDN+PIF   +Y   + E     + +L VSA+D+DS  +G V Y   S ++     F I+P TG +F  +PL+     F  V+ A+D G   + N   I I V D +   P  + + S +  +                    T+ I   +         +V+ S+   + D       N+  ++   ++      + +    V++ I  +  SGE   S+   +VI I D N+ P  F+ S   +S++E+ +  + P  +      D+    +V  +I   +  S     Q T QL   S LD+E   +    ++  + G P R+   S  + FI ++D+NDNAP   +   T  + E++ P + +G + A D D   N  +V++  N      G E F I E  G +   + +DRE  S   + I+A D G P  S+T +  ISVLDVNDN P  +            + T +GT++    A+D D   + ++ Y 
Sbjct:  537 PPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQD--------EHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANS--ETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS----FSINPVTGEVFAQKPLA--RGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTP--QFSRSKYEIR-------------------TTEDILPGIAIGSVGAMSKVKYSIYSGDQD------HNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE---SNQTQVVIFIEDHNDNPPQFSSSLVEISIRED-LKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRS---SNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN------GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIV----AMDPDKGLNGSVLYR 1082          

HSP 2 Score: 96.2857 bits (238), Expect = 1.213e-19
Identity = 78/271 (28.78%), Postives = 124/271 (45.76%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPD-IKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRV 1416
            NDNPP F++S + I+++E   L    Y+  A+D D   NG   Y + S       S+  +     L    +LD+E    Y+L +   D+G P   S+  + I++LDVNDN P F+K  Y   + E+ P   ++ +V A D DS++ G + Y+  +       +F ID   G+++  R +  +   +    I A D G  P  +     I V D+N++ P  + IT       +V  G           +P +T I  IV  D D   NG V
Sbjct:  831 NDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGS--SIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN----GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSIT-----PIVVPAG-----------SPLSTAIGTIVAMDPDKGLNGSV 1079          

HSP 3 Score: 83.1889 bits (204), Expect = 9.881e-16
Identity = 153/671 (22.80%), Postives = 270/671 (40.24%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLP-LSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD---GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQ----WIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI------LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            NDN P + +S I I++  +      L  K   D D   NG   Y +     T+  S+      I+  V + +D       +  +   D G+P   +   V  ++LD     P F+K  +   I ED P+G  +++V A +        ++Y   + +        +D  +G + + +     + K++Q  + A +       + +LI+I +KD+N+++P                 PN+  ++  E   P   ++ +  +D DS   G V   +   +S + I    N +  +V        +    +R    +V+S  D G +   ++  I I ++D +     F++S Y +   E+     LP ++I      S V  +I       +F   + T ++ +  +LD +   ++  +I+        N             +    +  L+E     I ED K       ++A+D D+  N  V +  I+            IE D   G +     LD E    Y L + ATDLG P  S+  T+ I VLDVNDN P+    W      +N   ++I   VG V+ R    D D L +  I Y  I++ ++YF    I  +L  + T R  +        + IVA D G P RS+     + + D  +ND
Sbjct:  435 NDNAPQWHSSQIHISLNRTQGGSRTLTAK---DPDLGQNGWIRYSVLD---TELVSIDKETGRIF--VPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEH----LTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANS--ETSTSLISIRLKDVNDNWPIFY--------------PNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSI----NPVTGEVF-------AQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDI----LPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVE---ISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSS------IEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTI---VGKVVAR----DKDSLENGQIVYR-ITNGSEYFG---IDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLD--VND 1040          

HSP 4 Score: 75.485 bits (184), Expect = 2.231e-13
Identity = 89/346 (25.72%), Postives = 140/346 (40.46%), Query Frame = 1
Query:  247 IIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHV----LDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLD-----SIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHV 1239
            I+IF   F +    C     FTV E+    T IG +S  R   E+S+A   + + +    +EQ     ++D  +G I    ++D E      ++  ++  +  T  + + V              DENDN P FA+  + + + E   LGT   L   TD D     V  + +    V   F L        L+   V    LD E  D Y+L +   D G P         I I+D NDN P+F + +Y   ++ +  +G  ++ V ATD D      I Y + K    S +N A     +  TT  +    P ST       ++ A D+G     +  ++TI V
Sbjct:    9 ILIFSLIFLIFPTFCQCLTKFTVPESAQIGTRIGWISGKR---EESAA--PKYFVV--FPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETIDILVEV-------------DDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLL---PASTH----DVIVVASDHGSPSLSSSAVVTITV 327          

HSP 5 Score: 53.5286 bits (127), Expect = 1.314e-6
Identity = 69/271 (25.46%), Postives = 121/271 (44.65%), Query Frame = 1
Query:  418 SIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTK-PFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIIN-EDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTL 1224
            SI    +   F +D + G+I+ +L +DRE++        GT S   + T ++  VN +      NDN P F  S     V E+  +G+++    A D D+L      Y L S+   + P     +     + +   LDFE    + LT+   D       +   + I + D+NDN P F KP Y T ++      G+   ++ A DLD+   G + Y     ++     F++ P +G +F+ + L    + +   + A DNG VP+ + ++
Sbjct: 1864 SIVEGNIDSAFSVD-SEGVIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNL------NDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNL--APLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSI---FRVAPESGALFM-KVLPPAGERYLVTVTATDNG-VPSFSTSV 2114          

HSP 6 Score: 50.8322 bits (120), Expect = 6.972e-6
Identity = 62/258 (24.03%), Postives = 109/258 (42.25%), Query Frame = 1
Query:  919 ILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF-----QFVIEARDNG-PV-PNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSV 1671
            +LD NDN P+F    Y+  + +    G+ I Q+ A+D DS + G V Y+  S N+       ++P TG I L      Q   F     Q ++EARD+G P    V +  +++ +   +   P        F   + +       V   E+    T +  I  +++    N  +  S+++      I +K   +  K        +  + ES   + + +S SD   +       IV++ +D  EF  VF KS+Y+L +
Sbjct: 2220 VLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGND--LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAP-------FFVLPVYE-------VHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLK--------THLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVD--EFAPVFTKSSYTLQI 2451          

HSP 7 Score: 50.8322 bits (120), Expect = 8.322e-6
Identity = 51/167 (30.54%), Postives = 85/167 (50.90%), Query Frame = 1
Query: 2104 FRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGT-ITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK----YFYLHPIKGELSFLTTPRQ----GENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            F ++S+G I+   ELDRE    Y L ++ T  G  +    GT + + V ++NDN P   FP+    ++ E++  RVG+ +  + A DVD+L+   + Y ++SD++     +F +    G +  LT P       E+ L I A D      +N   L +++SD  IND
Sbjct: 1874 FSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQI----GTRVDVRVNNLNDNVPS--FPMSKPRRVPENL--RVGSYVATVGAKDVDNLA--PLRYFLVSDSSGQTPTHFNIDQFTGTI-HLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSD--IND 2024          

HSP 8 Score: 50.447 bits (119), Expect = 9.933e-6
Identity = 48/193 (24.87%), Postives = 84/193 (43.52%), Query Frame = 1
Query:  622 PMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEV---------VHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYP-IFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNE-AKRWFQIDPTTGHIFLIRPLSTQYKNF 1167
            P F   ++ +N++E TP G+ +   +AT               S+    P S R+ L +    +         +  L +     Y L   + +  T    ++ LV +N+ DVND+ P I  +P    ++   +  G M+ +V A DLD  K   ++Y      +E AK +F+ID  +G IF++   S    +F
Sbjct: 1329 PRFDTGHLRVNIREDTPTGSIITTVNAT--------------VSDDSASPISYRFPLLIDNFSIDQFTGDITLIDTLHWHVTPTYNL---IVEAFTSGPGTTLLVTVNVDDVNDHTPFIVSQPT--VLLPSSYRKGGMVHRVVAIDLD--KDPEIRYSLKYAGSEVAKEFFKIDEKSGEIFVVESSSALSTSF 1500          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 106.301 bits (264), Expect = 1.145e-22
Identity = 86/283 (30.39%), Postives = 134/283 (47.35%), Query Frame = 1
Query:  445 LFQIDPTNGIIKASLNVDREVIC---PQLSATSGTCS--VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQF----ASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYP 1263
            LFQID  NG++     +D E++      + A+ G      T+LVT+++           +NDN P F  S   + V ES  +G  L    A+  D   N   EY L    VT   +L     ++ L     LDFET  A +LT+   D G P   +   V I+++D NDN P F+K KY   + E+   G+ +L V A D+DS  +G V Y+      +T +     F I+ + G + + + +   + K +   + A+D G  P  +  L+ IHV+D N+H P
Sbjct: 3058 LFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVID-----------QNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLKPSDVTSFVNLNAQTGILTL--AKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAIN-SNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAP 3324          

HSP 2 Score: 98.2117 bits (243), Expect = 3.147e-20
Identity = 81/278 (29.14%), Postives = 138/278 (49.64%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYR-----------LTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQ-FVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVS----FYENNPPNTDIIFIVVTDK 1392
            EN + P+F++   ++ V E  P+GT +    A D D+  NG   Y            LT ++ +   ++  +LS +  E + VLD       QL +S  D GTP   S + +++ I DVN++ P F +  Y+  I+E+   GK I +V+A D D    G +K+   + N E      ID  TG + L++ L  + ++   F I A D G    V+ T +TI V+D+N++ P   +  S   A+I +  P+ + VS    F E+   N+ + F++ ++K
Sbjct:  601 ENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDV------QLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGN-NQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHS--RARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEK 869          

HSP 3 Score: 69.3218 bits (168), Expect = 1.869e-11
Identity = 47/154 (30.52%), Postives = 69/154 (44.81%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL------TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYG 1050
            ENDN P F     V  VKE++  G  +    A D DS   G   Y L      T++    PF++  N  V+   +   +D+E    Y L +   D G P   S  L+ I++ D ND+ P F       ++ E   +G  +L+ S +DLD  K G
Sbjct: 3209 ENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVL---ISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNG 3359          

HSP 4 Score: 68.1662 bits (165), Expect = 3.859e-11
Identity = 57/207 (27.54%), Postives = 100/207 (48.31%), Query Frame = 1
Query: 1969 FHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY--------FYLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
              I+E+ KPG +I  + AND D   N  +   K ++ NN+       I++  G +KL K LDRE + ++   I+A+D G P+  +   +TISV DVNDN P+ +    +  +I E +    G  ++ + A D D   ++ + + + S+   +         ++H  +  L +  TP      L I   D+G+P+ S    L + + D
Sbjct:  727 LRISENEKPGKDIFKVTANDFDGGNNGKI---KFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQ-HSRARIPEDLPH--GAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFN---LSIEVADHGDPILSTSCHLHVELVD 924          

HSP 5 Score: 67.0106 bits (162), Expect = 1.088e-10
Identity = 121/440 (27.50%), Postives = 197/440 (44.77%), Query Frame = 1
Query: 1210 VNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTD----IIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN-TVSFNLP---LSIHDQDCTSDVIVNITDLYARSHFRYLQA-TQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRG--LENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVIT-RLHAIDVDDLSHTN----ITYHIISDNAKYFYLHPIKGELSFLTTPR 2472
            V + LIT+ ++++N++ P  KI E     K++K       VS  EN P + D    I  IV  D D DE   ++  M     D+  + + + IN  V      +   + E      + +  SD   + K+   TI++ ++D N+    F KSTYS+ V E+ ++ + L     S  DQ+ T +  +  +D+   + F  L A T  L L   LDFET S++  ++   + G  P    L +     I+++D NDNAP    E     + E++K G  + ++KA D D      V ++   VS       +  F I S+G + +++ +D EK   Y L ++A D G P L +   + I V D ND+ P +       +  N +   + G  I  RL    V DL         T  I  D AK F ++    +L  LT  +
Sbjct: 2992 VCKELITVVIENLNDNRP--KIIE-----KLLK-------VSIDENLPTSEDARQYITRIVAEDADFDE---IKFRMVD---DFGGLFQIDDINGVV----TVVKPLDSEILGFFNLTVVASDGEFEDKA---TILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDV---TSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPP----LETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF-------DDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNE---KLELLTAKK 3387          

HSP 6 Score: 65.4698 bits (158), Expect = 2.941e-10
Identity = 156/658 (23.71%), Postives = 280/658 (42.55%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFT--IINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTN-NEAKRWFQIDPTTG-----HIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDK--DSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIY--RLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIV--IQILDLNEFPAVFNKSTYSL-----SVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHR-NFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQND--NKINESIYTRVGTVITRLHAIDVD-----DLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENILD 2493
            END PP F ++++ I++   T  G  +  + A D DS    VG  R   +  + PFS+      + ++  + +  +    + L + V D    K  +S +++I+ +   ++   F + +Y T  I N   P G +IL V AT  D + +      F+  N +EA   F I P TG      I L R  S      + V++A+ +   P + R L+ + +++IN+  P            I    P       Y+    ++DI  +V+  K  D+DE   V  S E           F  +  KV+   +L ++   + E   +++          K   S H +   ++I  +++   VF+++ Y+      S K++TV   + ++       S  ++    L  +S F     T ++ L    + +  +  N++ E+  +   R   +       I    I  +APV  +   T    E T  G  + +IKA  SDEN           +  +  G ++  I  + G + +T +LD EK   Y L ++AT  G  V S+     + + DVND  P++   I++D   KI++S  T  G  IT + A D+D     D     + Y I+  +   F + P  GELS L  P + +++++
Sbjct: 1777 ENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDS----VGSLRYFIKDQSVPFSVDSKTGDVLVKDSNGIS-DMTKLFDLEVFVTD---GKQSASYVMKISTISTENSKFKFTRNEYHTSLIENTTLPPGSIILSV-ATIGDKLDH------FSIVNPHEA---FFIHPGTGVISSSGIALDREKSAI---IRLVVQAKSHEKNPVMARALVVVGIENINDETP------------IFMGTP-------YDITIGHSDIGTVVLEPKVIDNDEGDVVTISSENMPE------YFKIVGGKVVLGKKLPSIEEEDLEFNFKLIA---------KDNGSVHRVEEPVKIRVVDKARPVFSQNVYTAVISKESTKKSTVLVKV-MAKSSLQSKSKGLIGYRILDKKSPFSVDFLTGEVRLN---NLKMLAETNYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDEN---------DTIEYSLSGSKDIEIHPETGDVTITGQLDYEKTQKYDLKLVATSSGKQV-SSEAEFIVLIEDVNDEMPEF---IRSDVSAKISDSAIT--GQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELS-LARPVEQDDLVN 2359          

HSP 7 Score: 63.5438 bits (153), Expect = 9.489e-10
Identity = 169/729 (23.18%), Postives = 299/729 (41.02%), Query Frame = 1
Query:  313 VTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDR------EVICPQLSATS---GTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRP-LSTQYKN---FQFVIEARDNG-PVPNVNRTLITIHVK--DINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNY----INNKVIYRLVALSSANCESRKEVMVVISCSDSG-----EKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD-------VIVNITDLYARSHFRYLQATQQLVLFS---HLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVND---------NNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVD 2367
            VTE+ P  T++  + A  + +  +  I   I+ I    +E    +  +D  +G I  + ++ +      EV+  QL  ++   GT   + + T+   I ++       N++ P F   +  + + E+   G  ++   A DFD  +NG  ++ L + +  K   +  +     ++++  LD E  D +   +   D G P   S   + I++ DVNDN P          I ED P G  +  ++A D D  +   +K+      N  K  F+ID  +G IF+  P     Y     F   IE  D+G P+ +   T   +HV+  DI +++  I+  +    A            S YEN+   T++I I     ++ E G  Q  ++  N ++ I+    +    I+ K   R   L   + E++    + +   DS      +  +     + I+ILD N+   V  K  Y  SV EN+ +  + + +   D           ++  I     +S FR +  T   +  S    LD E +S     + I + G  +  L S     + ++D NDN+P   +    H +  +K    +  I A D+DE  N+ + +      N   G   F I+++G I  ++ +  ++   Y L + ATD G P      T    VL  N          N+P  I   ++D  I  S   +VG  + +L A D D
Sbjct:  617 VTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHE----VLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDV-------NNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQ-EKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLL----NSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILS---TSCHLHVELVDIAHNHLAIEFDDVAKEA------------SVYENSEIGTEVIMI-----EAKETGDEQ-KVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHL--LDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFR-IDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQ--LCSNVIVIVNVLDENDNSPTFTQ-AIHHYSVRSKFAGKLCRIFAVDADEGENARLTY------NITEGDARFSIDNNGNIIASEAIHGDES--YALTVQATDHGTPGQQFAATRV--VLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDAD 1292          

HSP 8 Score: 63.5438 bits (153), Expect = 9.489e-10
Identity = 152/657 (23.14%), Postives = 277/657 (42.16%), Query Frame = 1
Query:  652 NVKESTPLGTHLYL---KHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGT-----PKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVK-YQFASTNNEAKRWFQIDPTTGHIFL--IRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVI-----YRLVALSSANCESRKE---VMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN-KSTYSLSVKE-NTVSFNL-PLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSI-VVFQKINVSNNKRGLEN-FRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWI----FPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTP-----RQGENILDIVAIDNG 2514
            +V E++ +GT + +   K   D   +     EYR+        FS+    +V      H+LD ET  AY +T+   D  T     P+      V I ILD ND+ P+ KKP Y   + E+ P   +I++V ATD D +         F     + + +F+ID T+G+I    IR L  + ++  +  +   D G     +  ++ ++V D N++ P       TF   I     + S+ S +        +  I   D D  EN R+  ++ + ++ + I    N I ++ I     Y L   ++ +    ++     VV++ + +G+KP+ S           N  P +   KS Y + + + + V   +  L   D D   ++  +I+     S F   Q T QL+L   ++   +  +  +I + +     +                 +A          ++E    G+ I ++KA  S E+L +  +VF   +V +    +E+  R+E S G + + + LD E  +     ++     N  + +  T ++++ D NDN+P ++    F       ++ES    V  V+  + A D D   +  +TY I+S N +  F +    GE+  L  P     +  E+IL I AID+ 
Sbjct:  942 SVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTV---RTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSP-------TFTQAI----HHYSVRSKFAGK-----LCRIFAVDADEGENARLTYNITEGDARFSIDNNGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSK----------NSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADG-DELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSA----SHYQTDVSERVAVGTQIYTLKA--SGESLGTKPLVFNLFSVDD--VAMEDKIRVEPSSGNVIVMEPLDYEA-ARRIRAVVQVQQAN--MKSFATFSVNINDENDNSPYFVGHTAFAF-----VDES--DTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVR-LAKPLDPELQHVESILRIRAIDSA 1549          

HSP 9 Score: 59.6918 bits (143), Expect = 1.637e-8
Identity = 127/579 (21.93%), Postives = 246/579 (42.49%), Query Frame = 1
Query:  778 LRYNLSVIYLEV--VHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNG-PVPNVNRTLITIHV-------KDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPK-SSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNI-GSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLY-YLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIY---TRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLT 2463
             R +L+  Y+    +  LD E    ++L +S+CD G P+ CS+ +V +N+LD NDN P F +  +   +      GK+  ++ A D D  +   + Y    T  +A+  F ID   G+I     +    +++   ++A D+G P      T + +         +   N  P+I   +S +   I         V   E +  + D ++  ++  D D    V+    Q     L+  K   +    +   ++++         V++ +S   S ++PK S++H       D++E  AV  +  Y+L     ++    PL  +        + ++ D+      R   ++  +++   LD+E    I   +++      +  + S  +F + I D NDN+P  +  T F   +++    ++  ++ A D D   N IV +    VS N+  L  F+I++  G ++L K LD E + +   L I A D  +   S    +++ + + N+      F    D K+ ++     TR GT +  L+A     L H  ++Y  +  N  +F +H + G +   T
Sbjct: 1097 FRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKF-AGKL-CRIFAVDADEGENARLTYNI--TEGDAR--FSID-NNGNIIASEAIHGD-ESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQL----LLAKKVELLKRGELRLNISVTDGQAWDHSTVIIQVSRQIS-QRPKFSASHYQT----DVSERVAVGTQ-IYTLKASGESLGTK-PLVFN--------LFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQV-----QQANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSI--VSGNEESL--FKIDAKSGEVRLAKPLDPELQHVESILRIRAID--SAANSLKDEMSLHIRNSNEAPETAKF----DRKVYQTTLYDSTRPGTPVLVLNA-----LHHGTVSYK-LEPNCTFFEVHTLSGAVHLAT 1627          

HSP 10 Score: 59.6918 bits (143), Expect = 1.722e-8
Identity = 125/537 (23.28%), Postives = 231/537 (43.02%), Query Frame = 1
Query:  877 GTPKHCSSQLVRINILDVNDNYPIF-KKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPD----IKITEST-FNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNK--VIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS----FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLV-LFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTK---ELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINE-SIY--TRVGTVITRLHAIDVDD---LSHTNITYHIISDNA 2415
            G  +  + + V I ILD ND+ P+F  K    T I    P G ++++V ATD D  + G + Y+F S     +   +I+  TG I L+  +  +  ++   + A D G +P    + + +         P     I I ES   ++ +  + P   +V   E+ P  T +  +   D+D+  NG ++  +         +L  +  + +  V   L  L     E   +V + +S  D+G   KSS  T+ ++I D+N     F++ +Y L + EN       F +  +  D      +  ++ +   +S    + A   +V L   LD E +    F+I   ++G P R  ++ T          ++    +++ +   I ED   G+ +  + A D D   NS + F    + N+++    FRI+   G I +      LD  K   + L I   D G+P+LST+  + + ++D+  N+      I+ D+   E S+Y  + +GT +  + A +  D   +   N+ Y II  + 
Sbjct:  468 GINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKP-GDVLVKVDATDQDEGENGKIVYKFTS-----ELPLEINANTGEITLVE-VPKKGNSWPATVWAIDLG-LPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPE--IVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVL-DVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMR--VSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKF----LLNSEK--VPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNH----LAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDG 981          

HSP 11 Score: 53.5286 bits (127), Expect = 1.201e-6
Identity = 73/311 (23.47%), Postives = 130/311 (41.80%), Query Frame = 1
Query:  349 DMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLT----------SEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDL---DSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHV 1239
            DM     + E+S  ++ +I      G+E    LF I P  G +  +  V+++ +  + +      SVT  +      + + I+       PP F  S+ V N  E+T +     L  A     +  GV   + +          + K   P ++      I+  V  VL++     YQ+ L V D  T +   S L  ++++D+ND  P F  P Y T I+E    G  ++ VSATD    D+I+Y L+       +    ++F + P  G I + + L  +        I+A D+   P+   T + +++
Sbjct: 2311 DMDTTNSLDEESQKLLYKIVD----GDET---LFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVA-----VKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIH--VSRVLNYHRDKRYQIPLVVED-ATGRRAFSTLT-LSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLL-------DGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNI 2598          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 98.2117 bits (243), Expect = 2.709e-20
Identity = 108/357 (30.25%), Postives = 173/357 (48.46%), Query Frame = 1
Query:  223 FYSHRLYIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNG-VGEYRLTSEKVT----KPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKI 1275
            F+S  L   +IF   F   +      I F+V+E+   NTIIG + A           +   Y + S GN ++K     D     +  S  +DRE         S      L++T    I++I+I ++D NDN P+F      + + E+ P+G  + +  ATD D   NG +G+Y L     T     PF +  +   ++LEV   LD ET D Y + L+  D G P+  SS  + I ILD+NDN P F   +  T+     P  K+   ++ATDLDS +  L+ Y+   +   ++  F I  +  +I + +  +   +  +FV+EARD+G VP ++ TL I ++++  N H P+I I
Sbjct:    6 FFSIFLLNHLIFFHLFNFTHQFSEETIKFSVSEDAKLNTIIGHLEAE----------IGYTYRL-SRGNSKIK----FDEQTLELSVSSPLDRE---------SENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGI-RSLTLNWNGLPNTKL-FSLNATDLDSNENSLLTYRILPSGPTSE-MFSI--SDENILVTQNNTECLQRCEFVVEARDSG-VPPLSTTLNIVVNMEYGNEHEPNINI 332          

HSP 2 Score: 94.3597 bits (233), Expect = 3.942e-19
Identity = 153/603 (25.37%), Postives = 253/603 (41.96%), Query Frame = 1
Query:  823 LDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY--FTIINEDHPVGKMILQVS--ATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRT-LITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKS----SINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQK----INVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATD-LGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            LDFE    Y+  +      T    +SQ++ I++ D ND  P F         ++ E   V   ++  S  A DLD  + GLV Y   S N      F ++ TTG I  + PL  +  +  + +IEA+D G +P+++ T  I IHV DIN++ P+ ++  S++  KI             EN+   + II I+ TDKD D    +Q S+E  N +  I  + N     +          N E  +E    +  +D GE  KSS   + I + D N+   + N     + V + T S  +   IH        ++N+ DL    H ++      L L  + +   KS    ++   + + +   H  F+                 PV +E               + ++   + DE    + VF+     I  S   R  ++  +E S G +K    LD E+ S   + I+AT    N  LST    TI ++D+NDN+P++   +   N    S    +G VI R    D+D  S   + Y I+  +A + ++    G++     L    + E  L + AID+G P R   T + + + D+  N
Sbjct: 1613 LDFENIKTYRFNI------TAGKSTSQVI-IHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSL---FAVNSTTGDILSLIPLDREESSLHELLIEAKDAG-IPSLSATSKILIHVGDINDNTPEFEL--SSYFIKI------------SENSKIGSKIIRILATDKDKD--AELQYSLES-NDEITIPFRINVATGWI----TVAGKVNREENEEFRFFVKVTD-GE--KSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEI---IH--------VINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHF-----PVFVE--------------KLDTVSVREHDE--QELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIAR----DIDRSSR--VFYEIVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDN 2142          

HSP 3 Score: 73.1738 bits (178), Expect = 1.181e-12
Identity = 79/283 (27.92%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDREVICP---QLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLY-----LKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDI 1269
            F I P +G I  +  +D E I      ++A   T  V + VT              END  P F   ++V N+K    L T  Y        A D D   NG+  Y + S   T  F++      I L ++  LD E    ++L +   D G P   ++  + I++ D+NDN P F+   YF  I+E+  +G  I+++ ATD D  K   ++Y   S N+E    F+I+  TG I +   ++ +  + F+F ++  D       ++ ++ IHV+D N+++P I
Sbjct: 1598 FTISPFDGTIFTNSPLDFENIKTYRFNITAGKSTSQVIIHVTD-------------ENDEAPRFITGDVV-NLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGN-TSLFAVNSTTGDI-LSLIP-LDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKD--KDAELQYSLES-NDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDG---EKSSKVIVEIHVEDFNDNHPMI 1857          

HSP 4 Score: 72.4034 bits (176), Expect = 1.960e-12
Identity = 102/357 (28.57%), Postives = 165/357 (46.22%), Query Frame = 1
Query: 1510 SSANCESRKEVMV-VISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSI-HDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELS-FLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKS 2568
            SS + E   E +V +I+ +    KP S+     I+I+D+N+    F++  Y  +V EN+    +   I  D D +S V   I    A   F  +  + Q+     LD ETKS  +  +E I+ G  R      T+  +T++D +DNAP         + ED + G  +  + A+D+DE+ N      +  +     G+  FR+ E+ G + +   LD EK+  Y + +  TD G  ++ T  ++ ++V DVNDN P  IF       I+E     +G    + HA D+D  ++  I Y + S    YF + P  G LS F     Q    L + A D+G P    Q  +  ++ DKS
Sbjct: 2000 SSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIARDIDRSSRVFYEIVGGDANHEF-MVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRR--RGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRIGEPVIQLSASDADEHSN-----HRFELDGGGEGIP-FRVDENTGMVFVNDSLDFEKKQSYRIKVKLTD-GAWLIET--SLFVNVKDVNDNAP--IFEKPEYLFISEENSAEIG----QFHASDMDSENNGKIRYSVTS---PYFKIEPSTGVLSRFRQQLPQPLMSLKVTATDHGVP--RLQKTVLAHLVDKS 2333          

HSP 5 Score: 58.9214 bits (141), Expect = 2.537e-8
Identity = 51/202 (25.25%), Postives = 98/202 (48.51%), Query Frame = 1
Query: 1963 TTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVD-DLSHTNITYHIISDNAKYFYLHPIKGELSFLT-TPRQGENILDIVAIDNGNPVRSNQTRLFLYIS 2559
            T  H+ E+   G+  G I+A D D  L+ +V ++ +  S++  G+  F ++S  G+++  K  D EK+  Y     A DLG P  +T    TI + DVNDN P++            +I  +    +  + A D D D+ +  + YH+++ +  +F L    G+++ +   P   + +   ++  N +  R  Q++ FL ++
Sbjct:  636 TEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGI--FHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKF-----GSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYH-DFFQLDKETGKVTTIQDVPMTWQRLNISISAVNMDSERFLQSKTFLLVT 829          

HSP 6 Score: 55.8398 bits (133), Expect = 2.158e-7
Identity = 52/209 (24.88%), Postives = 98/209 (46.89%), Query Frame = 1
Query:  805 LEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM 1428
            +E V  LD ET   Y L +   D G P+   +  V + +LD +DN P F +  +   + ED  +G+ ++Q+SA+D D        ++F          F++D  TG +F+   L  + K +++  ++  D   +     T + ++VKD+N++ P  +  E  F ++              EN   + +I     +D DS+ NG+++ S+
Sbjct: 2098 IESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSR-IFHVEVPEDVRIGEPVIQLSASDADEHS----NHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLI---ETSLFVNVKDVNDNAPIFEKPEYLFISE--------------EN---SAEIGQFHASDMDSENNGKIRYSV 2281          

HSP 7 Score: 53.9138 bits (128), Expect = 8.964e-7
Identity = 47/183 (25.68%), Postives = 76/183 (41.53%), Query Frame = 1
Query:  649 INVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLD----SIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEA 1185
            I+V E+ P+GT      A D DS  +GV  Y++ ++          + +   L  +   D E   +Y       D+GTP   ++    I I DVNDN P F    Y   I+        I+Q +  D+D     ++Y L+ Y           +FQ+D  TG +  I+ +   ++     I A
Sbjct:  638 IHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYH---------DFFQLDKETGKVTTIQDVPMTWQRLNISISA 811          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 206.838 bits (525), Expect = 1.752e-53
Identity = 206/763 (27.00%), Postives = 343/763 (44.95%), Query Frame = 1
Query:  418 SIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQ---LSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL------------TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM-EQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----------------ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNS------IVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPV---LSTTGTITISVLDVNDNNPQWIFPIQNDNKINE---SIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTT-PRQGENI-------LDIVAIDNGNP 2520
            S+  E  K LF ID  +G +  S ++D E        ++AT G     + ++T+LV + +            NDNPP+F      +NV ES  +   +   +A+D D+ +N    YR+            +S  V++ F +  N   IYL     LD ET D YQLT+   D GTP   +   V + +LD NDN P F+K KY   I E+   G ++  V+A+DLD  +   ++Y     N+     FQ+ P TG I    PL  + +  +  V+EARD G      R  + IHV D+N++ P+I               P + +VS  E  PP T+++ +   D+D  +N  +  S+ +  +SD   +   +  +  +  R+V     + E R    + ++ SD G  P+ +   + +++LDLN+    F  S+    V+E+    ++  SI   +  +DV+ N                 +T     + F   + +  LV+   LD E +S     I  ++     N  +S  +  I + D+NDNAP    +P    ++E T  G+ I +  A D+D   N       I  F ++N S  ++ +  FR++S  G + L   LD E    Y L + A D  + V   L T+ T+ + +LD ND+ P ++ P  +  K      S  TR+G V+  + A+D D   +  +TY I   N +  F ++   G +  + + P   E++       L I A D+G P
Sbjct:  969 SLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDV-----------NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAP--LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI-------------ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV----LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNES-QEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 2 Score: 188.348 bits (477), Expect = 9.486e-48
Identity = 213/750 (28.40%), Postives = 345/750 (46.00%), Query Frame = 1
Query:  421 IGNEQVKDLFQIDPTNGIIKASLNVDRE------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSL---RYNLSVIYL--EVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSD-ENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQD--CTSDVIVNITDLYARSHFRYLQATQQLVLF---SHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH---ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTR---VGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGEL-----SFLTTPRQGENILDIVAIDNGNPVRSNQTR-LFLYISD 2562
            +    V+    ID   G I+  + +DRE      ++   LS  +    + +LVT+ +           ENDN P F  +++ I   E+TP      L  A D D        Y + S  V   F L   R    V+YL  ++   LD ET   Y L +   D GTP       V I I DVNDN PIF + +YF  + E+  VG  +LQV A+D D+ + GLV+Y      ++ ++ F+IDP TG I++ + L  + K   + V+ A+D+G  P      ++I V D+N++ P I +   + +A      P  S     E+  P   +  I V D DS  E   V  ++   +  + +  + N      IY ++     + E      + +  +D G  P  ++ +I ++I D+N+ P  F +  Y  +V E  +  +  L +  HD+D    S +  ++ +    +H ++ Q   Q  L    SH+D ET+     ++   + G  P    L+ST +  +TI D+NDN P+  +  +F+   + E+   G  I  + A+D D  +N++V +    +    + L  F + S  G I +  ELD E+ S Y  P+LATD G   LSTT  I + + DVNDN P + +P +    + ES         T I  + A D D  +   ++Y I++ N A  F +    GE+       L+   Q  ++L+I A D GN +RSN    +FL I D
Sbjct:  114 VAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN----IRVLVTVKD-----------ENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDAS-----PKIS-----ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS-----IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP----LSSTATVLVTIHDVNDNEPIFDQ--SFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNY---TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIID 819          

HSP 3 Score: 150.599 bits (379), Expect = 3.996e-36
Identity = 193/746 (25.87%), Postives = 334/746 (44.77%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDREV-ICPQLS--ATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSE-KVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKM-----ILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRP--LSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPL---SIHDQDCTS--DVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKI-----NVSNNKRGL---ENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT-PRQGENILDIV--AIDNGNPVRSNQTRLFLYISDKSIND 2577
            FQIDP  G+I    ++D E    PQL+  A  G     + + T+LVTI +            NDN P+F  S   ++V E+ P+G  +    A+D D   N +  Y +    K    F +R     I   +   LDFE   +Y+  +   D G     ++ ++++ + DVNDN P+F   +Y   + E            I+ V ATD D   +G V Y+  + N      F+ID +TG IF++RP  LS + +    + I A D G + +    ++ + + D     P  +     +  K              E+ P  T +  ++    D      V+ S+   + D    ++ N  N ++   L      + E++ +V++ I  +  GE P      + I++ D+N+    F  S   +SV E +     PL     HD+D  S   V  ++     +  F     +  L+L  HLD+E+       +   + G P    L++  +  + + D+NDN PV   +  + +++E     + I  + A+D D   N+ + ++ +     NV+N+       ++F I  + G I L   LDRE    Y L +LATD G P       + + VLD NDN+P++    + + +I E++  R G+V+  + A D+D   +  I Y ++  N+  F +HP+ GE+S      R+   + D+V  A D G PVRS +  + +++SD  +ND
Sbjct:  554 FQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDV-----------NDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEIC--IAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAG--IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVK--------------EDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPL------DHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPE-SAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS---LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ-KSKYEFRIEENL--RRGSVVGVVTASDLDLGENAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSD--VND 1251          

HSP 4 Score: 148.673 bits (374), Expect = 1.609e-35
Identity = 182/742 (24.53%), Postives = 317/742 (42.72%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREV---ICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFAS----------TNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSIH--DQDCTSDVIVNITDLYAR---SHFRYLQATQQLVLFSH--LDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIK--ANDSDENLNSI-VVFQKINVSNNKRGLENFRIES-------DGTIKLTKELDREKESLYYLPILATD--LGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYF 2424
            + V E+ P+ T++G + A        S +   IYS +  G       F I+  +G I+ +  +D E    +   + AT G   V            + I + D NDN P F  S + I+V ES  LG  LY  HA D DS  +G   Y L  E     F++  +    +L +   LD+E+   + L ++  D G P   ++  + +++ DVNDN P+F+K +Y   ++E   +   I+QV+A+DLD+     + Y+             ++++  + F I P +G I+L  PL  + ++ +Q  + A DNG      +T + + V D N++ P  K  +S +  +I +     S+V              +  +D D  EN  ++ S+   NS + +        + V   +      + E R+   +V+   D G   +S+   + I + D+N+  P + +     +SV+E        + +   D+D   +  +  + +  R    H  +       V+ +   LD E +S     +   + G P R  +       + + D     P     +  F + ED   G  +GSI      +D   NS+   F+ + V+     L    IE+        G + + + LDRE +S + L I A D    N   S+  T+ I V DVNDN P+W    Q+   +  S  T VGT+I    A D D  ++ ++ Y +I    +YF
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG------YFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPV-------YGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI--DARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP--KFQKSKYEFRIEENLRRGSVVG------------VVTASDLDLGENAAIRYSLLPINSSFQV--------HPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNR---PTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI----RYF 1528          

HSP 5 Score: 143.28 bits (360), Expect = 5.988e-34
Identity = 181/681 (26.58%), Postives = 299/681 (43.91%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHIT--EDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII-------------SDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            NDNPP F       NV E    GT +    A D D   N    Y L     T     + +     +     +D ET    QLT+   D G P   S+  V + I DVNDN PIF +  Y   + E+ PVG+ IL+VSA+D D     +V Y            F++   +G I +   L  + + +++F + A D G +      +I + + D+N++ P     E   +   ++  P  S      +   +T I+ +V TD D    G+V   +   N   +  +  +      + R   LS     ++   M+ IS +D G    ++   + + I+D  + P +F K+ Y+  VKE+    TV  ++  +  D    S V  +I       +F     +  + +   LD E KS +  +I+     P    +   T   I + D+NDNAP   E +   I+  E  + G+ + +  A+D D   +  V +  +  S   +GL  F I++  G + L++ LD E    + L + ATD G P LST  TI + V DVNDN P  +F  +++  +N S    +   I +++A D+D  ++  ITY I+             SD +++F + P  G + +L  P   E      L ++A DNG P    +TR+ + + D + ND
Sbjct:  498 NDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE-FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTT--AMIKMQLTDVNDNRPVFYPREYKVS---LRESPKAS------SQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRS-TGEIFVVRPDMLS---VRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP---VYGHTQVNIEVEDVNDNAPE-FEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGL--FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP--VFE-KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWI-YLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDND 1150          

HSP 6 Score: 137.117 bits (344), Expect = 5.695e-32
Identity = 201/820 (24.51%), Postives = 352/820 (42.93%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMS-------AYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICP------QLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLT------SEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIG---TPKHCSSQLVRINILDVNDNYPIFKKPKYFT------IINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN------FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM------EQFNSDW---LIMLKFNY-INNKVIYRL-VALSSANCESRKEVMVVIS--CSDSGEKPKSSTH----TIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSIH-------DQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGN-PVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINE-SIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY---FYLHPIKGELSFLTT--PRQGENI-LDIVAIDNGNPVRSNQTRLFLYISD 2562
            F V E+     ++G +S         R   E+S   ++  Y++  +  + ++  F ID  +G +  +  +DREV          L  T+     +  +T+  ++ ++       NDN P +    I + V E+TP+GT ++   ATD D+  NG  +YRL       +E   +  SL R +     L +   LDFE    Y L +   D     T +  +S  VR+ ILD ND+ P F  P           I++   +G+++  + A D DS   G + Y+    N E +  F+I+  TG I L++ L    ++      F  +I A+D+G  P   ++ + +H+    +H    +  ++ + A I+            EN P  + ++ +        EN  +   +      + F+ DW   +I  +  +   ++  Y L V +  AN +S      V     SDS     +  H    TI I + D+N+  P     S Y LSV EN+     P  IH       D+   +D+I +IT     + F    ++ +L     LD E  S     I+  ++G  ++               ++     L   T  + ED   G+++  I A D+D  +N+ +V+   N +  +  ++       G I    +LDRE ++ Y   +LATD G   V S T  + I+VLD+NDN P  IF  +    I +     + G  + ++ A+D D  ++  I Y + ++N+     F ++P  G LS   +     G+ + L++VA D GNP +S+   + L I +
Sbjct: 1372 FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADV-------NDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR--FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATIL------------ENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSE----PGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDG----QSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP--IF--ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGE 2156          

HSP 7 Score: 124.79 bits (312), Expect = 3.335e-28
Identity = 142/587 (24.19%), Postives = 244/587 (41.57%), Query Frame = 1
Query:  619 PPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWL--------IMLKFN-YINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNL--PLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT--TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW-----IFPIQNDNKINESI 2316
            PP+F  +     VKE  P GT +    A   D        Y + S      FS+  N   I   +   LD E      L +    +G P       V I + DVNDN P F+       + E   +G  +    A D DS   G V Y         K  F ID  +GH+ L + L  +      +I    +G VP+++  L I + V+D+N++ P  +  E + N                E+   N  II +  +D D+  N R+   +     D +        +   F  + N+  IY    L   + E+R    + +  +D+G     +   +++++LD N+    F KS Y   ++EN    ++   ++  D D   +  +  + L   S F+    T ++     LD E +   +  +E  ++G P R+   +     I + D+NDNAP + +P      + E+  PG+ +  ++A D D   N+ + +  +    +  G   F I+ + G I+    LD E+ S+Y L + A+D GNP   T   + + VLD+NDN P +     +F ++ D  +   +
Sbjct:  824 PPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNI--RIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL--VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVS--------------ESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL---DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRS---ARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVV 1384          

HSP 8 Score: 106.686 bits (265), Expect = 9.045e-23
Identity = 183/793 (23.08%), Postives = 335/793 (42.24%), Query Frame = 1
Query:  310 TVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVD---REVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLY-----LKHATDF--DSLDNGVGEYR-------LTSEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPK--HCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDS-----IKYGLVKY--QFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGP-VPNVNRTLITIHVK--DINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDII-FIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVAL---SSANCESRKEVMVVISCSDSGE-KPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT---------------------VSFNLPLSIHDQ----DCTSDVIVNITDLYARSHFRYL------QATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTG--TITISVLDVNDNNP-----QWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT 2466
            +V E  P  T +  + A  +   ++++I    YSI    +     LF IDPT+G+I+  + +D   R +    ++A+ G       V ++   V  +      NDN P F +S++V  V+E   LG H+      ++   D   +S++    + R       LT + +   F + R++ +++   V  +LD E    ++L +   D         S+  V+I + DVNDN P + +      ++E  PVG +I   +ATD D+     ++Y L++Y  Q   +  +A   F++D  TG + L  PL  +  + +  +++A D    V    +T +T+ ++  D N+H P        F +     G   SL  F  +     +++  IV  D+DS +NG++   +   N +     +F   +   I  LV     ++ + E      ++I   D G+ +PK S+  + + +   +  P  F ++ Y  ++ EN                      +S+ +P  + +     D    +I         S   Y+       A +Q  L S    + +SS   SI   + G H +  T   +      +  +  P         + E+++PG  I ++ A+D DE  N+ +++   +++    G   F I+S       + LDRE+ S Y L I A+D G P  S  G   ITI V D NDN P     ++   +Q D  +        GT + ++ A+D D   +  + Y + ++    F    I G+   +TT
Sbjct: 1265 SVREEQPPGTEVVRVRAVDRDHGQNASIT---YSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL------NDNRPTFTSSSLVFRVREDAALG-HVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLV---VARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPH-------FVSPNSSGGKTASL--FISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG----RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSD--SIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSC--YGLSVPENSEPGV-IHTVVASDLDEGPNADLIY---SITGGNLG-NKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQP-KSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL--------GTSVVQISAVDADLGVNARLVYSLANETQWQFA---IDGQSGLITT 2010          

HSP 9 Score: 89.7373 bits (221), Expect = 1.439e-17
Identity = 98/368 (26.63%), Postives = 157/368 (42.66%), Query Frame = 1
Query:  403 IYSIES--IGNEQVKDLFQIDPTNGIIKASLNVDREVIC-----------PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQL-VRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIML 1461
            IYSI    +GN+     F ID ++G + A   +DRE               Q  +  G C++T+ V              D+NDN P F  S    +V+E  PLGT +    A D D   N    Y L +E   + F++     +I    V  LD E   +Y   +   D G  +  S+ + V+IN+LD+NDN PIF++  Y   +      G+ +L+V A D D      + Y   + N+     F+I+P+TG +   + L+++  K     + ARD G  P  +  LI + + +     P ++    T+             V   EN+P  T ++ +V    D     +VQ S    N D ++ L
Sbjct: 1883 IYSITGGNLGNK-----FSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFV-------------EDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ-FAIDGQSGLI--TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYR------------VMLKENSPSGTRLLQVVALRSDGRRQ-KVQFSFGAGNEDGILSL 2215          

HSP 10 Score: 86.6557 bits (213), Expect = 1.187e-16
Identity = 105/417 (25.18%), Postives = 178/417 (42.69%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN---EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGR-----VQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFE 1830
            ENDN P F+    V  V E    GT +   HA D D+  N    Y +        F +    S I    + VLD E  D Y+L +   D G P+   +  +R+ I+DVNDN P F  P     ++E   +G +I  +SA D+D+  Y  + Y+  + +    E    F +D  +G + L R L  + +  ++  + A D     +  RT++T+ V D N++ P     +      I+   P  S +S  E+   + D++ +  TD DS+ N       ++ + E F+          + +N V+   ++       S  +  V I   D+G+    S+  + +Q  D     + F ++ Y   + E     ++ L +  QD   D  + I      S F  LQ ++ +VL   LD E
Sbjct: 2315 ENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNI-VLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD---AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAIL---PAISEIS--ESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSV---------HPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-GQDAL-DQSLAIIAGNEESAFELLQ-SKAIVLVKPLDRE 2707          

HSP 11 Score: 73.559 bits (179), Expect = 1.141e-12
Identity = 69/233 (29.61%), Postives = 117/233 (50.21%), Query Frame = 1
Query: 1975 ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES--DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIIS------DNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASR--SYFTLVAVV 2634
            ++E    G+ +  + A DSD   N+ + +  ++ +++      F IE    G ++    LDRE   +Y L I+ATD G P ++ T TI + ++DVNDN P   FP  N   ++E+  T +G VIT + A DVD  ++  +TY + +      +N   F L    G+L     L    Q E  LD++A D  +  R   T L + ++D++ N  +   FLA +  +YF ++  +
Sbjct: 2331 VSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP--TFPPNNLVTVSEA--TELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNAPV---FLAQQPPAYFAILPAI 2547          

HSP 12 Score: 73.559 bits (179), Expect = 1.351e-12
Identity = 126/483 (26.09%), Postives = 208/483 (43.06%), Query Frame = 1
Query: 1216 RTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSL-VSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSS-ANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD------VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPV-----LLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLT---KELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII---SDNAKYFYLHPIKGELSFLTTPR-----QGENI--LDIVAIDNGNPVRSNQTRLFLYISDKSINDGI 2583
            R L+T  VKD N++ P       TF        P  S+ + F EN P       +   D D +     + ++   N +    L  +   + V+Y  + +S   + E+     ++I   D G  P     T+ I I D+N+   +FN+S Y  +V EN       L ++  D  +D        +N         FR    T  + +   LDFETK      + ++ K      L +T    I + D+NDN P      L +  +  I+E  +PG  +  I  +D D    S   +  +NV+ N  G  +F + + D +I L      LDRE  S Y L ++ATD G P L  + +I + + DVNDN P++   + + N +        GT + ++ A D D+  ++ +TY +      +A++F + P  G    L T R     + E +  L +VA D G P  S+   + + I D + N+ I
Sbjct:  159 RVLVT--VKDENDNAP-------TF--------PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL--HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD----SKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME---VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG----LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPI 610          

HSP 13 Score: 64.6994 bits (156), Expect = 6.751e-10
Identity = 50/178 (28.09%), Postives = 82/178 (46.07%), Query Frame = 1
Query:  610 NDNPPMFANS-NIVINVKESTPLGTHLYLKHATDFDSLDNGVGE--YRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFET-CDAYQLTLSVCDIGTPKH-CSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRW--FQIDPTTG 1122
            NDN P+F  S      + E  PL   +    A D D  +    E  Y +TS      F++     V++  V + LD+++   +Y+L +  CD    +  CS Q  R+ + D NDN P F   +Y   + E+ PVG  + +  A+DLD   +G + Y      ++   W  F++D  +G
Sbjct: 2746 NDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLF--VNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG 2921          

HSP 14 Score: 62.3882 bits (150), Expect = 2.976e-9
Identity = 52/186 (27.96%), Postives = 88/186 (47.31%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL----TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINED--HPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPL 1146
            ENDN P F  +  V  + E+ P+G+ ++  HA+D D    G   Y +    + E   K F  R +     +    V D+E    Y + L   D+G  K  +S  VR+ I   ++  P F +  Y  ++      P G ++ QV+ATD DS   G V YQ ++ ++     F+++ ++G + + R L
Sbjct: 2855 ENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMF--RVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK--ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH----FKVNRSSGAVLIKRKL 3032          

HSP 15 Score: 62.3882 bits (150), Expect = 3.435e-9
Identity = 110/433 (25.40%), Postives = 185/433 (42.73%), Query Frame = 1
Query:  430 EQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLV--TXXXXXXXXXXXXXXENDNP---PMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTP------KHCSSQLVRINILDVNDNYPIF-KKPKYFTIINEDHPVGKMILQVSATDLD--SIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPL--STQYKNFQFVIEARDN---GPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFY-ENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSD---WLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTY 1659
            E  ++ F + P+NG++  S+N+ R  + P +S +SG   V ++        + +  ++ V  NDN      F  +     + E+ PLG+ + L+     D+LD  +    + +      F L  + +++   +V  LD E  D Y+L L +     P         S   V I ILD NDN+PIF +  KY   I+E  P+   I Q+ A D D  +     V Y   S N+E    F ID  TG +F+   L   +  K+++ +I A D+    P+ ++    + +H  D N++ P   +TE                V F  EN P  + +     +D D    G++  S+    SD   W  M + +  +  V    V     + E R+   + +  SD G K  S    + ++I   +EF   F + TY
Sbjct: 2582 EPAQEGFSVHPSNGVV--SVNMSR--LQPAVS-SSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGS-VVLQLGQ--DALDQSLA---IIAGNEESAFELLQSKAIV---LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDE--HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELH--DENDNEPKFPLTE---------------YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK-MFRVDSESGLVTSAFV----FDYEQRQRYDMELLASDMGGKKASV--AVRVEIESRDEFTPQFTERTY 2974          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 206.838 bits (525), Expect = 1.752e-53
Identity = 206/763 (27.00%), Postives = 343/763 (44.95%), Query Frame = 1
Query:  418 SIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQ---LSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL------------TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM-EQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----------------ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNS------IVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPV---LSTTGTITISVLDVNDNNPQWIFPIQNDNKINE---SIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTT-PRQGENI-------LDIVAIDNGNP 2520
            S+  E  K LF ID  +G +  S ++D E        ++AT G     + ++T+LV + +            NDNPP+F      +NV ES  +   +   +A+D D+ +N    YR+            +S  V++ F +  N   IYL     LD ET D YQLT+   D GTP   +   V + +LD NDN P F+K KY   I E+   G ++  V+A+DLD  +   ++Y     N+     FQ+ P TG I    PL  + +  +  V+EARD G      R  + IHV D+N++ P+I               P + +VS  E  PP T+++ +   D+D  +N  +  S+ +  +SD   +   +  +  +  R+V     + E R    + ++ SD G  P+ +   + +++LDLN+    F  S+    V+E+    ++  SI   +  +DV+ N                 +T     + F   + +  LV+   LD E +S     I  ++     N  +S  +  I + D+NDNAP    +P    ++E T  G+ I +  A D+D   N       I  F ++N S  ++ +  FR++S  G + L   LD E    Y L + A D  + V   L T+ T+ + +LD ND+ P ++ P  +  K      S  TR+G V+  + A+D D   +  +TY I   N +  F ++   G +  + + P   E++       L I A D+G P
Sbjct:  969 SLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDV-----------NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAP--LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI-------------ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV----LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNES-QEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 2 Score: 188.348 bits (477), Expect = 9.486e-48
Identity = 213/750 (28.40%), Postives = 345/750 (46.00%), Query Frame = 1
Query:  421 IGNEQVKDLFQIDPTNGIIKASLNVDRE------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSL---RYNLSVIYL--EVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSD-ENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQD--CTSDVIVNITDLYARSHFRYLQATQQLVLF---SHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH---ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTR---VGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGEL-----SFLTTPRQGENILDIVAIDNGNPVRSNQTR-LFLYISD 2562
            +    V+    ID   G I+  + +DRE      ++   LS  +    + +LVT+ +           ENDN P F  +++ I   E+TP      L  A D D        Y + S  V   F L   R    V+YL  ++   LD ET   Y L +   D GTP       V I I DVNDN PIF + +YF  + E+  VG  +LQV A+D D+ + GLV+Y      ++ ++ F+IDP TG I++ + L  + K   + V+ A+D+G  P      ++I V D+N++ P I +   + +A      P  S     E+  P   +  I V D DS  E   V  ++   +  + +  + N      IY ++     + E      + +  +D G  P  ++ +I ++I D+N+ P  F +  Y  +V E  +  +  L +  HD+D    S +  ++ +    +H ++ Q   Q  L    SH+D ET+     ++   + G  P    L+ST +  +TI D+NDN P+  +  +F+   + E+   G  I  + A+D D  +N++V +    +    + L  F + S  G I +  ELD E+ S Y  P+LATD G   LSTT  I + + DVNDN P + +P +    + ES         T I  + A D D  +   ++Y I++ N A  F +    GE+       L+   Q  ++L+I A D GN +RSN    +FL I D
Sbjct:  114 VAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN----IRVLVTVKD-----------ENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDAS-----PKIS-----ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS-----IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP----LSSTATVLVTIHDVNDNEPIFDQ--SFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNY---TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIID 819          

HSP 3 Score: 150.599 bits (379), Expect = 3.996e-36
Identity = 193/746 (25.87%), Postives = 334/746 (44.77%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDREV-ICPQLS--ATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSE-KVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKM-----ILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRP--LSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPL---SIHDQDCTS--DVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKI-----NVSNNKRGL---ENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT-PRQGENILDIV--AIDNGNPVRSNQTRLFLYISDKSIND 2577
            FQIDP  G+I    ++D E    PQL+  A  G     + + T+LVTI +            NDN P+F  S   ++V E+ P+G  +    A+D D   N +  Y +    K    F +R     I   +   LDFE   +Y+  +   D G     ++ ++++ + DVNDN P+F   +Y   + E            I+ V ATD D   +G V Y+  + N      F+ID +TG IF++RP  LS + +    + I A D G + +    ++ + + D     P  +     +  K              E+ P  T +  ++    D      V+ S+   + D    ++ N  N ++   L      + E++ +V++ I  +  GE P      + I++ D+N+    F  S   +SV E +     PL     HD+D  S   V  ++     +  F     +  L+L  HLD+E+       +   + G P    L++  +  + + D+NDN PV   +  + +++E     + I  + A+D D   N+ + ++ +     NV+N+       ++F I  + G I L   LDRE    Y L +LATD G P       + + VLD NDN+P++    + + +I E++  R G+V+  + A D+D   +  I Y ++  N+  F +HP+ GE+S      R+   + D+V  A D G PVRS +  + +++SD  +ND
Sbjct:  554 FQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDV-----------NDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEIC--IAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAG--IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVK--------------EDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPL------DHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPE-SAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS---LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ-KSKYEFRIEENL--RRGSVVGVVTASDLDLGENAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSD--VND 1251          

HSP 4 Score: 148.673 bits (374), Expect = 1.609e-35
Identity = 182/742 (24.53%), Postives = 317/742 (42.72%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREV---ICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFAS----------TNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSIH--DQDCTSDVIVNITDLYAR---SHFRYLQATQQLVLFSH--LDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIK--ANDSDENLNSI-VVFQKINVSNNKRGLENFRIES-------DGTIKLTKELDREKESLYYLPILATD--LGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYF 2424
            + V E+ P+ T++G + A        S +   IYS +  G       F I+  +G I+ +  +D E    +   + AT G   V            + I + D NDN P F  S + I+V ES  LG  LY  HA D DS  +G   Y L  E     F++  +    +L +   LD+E+   + L ++  D G P   ++  + +++ DVNDN P+F+K +Y   ++E   +   I+QV+A+DLD+     + Y+             ++++  + F I P +G I+L  PL  + ++ +Q  + A DNG      +T + + V D N++ P  K  +S +  +I +     S+V              +  +D D  EN  ++ S+   NS + +        + V   +      + E R+   +V+   D G   +S+   + I + D+N+  P + +     +SV+E        + +   D+D   +  +  + +  R    H  +       V+ +   LD E +S     +   + G P R  +       + + D     P     +  F + ED   G  +GSI      +D   NS+   F+ + V+     L    IE+        G + + + LDRE +S + L I A D    N   S+  T+ I V DVNDN P+W    Q+   +  S  T VGT+I    A D D  ++ ++ Y +I    +YF
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG------YFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPV-------YGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI--DARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP--KFQKSKYEFRIEENLRRGSVVG------------VVTASDLDLGENAAIRYSLLPINSSFQV--------HPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNR---PTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI----RYF 1528          

HSP 5 Score: 143.28 bits (360), Expect = 5.988e-34
Identity = 181/681 (26.58%), Postives = 299/681 (43.91%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHIT--EDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII-------------SDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            NDNPP F       NV E    GT +    A D D   N    Y L     T     + +     +     +D ET    QLT+   D G P   S+  V + I DVNDN PIF +  Y   + E+ PVG+ IL+VSA+D D     +V Y            F++   +G I +   L  + + +++F + A D G +      +I + + D+N++ P     E   +   ++  P  S      +   +T I+ +V TD D    G+V   +   N   +  +  +      + R   LS     ++   M+ IS +D G    ++   + + I+D  + P +F K+ Y+  VKE+    TV  ++  +  D    S V  +I       +F     +  + +   LD E KS +  +I+     P    +   T   I + D+NDNAP   E +   I+  E  + G+ + +  A+D D   +  V +  +  S   +GL  F I++  G + L++ LD E    + L + ATD G P LST  TI + V DVNDN P  +F  +++  +N S    +   I +++A D+D  ++  ITY I+             SD +++F + P  G + +L  P   E      L ++A DNG P    +TR+ + + D + ND
Sbjct:  498 NDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE-FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTT--AMIKMQLTDVNDNRPVFYPREYKVS---LRESPKAS------SQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRS-TGEIFVVRPDMLS---VRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP---VYGHTQVNIEVEDVNDNAPE-FEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGL--FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP--VFE-KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWI-YLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDND 1150          

HSP 6 Score: 137.117 bits (344), Expect = 5.695e-32
Identity = 201/820 (24.51%), Postives = 352/820 (42.93%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMS-------AYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICP------QLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLT------SEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIG---TPKHCSSQLVRINILDVNDNYPIFKKPKYFT------IINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN------FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM------EQFNSDW---LIMLKFNY-INNKVIYRL-VALSSANCESRKEVMVVIS--CSDSGEKPKSSTH----TIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSIH-------DQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGN-PVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINE-SIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY---FYLHPIKGELSFLTT--PRQGENI-LDIVAIDNGNPVRSNQTRLFLYISD 2562
            F V E+     ++G +S         R   E+S   ++  Y++  +  + ++  F ID  +G +  +  +DREV          L  T+     +  +T+  ++ ++       NDN P +    I + V E+TP+GT ++   ATD D+  NG  +YRL       +E   +  SL R +     L +   LDFE    Y L +   D     T +  +S  VR+ ILD ND+ P F  P           I++   +G+++  + A D DS   G + Y+    N E +  F+I+  TG I L++ L    ++      F  +I A+D+G  P   ++ + +H+    +H    +  ++ + A I+            EN P  + ++ +        EN  +   +      + F+ DW   +I  +  +   ++  Y L V +  AN +S      V     SDS     +  H    TI I + D+N+  P     S Y LSV EN+     P  IH       D+   +D+I +IT     + F    ++ +L     LD E  S     I+  ++G  ++               ++     L   T  + ED   G+++  I A D+D  +N+ +V+   N +  +  ++       G I    +LDRE ++ Y   +LATD G   V S T  + I+VLD+NDN P  IF  +    I +     + G  + ++ A+D D  ++  I Y + ++N+     F ++P  G LS   +     G+ + L++VA D GNP +S+   + L I +
Sbjct: 1372 FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADV-------NDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR--FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATIL------------ENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSE----PGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDG----QSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP--IF--ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGE 2156          

HSP 7 Score: 124.79 bits (312), Expect = 3.335e-28
Identity = 142/587 (24.19%), Postives = 244/587 (41.57%), Query Frame = 1
Query:  619 PPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWL--------IMLKFN-YINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNL--PLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT--TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW-----IFPIQNDNKINESI 2316
            PP+F  +     VKE  P GT +    A   D        Y + S      FS+  N   I   +   LD E      L +    +G P       V I + DVNDN P F+       + E   +G  +    A D DS   G V Y         K  F ID  +GH+ L + L  +      +I    +G VP+++  L I + V+D+N++ P  +  E + N                E+   N  II +  +D D+  N R+   +     D +        +   F  + N+  IY    L   + E+R    + +  +D+G     +   +++++LD N+    F KS Y   ++EN    ++   ++  D D   +  +  + L   S F+    T ++     LD E +   +  +E  ++G P R+   +     I + D+NDNAP + +P      + E+  PG+ +  ++A D D   N+ + +  +    +  G   F I+ + G I+    LD E+ S+Y L + A+D GNP   T   + + VLD+NDN P +     +F ++ D  +   +
Sbjct:  824 PPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNI--RIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL--VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVS--------------ESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL---DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRS---ARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVV 1384          

HSP 8 Score: 106.686 bits (265), Expect = 9.045e-23
Identity = 183/793 (23.08%), Postives = 335/793 (42.24%), Query Frame = 1
Query:  310 TVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVD---REVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLY-----LKHATDF--DSLDNGVGEYR-------LTSEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPK--HCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDS-----IKYGLVKY--QFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGP-VPNVNRTLITIHVK--DINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDII-FIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVAL---SSANCESRKEVMVVISCSDSGE-KPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT---------------------VSFNLPLSIHDQ----DCTSDVIVNITDLYARSHFRYL------QATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTG--TITISVLDVNDNNP-----QWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT 2466
            +V E  P  T +  + A  +   ++++I    YSI    +     LF IDPT+G+I+  + +D   R +    ++A+ G       V ++   V  +      NDN P F +S++V  V+E   LG H+      ++   D   +S++    + R       LT + +   F + R++ +++   V  +LD E    ++L +   D         S+  V+I + DVNDN P + +      ++E  PVG +I   +ATD D+     ++Y L++Y  Q   +  +A   F++D  TG + L  PL  +  + +  +++A D    V    +T +T+ ++  D N+H P        F +     G   SL  F  +     +++  IV  D+DS +NG++   +   N +     +F   +   I  LV     ++ + E      ++I   D G+ +PK S+  + + +   +  P  F ++ Y  ++ EN                      +S+ +P  + +     D    +I         S   Y+       A +Q  L S    + +SS   SI   + G H +  T   +      +  +  P         + E+++PG  I ++ A+D DE  N+ +++   +++    G   F I+S       + LDRE+ S Y L I A+D G P  S  G   ITI V D NDN P     ++   +Q D  +        GT + ++ A+D D   +  + Y + ++    F    I G+   +TT
Sbjct: 1265 SVREEQPPGTEVVRVRAVDRDHGQNASIT---YSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL------NDNRPTFTSSSLVFRVREDAALG-HVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLV---VARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPH-------FVSPNSSGGKTASL--FISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG----RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSD--SIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSC--YGLSVPENSEPGV-IHTVVASDLDEGPNADLIY---SITGGNLG-NKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQP-KSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL--------GTSVVQISAVDADLGVNARLVYSLANETQWQFA---IDGQSGLITT 2010          

HSP 9 Score: 89.7373 bits (221), Expect = 1.439e-17
Identity = 98/368 (26.63%), Postives = 157/368 (42.66%), Query Frame = 1
Query:  403 IYSIES--IGNEQVKDLFQIDPTNGIIKASLNVDREVIC-----------PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQL-VRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIML 1461
            IYSI    +GN+     F ID ++G + A   +DRE               Q  +  G C++T+ V              D+NDN P F  S    +V+E  PLGT +    A D D   N    Y L +E   + F++     +I    V  LD E   +Y   +   D G  +  S+ + V+IN+LD+NDN PIF++  Y   +      G+ +L+V A D D      + Y   + N+     F+I+P+TG +   + L+++  K     + ARD G  P  +  LI + + +     P ++    T+             V   EN+P  T ++ +V    D     +VQ S    N D ++ L
Sbjct: 1883 IYSITGGNLGNK-----FSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFV-------------EDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ-FAIDGQSGLI--TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYR------------VMLKENSPSGTRLLQVVALRSDGRRQ-KVQFSFGAGNEDGILSL 2215          

HSP 10 Score: 86.6557 bits (213), Expect = 1.187e-16
Identity = 105/417 (25.18%), Postives = 178/417 (42.69%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN---EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGR-----VQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFE 1830
            ENDN P F+    V  V E    GT +   HA D D+  N    Y +        F +    S I    + VLD E  D Y+L +   D G P+   +  +R+ I+DVNDN P F  P     ++E   +G +I  +SA D+D+  Y  + Y+  + +    E    F +D  +G + L R L  + +  ++  + A D     +  RT++T+ V D N++ P     +      I+   P  S +S  E+   + D++ +  TD DS+ N       ++ + E F+          + +N V+   ++       S  +  V I   D+G+    S+  + +Q  D     + F ++ Y   + E     ++ L +  QD   D  + I      S F  LQ ++ +VL   LD E
Sbjct: 2315 ENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNI-VLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD---AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAIL---PAISEIS--ESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSV---------HPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-GQDAL-DQSLAIIAGNEESAFELLQ-SKAIVLVKPLDRE 2707          

HSP 11 Score: 73.559 bits (179), Expect = 1.141e-12
Identity = 69/233 (29.61%), Postives = 117/233 (50.21%), Query Frame = 1
Query: 1975 ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES--DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIIS------DNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASR--SYFTLVAVV 2634
            ++E    G+ +  + A DSD   N+ + +  ++ +++      F IE    G ++    LDRE   +Y L I+ATD G P ++ T TI + ++DVNDN P   FP  N   ++E+  T +G VIT + A DVD  ++  +TY + +      +N   F L    G+L     L    Q E  LD++A D  +  R   T L + ++D++ N  +   FLA +  +YF ++  +
Sbjct: 2331 VSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP--TFPPNNLVTVSEA--TELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNAPV---FLAQQPPAYFAILPAI 2547          

HSP 12 Score: 73.559 bits (179), Expect = 1.351e-12
Identity = 126/483 (26.09%), Postives = 208/483 (43.06%), Query Frame = 1
Query: 1216 RTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSL-VSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSS-ANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD------VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPV-----LLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLT---KELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII---SDNAKYFYLHPIKGELSFLTTPR-----QGENI--LDIVAIDNGNPVRSNQTRLFLYISDKSINDGI 2583
            R L+T  VKD N++ P       TF        P  S+ + F EN P       +   D D +     + ++   N +    L  +   + V+Y  + +S   + E+     ++I   D G  P     T+ I I D+N+   +FN+S Y  +V EN       L ++  D  +D        +N         FR    T  + +   LDFETK      + ++ K      L +T    I + D+NDN P      L +  +  I+E  +PG  +  I  +D D    S   +  +NV+ N  G  +F + + D +I L      LDRE  S Y L ++ATD G P L  + +I + + DVNDN P++   + + N +        GT + ++ A D D+  ++ +TY +      +A++F + P  G    L T R     + E +  L +VA D G P  S+   + + I D + N+ I
Sbjct:  159 RVLVT--VKDENDNAP-------TF--------PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL--HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD----SKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME---VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG----LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPI 610          

HSP 13 Score: 64.6994 bits (156), Expect = 6.751e-10
Identity = 50/178 (28.09%), Postives = 82/178 (46.07%), Query Frame = 1
Query:  610 NDNPPMFANS-NIVINVKESTPLGTHLYLKHATDFDSLDNGVGE--YRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFET-CDAYQLTLSVCDIGTPKH-CSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRW--FQIDPTTG 1122
            NDN P+F  S      + E  PL   +    A D D  +    E  Y +TS      F++     V++  V + LD+++   +Y+L +  CD    +  CS Q  R+ + D NDN P F   +Y   + E+ PVG  + +  A+DLD   +G + Y      ++   W  F++D  +G
Sbjct: 2746 NDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLF--VNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG 2921          

HSP 14 Score: 62.3882 bits (150), Expect = 2.976e-9
Identity = 52/186 (27.96%), Postives = 88/186 (47.31%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL----TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINED--HPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPL 1146
            ENDN P F  +  V  + E+ P+G+ ++  HA+D D    G   Y +    + E   K F  R +     +    V D+E    Y + L   D+G  K  +S  VR+ I   ++  P F +  Y  ++      P G ++ QV+ATD DS   G V YQ ++ ++     F+++ ++G + + R L
Sbjct: 2855 ENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMF--RVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK--ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH----FKVNRSSGAVLIKRKL 3032          

HSP 15 Score: 62.3882 bits (150), Expect = 3.435e-9
Identity = 110/433 (25.40%), Postives = 185/433 (42.73%), Query Frame = 1
Query:  430 EQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLV--TXXXXXXXXXXXXXXENDNP---PMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTP------KHCSSQLVRINILDVNDNYPIF-KKPKYFTIINEDHPVGKMILQVSATDLD--SIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPL--STQYKNFQFVIEARDN---GPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFY-ENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSD---WLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTY 1659
            E  ++ F + P+NG++  S+N+ R  + P +S +SG   V ++        + +  ++ V  NDN      F  +     + E+ PLG+ + L+     D+LD  +    + +      F L  + +++   +V  LD E  D Y+L L +     P         S   V I ILD NDN+PIF +  KY   I+E  P+   I Q+ A D D  +     V Y   S N+E    F ID  TG +F+   L   +  K+++ +I A D+    P+ ++    + +H  D N++ P   +TE                V F  EN P  + +     +D D    G++  S+    SD   W  M + +  +  V    V     + E R+   + +  SD G K  S    + ++I   +EF   F + TY
Sbjct: 2582 EPAQEGFSVHPSNGVV--SVNMSR--LQPAVS-SSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGS-VVLQLGQ--DALDQSLA---IIAGNEESAFELLQSKAIV---LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDE--HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELH--DENDNEPKFPLTE---------------YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK-MFRVDSESGLVTSAFV----FDYEQRQRYDMELLASDMGGKKASV--AVRVEIESRDEFTPQFTERTY 2974          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 175.252 bits (443), Expect = 9.697e-44
Identity = 202/751 (26.90%), Postives = 332/751 (44.21%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGV-GEYRLTSEKVTKPFSL------RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPL----------STQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIV-VTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQA---TQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPV-LSTTGTITISVLDVNDNNPQ-----WIFPIQNDN---KINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF 2457
            F V E  P+ T +G +    K S +               NE  ++ F +DP  G +K ++ +DRE +            + +L +     + + I ++D NDN P F   +I I+  ES   GT L L  ATD D  +NGV  +Y + +  V   F L        + S ++LE    LD E+  +YQL +S  D G+P       V + ILDVNDN PIF    Y   +NE    G  ++ V A+D D      + Y  A T ++    F ++P TG I     +          S   K+  F + ARD+G      RT +T+++ D N+H P I            +  P+   V+  + N  N  ++  V V D DS  NGR   S+   + + L   +     +  I R+  +   + E   +  + +   D G   +++T  ++I + D+N+   VF KS YS  + E   T SF   ++  D+D   +  V+  D+ + +  ++      T  +V    LD E + ++  SI   + GP+  F  + T   + I+D ND AP   +      + ED  P + +  + A D D+  N  V F  +  S  +     F +++  G +   + LDREK S Y + ++A D G P   S T T+ ++V DVNDN+PQ     +I+ + +D+   K+ + +      ++  + A D DD  +  I Y + S     F L    G +S 
Sbjct:   71 FEVLEGQPRGTTVGFIPTKPKFSYRF--------------NEPPRE-FTLDPVTGEVKTNVVLDREGMRDHYD-------LVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ----FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISF----------RFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRT--SVRIVSGNELGHFRLEEAADLHIVRVNGV--LDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHY-DILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKF--AYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTF-ALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKE--RILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISL 775          

HSP 2 Score: 148.288 bits (373), Expect = 1.954e-35
Identity = 192/712 (26.97%), Postives = 322/712 (45.22%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARD-----------------------------------NGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM-EQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIH----DQDCTSDVIVNITDLYARSH-FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKP--GSNIGSIKANDSD-ENLNSIVVFQKINVSNNKRGLEN-FRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNK-INESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI---LDIVAIDNG-NPVRSNQTRLFLYISDKSINDGI 2583
            NDNPP+F ++    ++ E+   G  +    A D D   N    Y + S+     FSL  N     L +   LD+E    Y L +   D G P   ++  V  N+LD+NDN PIF    Y + + E+ P+   ++ VSA D+DS   GL++Y    T  +    F ID + G I   R L  ++++ +   + ARD                                   +     ++ T+ +TI +KD+N+  P             V    N++ +   EN   NT +I +   D D   NG +   M E  + D        +  N    +L  + + + E R   ++ I+  D GE P+S+   ++I+ILD N+   VF+   YS SV EN     + L +     D+     +  +I  L  ++H F   + T  + +  +L++E  S  + ++   +     N    T    I I+DINDN P  L+ P    + E+T P  G  + ++ A D+D   LNS V +        K G  + FRI  S G I L K LDRE++S Y L ++A D G+P L+ TG + + V D+NDN+P  +F +Q+ +  + E++ +  GT +    A D D+  +  + ++++ ++   F++    GE+S  TT  + E     L ++A D+     R++   L + +SD  +ND I
Sbjct: 1916 NDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSL--NPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSI--TAGDVDSEFGID-SNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVP-------------VFISANETAI--MENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIV-LGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCA-LENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFL------KEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDP--VFELQSYHATVRENLPS--GTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSD--VNDNI 2593          

HSP 3 Score: 147.132 bits (370), Expect = 4.763e-35
Identity = 172/740 (23.24%), Postives = 302/740 (40.81%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDREVICPQL-----SATSGTCSVTLLVTXXXXXXXXXXXXXX-----ENDNPPM-----FANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEK-PKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEI---INKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT--------------TFHITED------TKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGT------ITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNG 2514
            F ++P  G+I  +  V+    CPQ      SA+  +C  T+               V       ND+ P+     F +   V  V E+   GT +      D DS  NG    R+ S      F L     +  + V  VLD E    Y LT+   D GTP   ++  + I++ DVND+ P+F+K +Y  +++E  P G  +  ++ATD D+     V Y   S N    +WF +DP TG I    PL  + ++  +  I ARD GP P    T + + + D N+  P     E                V+  E+ PP T +  +  TD D   NG V  ++   + + L  L+F    + +  +L      + E   +  + +   D G   P+S+T T+ + + D+N+    F    Y  S+ ++     L   +  +     V  +  D    +   Y   +    LF  LD  +  +I+   +    ++  PH   L S           +    ++L+                 F + ED      ++P   +G ++   ++   NS + +  I         +NFRI++  G I   + LDRE+++ Y L ILA+   +   + +        + I+++D+NDN P +    +++  I+      VG  I      D D   ++ I+Y + ++  + F + P+ G L +L  P + E      ++++A D G
Sbjct:  316 FTVNPETGVISTTERVN----CPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNE--LKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQN--------------VTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP-SVERLYPLQFAL--DALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLF-QLDARS-GAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDR----AQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVL-YLQRPIRAEPGSLIHVELMATDAG 1025          

HSP 4 Score: 139.428 bits (350), Expect = 1.093e-32
Identity = 192/757 (25.36%), Postives = 323/757 (42.67%), Query Frame = 1
Query:  328 PKNTIIGDMSAYRKVSEKSSAIMKRI-YSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE---VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-----KNFQ----------------FVIEA--RDNGPVPNV-NRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEK-PKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE----NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF---HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPV---LSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVG--TVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPR 2472
            P+N  +G      +V ++ + +  RI YS+ +  N+Q    F+I P  G++     +  E   +I  +L AT            ++ ++  +      ND+ P+F +++   ++ E+T + T  +   ATD D  DNG   Y +      + F +       YL V   LD E  D Y LT+S  D G P   S   V I+++D NDN P F    +   I E+ P    + +++A D D  +   + +  +S   +    F ID   G I  +RP   +      +N +                 ++EA   DNG +P + ++  + + V D+N++ P+     + ++            V+  E     T I  +   D D   NG V  S+ + N       +FN   +    +L      + ES++   +++   D+  K P SS  +I I +LD N+    F +S+  +SV E     T       S  DQ   S V+ +I+    R  F     T  L L   LD+E  +S   +I   + G     L++T  + + ++D NDN P+   P+T     I E     + I ++ A+D D  LN  V +             +F I ++ G I   +E+DRE    + L ++ATD   P    LST   +T+ V D+NDN P  +F   N   +     T  G  T + ++HA D D  S+  +TY I+S   + F L    G ++F   P+
Sbjct:  955 PENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ----FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADV------NDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGV---FPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQD----FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNG-IPRLQDKVKVKVIVTDVNDNAPE--FLRAPYH------------VTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAG----QFNL--DSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPS--LSTTVLYNVLVVDDNDNPPIF--PSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAP--VFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQ 1667          

HSP 5 Score: 137.887 bits (346), Expect = 3.518e-32
Identity = 188/731 (25.72%), Postives = 313/731 (42.82%), Query Frame = 1
Query:  310 TVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICP-QLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVL---DFETCDAYQLTLSVCDIGTPKH---CSSQLVRINILDVNDNYPIFKK-------PKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHI-FLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINN--KVIYRLVALSSANCESRK----EVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN-----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT--TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIF-PIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN 2412
            +V E  P  T   ++  +R          + ++SI S GN   +D F ID   G +     +D E I    L+ T+  C    L T +   V ++     +NDNPP+F ++ IV  +KE  PL T +    A D DS  NG   Y ++ ++   P    + ++     V+H L   D E+ D ++LT+   D   P      + +LV + + D+NDN P+F         PK+ T           ++QV A D DS   GLV Y+  S   E    F++   TG I F   P   Q   +Q  +++ D        R    +++  I       + +   F  +   +G      S YEN P  T I+ +                +E F ++         ++    +  +L  LS+A    R+    E  V +     G +P++S   + + +LD N+ P  F  + +  +V E+     T+S    L  HD D    V   + D +    F    +T +L+L   LD ETKS     I + +       +  T ++    +   ++ P L E T  +F I E+ + G  +G I A D+D   N+ + +  ++   N    + F +    G + LT  LD E+   Y L + A D G P LSTT T+  +VLD+NDN P  IF P+   +++ E++   + T +  + A D+D  ++  I Y I + +
Sbjct: 1392 SVLETSPTGT---ELMRFRASDADQGVNSQVVFSI-SAGNR--RDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVD----DNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINT-ETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSS----TAVMQVHAKDADSSSNGLVTYEIVSGPQE---LFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDE--AVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSG------SVYENEPIGTSILTVTAH--------LASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTIST---LRAHDPDTLGSVTFLLMDGH-DGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG------VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAN----DVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAP--IFDPMSYSSEVFENV--PIATEVVTVSAKDIDSGNNGLIEYSITAGD 2070          

HSP 6 Score: 129.413 bits (324), Expect = 1.266e-29
Identity = 188/777 (24.20%), Postives = 332/777 (42.73%), Query Frame = 1
Query:  304 SFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQL----SATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIG-------------------TPKHCS---------------SQLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRW-----FQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSG-EKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLP--LSIHDQDCTSDVIVNITDLYARSH----FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHIT--EDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATD--LGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRV--GTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELS 2454
            SF + EN  +   +G + A R      +A +   Y + S   +   D+F ++P  G++  +  +D E +   +    +  +G  S++  +T+  +++++       NDN P+F   +    V E+ P+ T +    A D DS +NG+ EY +T+  V   F +  N ++        LD E    Y LT++  D                     +P+                  S  V++ IL  DVND  P+F      T I E+  +  +++ V A D D  + G + Y      +E         F ++PT G + ++  L  + ++ +   I ARD G  P    + + I + D N++ P        F+       P +   S  EN      ++ +  TD D   NGR++ S+   + +      F+   +  + R+    + N E      + +   D   E P   T  + I ILD+N+    F  S Y   V ENTV  N    L+++  D  +  + +    + +      FR   ++  + L   LD E +S    ++  ++ G     LT T    + + DINDN PV  E  ++H T  E+   G+++ + +A D DE LN+ + F  +        +  F I+S+ G I     LDRE+ S+Y+L ++A D  +  P  S+   +TISV DVNDN P++     +    N ++  R+  G  +    A+D+DD  +  + Y I   +  YF ++   G +S
Sbjct: 1928 SFDIPENAQRGYQVGQIVA-RDADLGQNAQLS--YGVVS---DWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDL-------NDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTI---RTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANE-TAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSP-------VFD-------PKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNH----DFSISEDTGVVRVA--KNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPP--LTGTGIVRVEVQDINDNDPVF-ELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLG-----EHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSV-NLTISVSDVNDNIPKF-----DSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVS 2653          

HSP 7 Score: 127.872 bits (320), Expect = 3.131e-29
Identity = 166/685 (24.23%), Postives = 301/685 (43.94%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSV--CDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDH--PVGKMILQVSATDLDSIKY-GLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMV----VISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSS----INFSIEI--INKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKE-LDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQ--GENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            ENDN P+F       +V E+  +G  +    ATD D   NG   Y +        FS+  +  V+   V   L++E    Y LT+    C +  P   +++L  INILD+NDN P F    Y   + E+   P G  +L V+A D D+      V+Y     +++    F+I+ ++G I L++PL   Q   +   + A D G  P     ++ + V+DIN++ P  ++   +++A +             EN P  T ++    TDKD   N ++     +FN     M +F +I+++       +S+A    R+E  V    +++   S  +P++S+  + I + D+N+    F+ +TY+++V E  +   F       D D   + +V+ T +  R    +   T+  V+ + L+ +TK+     + ++I I  +++G          S            P  L PT        F ++ED +PG  I  + A    + L   + +    ++    G ++ R++ + G + + ++ LD E   LY + I A D   P L +   IT++V D NDN P     I N   + E    +   +I  + A D D   + N+ Y + +D    F +       + +   R+  G+    + A+D G P  +    + L++ DK+ N
Sbjct: 2271 ENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVV--RVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELT-INILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSD---LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFEL--QSYHATV------------RENLPSGTHVLTPRATDKDEGLNAKL-----RFNLLGEHMHRF-HIDSET----GEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYT-ISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQ--------SLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYA---IAGGIMG-DSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQ---LIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDN 2909          

HSP 8 Score: 122.865 bits (307), Expect = 1.211e-27
Identity = 150/574 (26.13%), Postives = 263/574 (45.82%), Query Frame = 1
Query:  904 LVRINILDVNDNYPIF---KKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNIT--------DLYARSHF-RYLQATQQLVLF--------SHLDFETKSSINFSIEIINKGPHRNF---LXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATD--LGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNP 2520
            +V I I+D+NDN P+F   ++ +    + E+  VG+ I      D D+     + Y   S  N   + F+I P TG ++L RP+  +  +   V + A D G  P  ++  +++ + D+N+H P        F+    +T       S  E    NT    +  TD D  +NGR+   + + N++ +    F    +  ++    L   + E R    + +SC D+G+  +SS   +VI ++D N+    F  ST++ S+ EN  +  F   L+  D+D   +  ++ T         +  R+ F + L+   +  L         S  D   + S+  +  ++      N    L       + + D+NDNAP  L  P    I+E    G++I  +   D+DE LN  V +       N+ G   F ++S  G + L + LDRE + +++L ++A D  L +P LS+  +ITI VLD NDN P++    Q+ ++++    +  GT + R  A D D   ++ + + I + N +  F++  I G L +L  P   E+I    L+I A D G P
Sbjct:  927 IVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISY---SLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTP-------VFDHTSYET-------SLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERM----FGVFPDGYLFVRAPL---DREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSL--AKGNEAG--QFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHP-LSSNASITIVVLDENDNAPEF---TQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSL-YLHKPLDYEDITSYTLNITASDCGTP 1467          

HSP 9 Score: 117.857 bits (294), Expect = 4.081e-26
Identity = 207/803 (25.78%), Postives = 331/803 (41.22%), Query Frame = 1
Query:  298 PISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSAT----SGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNE--AKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPN---VNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSME---------QFNSDWLIMLKFNYINNKVIYRLVALS---SANCESR-KEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDV---IVNITDLYARSHF-RYLQATQQLVLFS---HLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQN-DNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            P   T++E   + T I     +    +    +   +Y   + GNE  +  F +D   G +     +DRE       ++  + +A     S   S+T++V             +DENDN P F  S+  ++V E++P GT L    A+D D   N    + +++      F +      +YL     LD+E   +Y L ++  D GTP   ++ L  + ++D NDN PIF        I E  P+   I+ V+A D DS   G V Y  +    +    R F I+  TG I  +R +  +    F+  + A D             L+T+ V+DIN++ P       + NA I+   P K    F  +   +T ++ +   D DS  NG V   +          Q N+  +          +V Y+L   S   +   E R  EV + I    SG    S               P    +S  S SV EN       L++     ++++   + N+T   +R    R      +L + S    LD E      + +E+          TS T   +T++D ND+ P  L+ P  ++++ED + G  I +++A+D D  L S V F  ++  + K  LE     S G + L   LDRE +S Y L I  +D    V  T    TI V D NDN P +   + + D   N     +VG ++ R    D D   +  ++Y ++SD A   F L+P  G L+    L        IL + A DNG P  S  T + +Y +   +ND
Sbjct: 1282 PYHVTISEGASEGTHI----THVFTQDADEGLNGDVYYSLAKGNEAGQ--FNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVV-------------LDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLH--KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVF----VSMNAAIL---PPK----FSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESS--------------VPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPE-EYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD-TLGS-VTFLLMDGHDGKFLLE----PSTGKLILNDTLDRETKSKYELRIRVSD---GVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVAR----DADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLS--TTITVYCNVLDLND 2022          

HSP 10 Score: 113.62 bits (283), Expect = 7.475e-25
Identity = 167/654 (25.54%), Postives = 274/654 (41.90%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKEST--PLGTHLYLKHATDFDS--LDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGL-VKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPV-PNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWL-IMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP--AVFNKSTYSLS--VKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQL-VLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW--IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNG 2514
            NDN P F +S  +  V E+T  P G ++   +A D D+  L++ V  Y L   K       R N S   + ++  LD E    Y LTL   D G+P    + +VR+ + D+NDN P+F+   Y   + E+ P G  +L   ATD D    GL  K +F        R F ID  TG I     L  +  + +   + A+D+    P  +   +TI V D+N++ P  K   +T+N            V+  E       +      D D  EN  V  ++   +  +  I  K   ++ K+  +    S  +        +VIS  D GE+  SS   + + +     FP  A    S +++S  V+   +   +  +   +     +   I         R    +  L V    LD+E        IE  +       L S T   + + D NDNAPV+ +      + E+  P   I  +KA+D D   N  V+++   + N+  G   F I   G I     LDRE+   Y   + A D G P ++ T ++ + +LD NDN P++  +F       +N +    +G+ + R+ + D+D  ++ N +Y    +  + F + P  G ++    L   +Q E IL +VA D  
Sbjct: 2378 NDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQV-RYFL---KEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDE---GLNAKLRFNLLGEHMHR-FHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIP--KFDSTTYN------------VAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDL----TYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADG--DTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYR---LQNDFDG--TFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLF------SLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGA 2992          

HSP 11 Score: 110.538 bits (275), Expect = 6.447e-24
Identity = 171/670 (25.52%), Postives = 280/670 (41.79%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHT---IVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARS----HFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSD-ENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVD-DLSHTNITYHIISDNAK-YFYLHPIKGELSFLTT-PRQGENILD--IVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            ++NPP F  +  +  + +    G  +   HA D   L     +Y L +  ++  FS+  +   I L  V  +       Y+L +   D G P       V I +   N + P F    Y  I+ E+ PVG  IL V ATD D+   G+++Y  +  N   ++ F +D  TG I + + L     + +   I  +D G  P  +  ++TI + D+N++ P        FN K       +      EN P  T +      DKDS +N  +  +      D     +  +I N+    + +  S + E R+   + I      + P SS  +   + + +L +NEF   F +  +   V E +       ++   D  S     +  L   S     FR    T  + +  HLD ET++ +  ++   N G  R   T      I+I D ND    +    T  I+E    G+ + ++KA D D    N+   +  IN  N K   ++F+I+   G I     LDRE+ S Y L I A D G P  + + T+ I + DVNDN P +  P   +  I+E+     GT I  L A D D   +    TY +I    K +  +    G +   T+  R+   IL+  I   D+G P + +Q  L + + D++ N
Sbjct: 3118 HNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITL--VKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNE--RQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPP-------VFNHK-------EYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPD-----RHFFIMNQSNGTISSAVSFDYEERRIYTLQIKA----KNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIIN-GNLK---QSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFT-PEGLNGYISEN--EPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 12 Score: 107.842 bits (268), Expect = 5.107e-23
Identity = 137/563 (24.33%), Postives = 245/563 (43.52%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQ-FVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSST--HTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIH--DQDCTS---DVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDN 2262
            EN + P F+ ++  + V E+ P+G+ +    ATD D+  NG+  Y ++     + FS+      I ++    LD++    Y L ++V D+G     S  ++ I + DVNDN P+F   +Y   I E+ PVG  + Q  A D DS K  ++ Y F  +  + + +F ++ + G I     +S  Y+  + + ++ +   P  ++     + +HV  +N  YP  +  +  F+  + +T    S V         T +  +  TDKDS E+GRV   +   ++D    +     N  +IY    L   + E++  V++ +   + G    + T    ++I I D N+ P  F K  Y+ ++ E         ++   D+D  +       +I +   +  F+    T ++   S LD E  S+ N  I  I+ G  P     T          +     P   E    +I+E+   G++I ++ A+D D   N      ++    +K  L   R  + G ++ T   DRE   +    I   D G P   +   +TI+VLD NDN
Sbjct: 3222 ENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQ--QQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPD-RHFFIMNQSNGTIS--SAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYP--QFLQPVFHFDVSET----SAV--------GTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRID---TNTGLIYVARHL---DRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTP---EGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDR--NSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 13 Score: 98.9821 bits (245), Expect = 2.619e-20
Identity = 184/758 (24.27%), Postives = 324/758 (42.74%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDRE---------------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCD--AYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFK--KPKYFTIINEDHPVGKMILQVSATDLDSIKYGLV-KYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK---NFQFVIEARDNGPVPNVNR-TLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSME-QFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSH-----FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEP-TTFHITEDTKPGSNIGSIKANDSD-ENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELD-------REKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP-----QWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            F ID   G I  +  +DRE               +  P+ S+ + T SV+ +                 NDN P F ++   + V E    G  ++   A D D  +N V  Y + S +    F +     V+  ++      ++ D   Y + +S  D G  +  SS+     IL   + +P F      +F + +ED   GKMI +VSAT   S K GLV K ++A          ++DP +G +  +      Y+    ++  IEA D G  P++   TLIT++V D N++ P ++  +  +NA++++           E +PP   I  +  +D+DS +NG V   ++  F+        F    +  IY  + L   + E   +   V+   D G    + T ++++ +LD N+ P  F +  +SL+V EN    +  + +   D   D+  N    Y+ S      FR    +  + +  HLD E +      + + + G  R    + T   ITI D NDNAP       +F   E  +  + +G I A D D +  NS++ +     S        F I+ + G +   K +        R  E++Y L +LATD G P L +   + I+++D ++N P     +++ P+  D           G  I R+HA D  DL    + Y +++ N +  F +    G ++    +  P      L + A D G P +S++TR+ + ++ ++++
Sbjct: 2538 FHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDV-----------------NDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-SGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGE-QSLSSKAELTVILRPPELFPTFAYMANSHFAM-SEDVRPGKMITKVSAT---SPKKGLVGKIRYAIAGGIMGDSLRVDPNSG-LLSVGQDGLDYELTHLYEIWIEAAD-GDTPSLRSVTLITLNVTDANDNAPVME--QLIYNAEVLE-----------EESPPQL-IAVVKASDRDSGDNGNVIYRLQNDFDG------TFEITESGEIYTRMRL---DREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDL--DLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKV-VASDGAWR----AETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS------PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQD--------AVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMD 3225          

HSP 14 Score: 97.0561 bits (240), Expect = 1.011e-19
Identity = 132/518 (25.48%), Postives = 221/518 (42.66%), Query Frame = 1
Query:  313 VTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVD---REVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKH--CSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGR---VQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKS 1839
            + EN P  T +    A  K S K++ I    Y+    G +  +  F ++ +NG I ++++ D   R +   Q+ A +   S+     +   ++ +       N+  P F       +V E++ +GT +    ATD DS ++G   Y L      K F +  N  +IY  V   LD ET +   LT+   + G+ +        V I+I D ND  P F K  Y + I+E  PVG  +  V A D D ++    ++ ++  N   K+ F+ID  TG I     L  +  + +  VI A D G  P      + I ++D+N++ P    T    N  I             EN P  T I+ ++ +D D   NG     Q    +  S WL + +    N+ V+    + +S + E    +  +I   DSG+  + S H + I +LD N+ P+    +T SL +  +  + +LP ++   D   + I  + D   R      Q+  QL +    D  T S
Sbjct: 3343 IPENKPVGTFVFQAHAADKDSPKNAIIH---YAFLPSGPD--RHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGV-------NEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIY--VARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP-PEFIKHYYTSTISEAAPVGTKVTTVKAIDKD-VRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGP--TFTPEGLNGYIS------------ENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKS-WLSVDR----NSGVVR---STTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPS----TTRSLHIAVSLFNGDLPSNVKLADVRPNDIDIVGDYRCRLQKNPAQSQLQLAIPRACDLITTS 3818          

HSP 15 Score: 87.0409 bits (214), Expect = 8.849e-17
Identity = 168/726 (23.14%), Postives = 295/726 (40.63%), Query Frame = 1
Query:  610 NDNPPMFANSNIVI-NVKESTPLG--THLYLKHATDFDSLDNGVGEYRLTSEKVTKP---FSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINIL-----DVNDNYPIF-KKPKYFTIINEDHPVGKMILQVSATDLDS-IKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIE--ARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFN-AKIVKTGPNKSLVSFYENNPPNT--DIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDC----TSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF--HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPV------------------------------------LSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITY--------HIISDNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            NDN P+F + N  I   K ST  G  T +   HA D DS  NG+    +T E V+ P   F L+ N  +I         F+    YQLTL   D        S  V I I+         + P F ++ K    + E+ P+G  IL V+A    + I+Y +       +  +  R F ID   G +     L  +    ++ +E  A   G  P  +RT + + V D N+  P    T   +N ++ ++ G   S +  ++   P+T   + F+++   D                         ++      +L+   + + E++ +  + I  SD  +  ++      IQ+ D N+ P +F  + YS  + EN         I  +D      + +   +   +A   F     T  L L + LD+E        ++  + G  +  L++T + +  ++D+NDNAP+  +P ++   + E+    + + ++ A D D   N ++ +  I   +       F I+S+GTI+  + LDRE  S Y L + A D  +                                      LS+T  +TI + DVND  P  +F   N+  I E++   + TV+  + A+D D+  +  I Y         +   +   F L+P  G+L     L    +   +L+I A D G P +S +++L + I D++ N
Sbjct: 1595 NDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGL----VTYEIVSGPQELFKLQRNTGIITF--TPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHD---PDTLGSVTFLLMDGHDG-----------------------KFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYA---TIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNG--QPSLSTTITVYCNVLDLNDNAPIF-DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEY-SITAGDVD---SEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVP--VFISANETAIMENV--AINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDN 2274          

HSP 16 Score: 83.1889 bits (204), Expect = 1.665e-15
Identity = 164/682 (24.05%), Postives = 273/682 (40.03%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYG---LVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFV----------IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFN----------SDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN--TVSFNLPLSIHDQDCTSDVIV--NITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH--ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI--ESDGTIKLTKELDREKESLYYLPILATDLGNP--VLSTTGTITISVLDVNDNNPQWIFPI-QNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII-SDNAKYFYLHPIKGEL---SFLTTPRQGENILDIVAIDNGNPVRSNQT 2538
            +NDNPP F      +NV E+  +G+ +    ++D D   N    Y  +     K    R       + V   LD E  D Y L +   D G  +  +   + I I D NDN P F+   Y     E      ++ Q+ ATD D  K G   ++ Y       +    F IDP TG +F  +  + ++K+ Q+V          + A DNG  P  +  L+ I++ D +N+ P  +  E               L    ++      I+ +   DK       +  S+  FN            W+ ++K   +     Y L                V+  +D G  P+S    +VI +   N     F+ ++Y + V EN    S  L +   D D   + ++  +I+    R  F   + T  +V+   LD++     + +I + + G H   L+S     I + D+NDN PV      +H  I E+   G+ +    A D D   N+I+ +  +    ++    +F I  +S+GTI      D E+  +Y L I A    NP   + +   + + VL VN+  PQ++ P+   D     ++ TRVG V     A D D      + Y ++ S N K F +    G +     L    Q   +L ++A + G+ +R N T
Sbjct: 2906 KNDNPPKFTRL-FSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEK---FRIEPQSGNITVAGHLDREQQDEYILKVVASD-GAWR--AETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRD--KQGPNSVISYSL----QQPSPMFSIDPATGEVFSKK--AVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAE--------------YLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYEL----------------VVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHP--LSSVAMLTIILTDVNDNPPV-FNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDR----HFFIMNQSNGTISSAVSFDYEERRIYTLQIKAK---NPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAV----QATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGS-IRGNDT 3527          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 172.555 bits (436), Expect = 7.019e-43
Identity = 193/715 (26.99%), Postives = 316/715 (44.20%), Query Frame = 1
Query:  406 YSIESI------GNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXX----------ENDNPPMFANSNIVINVKESTPLGTH---LYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----------ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLEN--FRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIY----TRVGTVITRLHAIDVDDLSHTNITYHII-SDNAKYFYL 2430
            Y IE++        +Q   +F+ID  +G+I    ++DRE           + S  LLVT  +                     +NDN P F+     + V E    GT    +    ATD D  +N    Y +        FS+      + L  V  LD+E+  +Y+L +   D G+P   ++  + +N++D NDN P F   ++   + E+ PVG  I++V A D D      + Y  +  ++       +DP TG +  I+PL  + +  F F + A+D G  P    + + I V+D+N++ P        FN K  +        +  E+ PP T +  +  TD   DE+ R+   +   N+      +F   +      +    S + +  K  ++ ++ +DSG   +S T T+ I I D N F  +F  + YS SV E+       L +   D  SDV VN           I  L +   F     T  +V  + LD ET S    ++   + G     L+ TT   I + D+NDNAP    P     I ED   G+++  + A+D D  LN      +I    + R +E+  F I+ + GTI+  K LDRE  ++++L  +A D G+P LS+T  + I + DVND+ P +       +KI  ++Y    + VG+V+  +HA D D+  +  + Y II  D++  F L
Sbjct:  501 YGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET----------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL--VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDP-------AFNPKYYE-------ANVGEDQPPGTPVTTVTATDP--DEDSRLHYEITTGNT----RGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATD--SDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG--NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNG-----RIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA-----SDKI--TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 2 Score: 164.466 bits (415), Expect = 2.109e-40
Identity = 189/762 (24.80%), Postives = 332/762 (43.57%), Query Frame = 1
Query:  403 IYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSL---------RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTP---KHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVG---KMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIVNITDLYARSHFRYL-QATQQLVLFSH-LDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL-EPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLEN-FRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN---AKYFYLHPIKGEL-SFLTTPRQGENI--LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +YS+ S+ + + + LF++D   G++  S ++DRE        V+    S    + + TL V +++            ND+ P F       +++E   +G+ +    ATD D   N   EY +  E VT    L         R +     +     LD ET D+Y L ++  D+ +    +  ++  V++ +LD NDNYP F +  Y   + ED   G     +  + ATD D      ++Y     N +++  F ID  +G + L++PL  +  ++++ VI A+D G     N T + ++V D N++ P  +   S F   ++            EN P   +II +   D D   N  +  S+ + + ++ + +       + I  L      + E +      +   D G  PKS++ ++VI + D+N+    FN   Y  +V E+         ++  D D  S +   IT    R  F    Q  + L+  +  LD++ +     ++   + G   +    T +  I I D N+ AP+    P +  + ED   G+ +  + A DSD  +N+ + +     S N  G  + F I    G I     LDRE  S Y L + A D GNP LS T  + I V DVNDN P +  P+   + + +++   VGT + ++ A D D   +  I Y ++SD       F + P  G + +     R+   +  L  +A+D G+P  S+   + + + D  +ND
Sbjct:  392 VYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDC-----------NDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ--FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVL------------ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPL------DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD----TATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL---VGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED--VND 1108          

HSP 3 Score: 98.5969 bits (244), Expect = 2.669e-20
Identity = 148/692 (21.39%), Postives = 268/692 (38.73%), Query Frame = 1
Query:  622 PMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRW-------FQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTL---ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRV-----------QCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT-VSFN-LPLSIHDQD--CTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIY--TRVGTVITRLHAIDVDDLSHTNITYHIISD------NAKYFYLHPIKGELSFLTTPRQGEN----ILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            P F  +  V +V E  P G  +    A D +          L   +    F +     V+       LD E  D +   +   D   P    +  +++N+LD ND+ P F+  ++   I E   VG  ++ + ATD D  K   ++Y   +  + A          F+ID  +G I     L  +  + +  ++ A D     +  RT    + + V D N++YP  + +E T+  ++    P        +N      +  I  TD D   N  +           Q S++  + D  ++   +Y                 ES +   +VI   D G   +S+T  +++ ++D N+    F  S +  SV EN  V +N + +  +D D    +++  +I++            T  +     LD E +    F +   + G  P     +   +      +     P   E    ++ ED  PG+ + ++ A D DE+     +  +I   N +           G I + + LD ++E  + L + ATD G    S T T+ I++ D N+       PI  +   + S++    VGT +  + A D D   +  ITY +  +      +   F ++P  G +     P   E     +L + A D GNP  S+ T + + ++D  +ND
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSAS--LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP--QFSERTYTVQV----PEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDY-----------------ESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA---NVGEDQPPGTPVTTVTATDPDEDSR---LHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANN-----FAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTD--VND 1002          

HSP 4 Score: 90.5077 bits (223), Expect = 9.286e-18
Identity = 134/575 (23.30%), Postives = 255/575 (44.35%), Query Frame = 1
Query:  925 DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDS--IKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQ-FVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIM----LKFNYINNK--VIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--------NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH--ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD---GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTP------RQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            ++ +  P F++  Y   + E+ P G  +  V A D +   + Y +V       ++ ++  F++D  TG +     L  +  +   F + A D+   P    T + ++V D N+H P       TF A+  +        S  E     + +I +  TD+D  +N  ++  +E       +     +    I+++  VI    +L     +S   ++     + +  + +++T ++ +++LD N+    F++ TY++ V E        NTV+ ++  +  DQ   + +   I     +S F     +  + L   LD+E+  S    I   + G P R+   +TT   + +ID NDNAP     + F   + E+   G NI  ++A DSDE  N+     +I  S ++R  +NF +  D   G ++  K LDRE++  +   ++A D G P  S + ++ I+V DVNDN+P +  P   +  + E      GT +T + A D D+ S   + Y I + N +  +    +     +T        ++   +L + A D+G   RS+   + + I+D
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSL----LDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP-------TFEAEQFE-------ASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVA-HIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRS---NTTQLLVNVIDANDNAPRFYT-SQFQESVLENVPVGYNIIRVQAYDSDEGANA-----EITYSISERD-DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-NPKYYEANVGED--QPPGTPVTTVTATDPDEDSR--LHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITD 889          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 172.555 bits (436), Expect = 7.019e-43
Identity = 193/715 (26.99%), Postives = 316/715 (44.20%), Query Frame = 1
Query:  406 YSIESI------GNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXX----------ENDNPPMFANSNIVINVKESTPLGTH---LYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----------ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLEN--FRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIY----TRVGTVITRLHAIDVDDLSHTNITYHII-SDNAKYFYL 2430
            Y IE++        +Q   +F+ID  +G+I    ++DRE           + S  LLVT  +                     +NDN P F+     + V E    GT    +    ATD D  +N    Y +        FS+      + L  V  LD+E+  +Y+L +   D G+P   ++  + +N++D NDN P F   ++   + E+ PVG  I++V A D D      + Y  +  ++       +DP TG +  I+PL  + +  F F + A+D G  P    + + I V+D+N++ P        FN K  +        +  E+ PP T +  +  TD   DE+ R+   +   N+      +F   +      +    S + +  K  ++ ++ +DSG   +S T T+ I I D N F  +F  + YS SV E+       L +   D  SDV VN           I  L +   F     T  +V  + LD ET S    ++   + G     L+ TT   I + D+NDNAP    P     I ED   G+++  + A+D D  LN      +I    + R +E+  F I+ + GTI+  K LDRE  ++++L  +A D G+P LS+T  + I + DVND+ P +       +KI  ++Y    + VG+V+  +HA D D+  +  + Y II  D++  F L
Sbjct:  501 YGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET----------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL--VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDP-------AFNPKYYE-------ANVGEDQPPGTPVTTVTATDP--DEDSRLHYEITTGNT----RGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATD--SDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG--NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNG-----RIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA-----SDKI--TLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 2 Score: 164.466 bits (415), Expect = 2.109e-40
Identity = 189/762 (24.80%), Postives = 332/762 (43.57%), Query Frame = 1
Query:  403 IYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSL---------RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTP---KHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVG---KMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIVNITDLYARSHFRYL-QATQQLVLFSH-LDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL-EPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLEN-FRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN---AKYFYLHPIKGEL-SFLTTPRQGENI--LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +YS+ S+ + + + LF++D   G++  S ++DRE        V+    S    + + TL V +++            ND+ P F       +++E   +G+ +    ATD D   N   EY +  E VT    L         R +     +     LD ET D+Y L ++  D+ +    +  ++  V++ +LD NDNYP F +  Y   + ED   G     +  + ATD D      ++Y     N +++  F ID  +G + L++PL  +  ++++ VI A+D G     N T + ++V D N++ P  +   S F   ++            EN P   +II +   D D   N  +  S+ + + ++ + +       + I  L      + E +      +   D G  PKS++ ++VI + D+N+    FN   Y  +V E+         ++  D D  S +   IT    R  F    Q  + L+  +  LD++ +     ++   + G   +    T +  I I D N+ AP+    P +  + ED   G+ +  + A DSD  +N+ + +     S N  G  + F I    G I     LDRE  S Y L + A D GNP LS T  + I V DVNDN P +  P+   + + +++   VGT + ++ A D D   +  I Y ++SD       F + P  G + +     R+   +  L  +A+D G+P  S+   + + + D  +ND
Sbjct:  392 VYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDC-----------NDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ--FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVL------------ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPL------DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD----TATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL---VGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED--VND 1108          

HSP 3 Score: 98.5969 bits (244), Expect = 2.669e-20
Identity = 148/692 (21.39%), Postives = 268/692 (38.73%), Query Frame = 1
Query:  622 PMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRW-------FQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTL---ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRV-----------QCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT-VSFN-LPLSIHDQD--CTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIY--TRVGTVITRLHAIDVDDLSHTNITYHIISD------NAKYFYLHPIKGELSFLTTPRQGEN----ILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            P F  +  V +V E  P G  +    A D +          L   +    F +     V+       LD E  D +   +   D   P    +  +++N+LD ND+ P F+  ++   I E   VG  ++ + ATD D  K   ++Y   +  + A          F+ID  +G I     L  +  + +  ++ A D     +  RT    + + V D N++YP  + +E T+  ++    P        +N      +  I  TD D   N  +           Q S++  + D  ++   +Y                 ES +   +VI   D G   +S+T  +++ ++D N+    F  S +  SV EN  V +N + +  +D D    +++  +I++            T  +     LD E +    F +   + G  P     +   +      +     P   E    ++ ED  PG+ + ++ A D DE+     +  +I   N +           G I + + LD ++E  + L + ATD G    S T T+ I++ D N+       PI  +   + S++    VGT +  + A D D   +  ITY +  +      +   F ++P  G +     P   E     +L + A D GNP  S+ T + + ++D  +ND
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSAS--LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP--QFSERTYTVQV----PEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDY-----------------ESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA---NVGEDQPPGTPVTTVTATDPDEDSR---LHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANN-----FAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTD--VND 1002          

HSP 4 Score: 90.5077 bits (223), Expect = 9.286e-18
Identity = 134/575 (23.30%), Postives = 255/575 (44.35%), Query Frame = 1
Query:  925 DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDS--IKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQ-FVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIM----LKFNYINNK--VIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--------NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH--ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD---GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTP------RQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            ++ +  P F++  Y   + E+ P G  +  V A D +   + Y +V       ++ ++  F++D  TG +     L  +  +   F + A D+   P    T + ++V D N+H P       TF A+  +        S  E     + +I +  TD+D  +N  ++  +E       +     +    I+++  VI    +L     +S   ++     + +  + +++T ++ +++LD N+    F++ TY++ V E        NTV+ ++  +  DQ   + +   I     +S F     +  + L   LD+E+  S    I   + G P R+   +TT   + +ID NDNAP     + F   + E+   G NI  ++A DSDE  N+     +I  S ++R  +NF +  D   G ++  K LDRE++  +   ++A D G P  S + ++ I+V DVNDN+P +  P   +  + E      GT +T + A D D+ S   + Y I + N +  +    +     +T        ++   +L + A D+G   RS+   + + I+D
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSL----LDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSP-------TFEAEQFE-------ASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVA-HIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRS---NTTQLLVNVIDANDNAPRFYT-SQFQESVLENVPVGYNIIRVQAYDSDEGANA-----EITYSISERD-DNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF-NPKYYEANVGED--QPPGTPVTTVTATDPDEDSR--LHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITD 889          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 222.631 bits (566), Expect = 3.059e-59
Identity = 210/756 (27.78%), Postives = 349/756 (46.16%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKR---IYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTCS----VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTP 2469
            + + E   +N +IG++     +S  +SA       +Y + S   +    L ++    G I   S  +DRE +CP  S     CS    V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  N V +Y L + +       V  P   ++      L V   LD E  D Y + + V D G P+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      +KY F +  + A +R F ++ TTG I + RPL  +     +  + A D    P   R  ITI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   D    LK  Y N    Y L   +  + E  KE +  I  SDSG+   + T  + +++ D N+ P +F +    L+V EN +   F   +S  D+D   +  + +  L   + F               D + K+ +  +  + ++     FL + T+       +   A V++         P        F ++E+    S +G I   D+D   N++V   ++++ N+    ENF ++ D G IK     DRE++S Y   + A D G+P  S+   +TI+V+DVNDN P  I+P  N +     +    G+V+  + A+D D   +  + Y I+S N +  F + P+ G ++    P
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGD--TPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR--------YIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEK---DVPFHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEI-VYQLGPNASF--------------FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVV---RLSILNDN---ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKP 740          

HSP 2 Score: 95.5153 bits (236), Expect = 2.237e-19
Identity = 115/459 (25.05%), Postives = 195/459 (42.48%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPP------MFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYL-EVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE 1629
            I   + EN P  T +  + A       ++A +K ++  +   +   + LF ++ T G+I     +DRE        V+    S++    ++T+ VT +             NDN P      + + +N  + + E  P+ T + L   +D D+  NG  +     EK   PF L+      YL E   +LD+E    Y   +   D G P    + LVR+ + D NDN PIF +P     + E++     +  +SATD DS +   + YQ          +F +D  TG +   R     + + F F + ARDNG     ++  + + + D N++ P  K T + F          +  VS  EN P  + +  I VTD D+ EN  V+ S+   N ++++      I + V +     SS   + R          D+G  P SS   + I ++D+N+
Sbjct:  256 IEVHIPENSPVGTSVVQLQA-TDADVGANAEIKYMFGAQV--SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDV-------------NDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNG--KVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSP--KFTHNHF----------QFFVS--ENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVR--------AVDNGSPPCSSAAKVTINVIDVND 669          

HSP 3 Score: 70.4774 bits (171), Expect = 1.217e-11
Identity = 145/608 (23.85%), Postives = 244/608 (40.13%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCE-------SRKEVMV---VISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN--------KSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITD-----LYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+    + KY+  +  +          E ++W Q+        + + L  + K+ +   ++  D G     +  ++ + V D+N++ P  K  ES     I             EN+P  T ++ +  TD D   N  ++               F    +    RL AL++            R+E  +    +  SD    P  +T  I I + D+N+     +          T  LS K+  NT    + +S  D D    VI  I       L A    +YL  T  L     LD+E      F I   + G  +  L  T    + + D NDN P+  +P     + E+      + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G   L +   + +++LD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +   I++DN + F L P    IK  +SF    +Q     D+ A+DNG+P  S+  ++ + + D  +ND
Sbjct:  123 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK--ESQIEVHIP------------ENSPVGTSVVQLQATDADVGANAEIK-------------YMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSAL-----LDYEGTKEYIFKIVASDSG--KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENAVVRLSILNDN-ENFILDPDSGVIKSNVSF-DREQQSSYTFDVRAVDNGSPPCSSAAKVTINVID--VND 669          

HSP 4 Score: 68.5514 bits (166), Expect = 4.465e-11
Identity = 77/288 (26.74%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPK---YFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL 1134
            I   V EN  ++  +  +SA  + S +++ I+ ++    S         F +D   G++ AS   DRE        +  + + T    S   ++  + D          ENDN P F +++    V E+ P  + + +   TD D+ +N V   RL+     + F L  +  VI   V    D E   +Y   +   D G+P   S+  V IN++DVNDN PI   P     F ++      G ++ +V A D D+     +KY   S N   +  F+IDP TG+I L
Sbjct:  473 IELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAV--VRLSILNDNENFILDPDSGVIKSNVS--FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGN--VRSLFRIDPVTGNITL 736          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 222.246 bits (565), Expect = 5.633e-59
Identity = 210/756 (27.78%), Postives = 349/756 (46.16%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKR---IYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTCS----VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTP 2469
            + + E   +N +IG++     +S  +SA       +Y + S   +    L ++    G I   S  +DRE +CP  S     CS    V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  N V +Y L + +       V  P   ++      L V   LD E  D Y + + V D G P+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      +KY F +  + A +R F ++ TTG I + RPL  +     +  + A D    P   R  ITI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   D    LK  Y N    Y L   +  + E  KE +  I  SDSG+   + T  + +++ D N+ P +F +    L+V EN +   F   +S  D+D   +  + +  L   + F               D + K+ +  +  + ++     FL + T+       +   A V++         P        F ++E+    S +G I   D+D   N++V   ++++ N+    ENF ++ D G IK     DRE++S Y   + A D G+P  S+   +TI+V+DVNDN P  I+P  N +     +    G+V+  + A+D D   +  + Y I+S N +  F + P+ G ++    P
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGD--TPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR--------YIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEK---DVPFHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEI-VYQLGPNASF--------------FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVV---RLSILNDN---ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKP 740          

HSP 2 Score: 95.1301 bits (235), Expect = 3.312e-19
Identity = 115/459 (25.05%), Postives = 195/459 (42.48%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPP------MFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYL-EVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE 1629
            I   + EN P  T +  + A       ++A +K ++  +   +   + LF ++ T G+I     +DRE        V+    S++    ++T+ VT +             NDN P      + + +N  + + E  P+ T + L   +D D+  NG  +     EK   PF L+      YL E   +LD+E    Y   +   D G P    + LVR+ + D NDN PIF +P     + E++     +  +SATD DS +   + YQ          +F +D  TG +   R     + + F F + ARDNG     ++  + + + D N++ P  K T + F          +  VS  EN P  + +  I VTD D+ EN  V+ S+   N ++++      I + V +     SS   + R          D+G  P SS   + I ++D+N+
Sbjct:  256 IEVHIPENSPVGTSVVQLQAT-DADVGANAEIKYMFGAQV--SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDV-------------NDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNG--KVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSP--KFTHNHF----------QFFVS--ENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVR--------AVDNGSPPCSSAAKVTINVIDVND 669          

HSP 3 Score: 70.0922 bits (170), Expect = 1.491e-11
Identity = 145/608 (23.85%), Postives = 244/608 (40.13%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCE-------SRKEVMV---VISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN--------KSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITD-----LYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+    + KY+  +  +          E ++W Q+        + + L  + K+ +   ++  D G     +  ++ + V D+N++ P  K  ES     I             EN+P  T ++ +  TD D   N  ++               F    +    RL AL++            R+E  +    +  SD    P  +T  I I + D+N+     +          T  LS K+  NT    + +S  D D    VI  I       L A    +YL  T  L     LD+E      F I   + G  +  L  T    + + D NDN P+  +P     + E+      + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G   L +   + +++LD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +   I++DN + F L P    IK  +SF    +Q     D+ A+DNG+P  S+  ++ + + D  +ND
Sbjct:  123 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK--ESQIEVHIP------------ENSPVGTSVVQLQATDADVGANAEIK-------------YMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSAL-----LDYEGTKEYIFKIVASDSG--KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENAVVRLSILNDN-ENFILDPDSGVIKSNVSF-DREQQSSYTFDVRAVDNGSPPCSSAAKVTINVID--VND 669          

HSP 4 Score: 68.1662 bits (165), Expect = 5.652e-11
Identity = 77/288 (26.74%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPK---YFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL 1134
            I   V EN  ++  +  +SA  + S +++ I+ ++    S         F +D   G++ AS   DRE        +  + + T    S   ++  + D          ENDN P F +++    V E+ P  + + +   TD D+ +N V   RL+     + F L  +  VI   V    D E   +Y   +   D G+P   S+  V IN++DVNDN PI   P     F ++      G ++ +V A D D+     +KY   S N   +  F+IDP TG+I L
Sbjct:  473 IELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAV--VRLSILNDNENFILDPDSGVIKSNVS--FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGN--VRSLFRIDPVTGNITL 736          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 222.246 bits (565), Expect = 5.633e-59
Identity = 210/756 (27.78%), Postives = 349/756 (46.16%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKR---IYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTCS----VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTP 2469
            + + E   +N +IG++     +S  +SA       +Y + S   +    L ++    G I   S  +DRE +CP  S     CS    V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  N V +Y L + +       V  P   ++      L V   LD E  D Y + + V D G P+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      +KY F +  + A +R F ++ TTG I + RPL  +     +  + A D    P   R  ITI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   D    LK  Y N    Y L   +  + E  KE +  I  SDSG+   + T  + +++ D N+ P +F +    L+V EN +   F   +S  D+D   +  + +  L   + F               D + K+ +  +  + ++     FL + T+       +   A V++         P        F ++E+    S +G I   D+D   N++V   ++++ N+    ENF ++ D G IK     DRE++S Y   + A D G+P  S+   +TI+V+DVNDN P  I+P  N +     +    G+V+  + A+D D   +  + Y I+S N +  F + P+ G ++    P
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGD--TPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR--------YIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEK---DVPFHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEI-VYQLGPNASF--------------FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVV---RLSILNDN---ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKP 740          

HSP 2 Score: 95.1301 bits (235), Expect = 3.312e-19
Identity = 115/459 (25.05%), Postives = 195/459 (42.48%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPP------MFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYL-EVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE 1629
            I   + EN P  T +  + A       ++A +K ++  +   +   + LF ++ T G+I     +DRE        V+    S++    ++T+ VT +             NDN P      + + +N  + + E  P+ T + L   +D D+  NG  +     EK   PF L+      YL E   +LD+E    Y   +   D G P    + LVR+ + D NDN PIF +P     + E++     +  +SATD DS +   + YQ          +F +D  TG +   R     + + F F + ARDNG     ++  + + + D N++ P  K T + F          +  VS  EN P  + +  I VTD D+ EN  V+ S+   N ++++      I + V +     SS   + R          D+G  P SS   + I ++D+N+
Sbjct:  256 IEVHIPENSPVGTSVVQLQAT-DADVGANAEIKYMFGAQV--SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDV-------------NDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNG--KVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSP--KFTHNHF----------QFFVS--ENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVR--------AVDNGSPPCSSAAKVTINVIDVND 669          

HSP 3 Score: 70.0922 bits (170), Expect = 1.491e-11
Identity = 145/608 (23.85%), Postives = 244/608 (40.13%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCE-------SRKEVMV---VISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN--------KSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITD-----LYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+    + KY+  +  +          E ++W Q+        + + L  + K+ +   ++  D G     +  ++ + V D+N++ P  K  ES     I             EN+P  T ++ +  TD D   N  ++               F    +    RL AL++            R+E  +    +  SD    P  +T  I I + D+N+     +          T  LS K+  NT    + +S  D D    VI  I       L A    +YL  T  L     LD+E      F I   + G  +  L  T    + + D NDN P+  +P     + E+      + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G   L +   + +++LD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +   I++DN + F L P    IK  +SF    +Q     D+ A+DNG+P  S+  ++ + + D  +ND
Sbjct:  123 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK--ESQIEVHIP------------ENSPVGTSVVQLQATDADVGANAEIK-------------YMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSAL-----LDYEGTKEYIFKIVASDSG--KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENAVVRLSILNDN-ENFILDPDSGVIKSNVSF-DREQQSSYTFDVRAVDNGSPPCSSAAKVTINVID--VND 669          

HSP 4 Score: 68.1662 bits (165), Expect = 5.652e-11
Identity = 77/288 (26.74%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPK---YFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL 1134
            I   V EN  ++  +  +SA  + S +++ I+ ++    S         F +D   G++ AS   DRE        +  + + T    S   ++  + D          ENDN P F +++    V E+ P  + + +   TD D+ +N V   RL+     + F L  +  VI   V    D E   +Y   +   D G+P   S+  V IN++DVNDN PI   P     F ++      G ++ +V A D D+     +KY   S N   +  F+IDP TG+I L
Sbjct:  473 IELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAV--VRLSILNDNENFILDPDSGVIKSNVS--FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGN--VRSLFRIDPVTGNITL 736          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 221.476 bits (563), Expect = 7.742e-59
Identity = 218/788 (27.66%), Postives = 355/788 (45.05%), Query Frame = 1
Query:  286 SCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSAT---SGTCSVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS-EKVTKPFSLRY----NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD-----VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
              V  I + V E  P +T+IG ++A + + +        +Y +E +G        ++D   G I    + +DRE +  C             SVT L+   +  +    I V + NDN P F +  + ++V E+T +G    +  ATD D+  NGV +Y LT+  +    F L+        +  L V+  LD E  D+Y LT+   D G P   SS L+R+ I D NDN P F+K  Y   + E+ P+G  +LQV A D D    G ++Y      +   +  +ID ++G I++  PL   +  N +F + ARD GP P  ++T ++I V D N++ P ++I        I     +  + +  E+ P  T +  + V+DKD  EN  V C +       L     + ++NK  Y L   +  + E  ++  V I   DSG    SST+++ +Q+ D N+   +F+ + + +   E        + +   D  S      V   I D   R  F     + ++   S LD E K    F +   +KG   HR    + T     +   +++   +L   +F + E+  P S +G +   D DE  N+ V   +++V  +   +  F I++  GTI  +   DREKES Y   + A D G+P  S+   +TI+VLD NDN P    P  N + I  S      +V+  + A D+D  S+  + Y I   N    FY+ P  GE++    LT    G + L I   D G P R     + +Y+++   N
Sbjct:   20 GAVGGILYRVHEEQPPSTLIGSLAADQGLPDTG-----HLYKLE-VG----APYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIR------GIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRG---TATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQV---QLSVEPD---VGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP-SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIAN 781          

HSP 2 Score: 61.2326 bits (147), Expect = 7.227e-9
Identity = 103/360 (28.61%), Postives = 162/360 (45.00%), Query Frame = 1
Query: 1606 IQILDLNEFPAVFNKSTYSLSVKENT---VSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQ----------QLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH--ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP----QWIFPI-QNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKG------ELSFL--TTPRQGENILD----IVAIDNGNPVRSNQTRLFLYISDKSINDGI 2583
            I++ D+N+    F     +LSV ENT     F++PL+  D+D   + + + T L A      L   Q          QL++   LD E K S + +I+ ++ G P R    S+    + I D NDNAP   E +++   + E++  G ++  +KANDSD   N  + +      +    L   RI+ S G I +   LDRE+ +     ++A D G    S+   ++I V D NDN P    + I  +  +D   N S    VGT +  +   D D+  +  +T  +  D    F L P            FL  TTP   E + D    IVA+D+GNP  S+   L + ++D + N  I
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLAT-DKDTERNGVADYT-LTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPR---YSSALLRVVIADANDNAP-KFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKL--LRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP--FQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPI 468          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 221.861 bits (564), Expect = 9.497e-59
Identity = 210/756 (27.78%), Postives = 349/756 (46.16%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKR---IYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTCS----VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTP 2469
            + + E   +N +IG++     +S  +SA       +Y + S   +    L ++    G I   S  +DRE +CP  S     CS    V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  N V +Y L + +       V  P   ++      L V   LD E  D Y + + V D G P+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      +KY F +  + A +R F ++ TTG I + RPL  +     +  + A D    P   R  ITI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   D    LK  Y N    Y L   +  + E  KE +  I  SDSG+   + T  + +++ D N+ P +F +    L+V EN +   F   +S  D+D   +  + +  L   + F               D + K+ +  +  + ++     FL + T+       +   A V++         P        F ++E+    S +G I   D+D   N++V   ++++ N+    ENF ++ D G IK     DRE++S Y   + A D G+P  S+   +TI+V+DVNDN P  I+P  N +     +    G+V+  + A+D D   +  + Y I+S N +  F + P+ G ++    P
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGD--TPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSP--ARATITINVTDVNDNAPNIDLR--------YIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEK---DVPFHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEI-VYQLGPNASF--------------FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVV---RLSILNDN---ENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKP 740          

HSP 2 Score: 94.3597 bits (233), Expect = 4.723e-19
Identity = 115/459 (25.05%), Postives = 195/459 (42.48%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPP------MFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYL-EVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE 1629
            I   + EN P  T +  + A       ++A +K ++  +   +   + LF ++ T G+I     +DRE        V+    S++    ++T+ VT +             NDN P      + + +N  + + E  P+ T + L   +D D+  NG  +     EK   PF L+      YL E   +LD+E    Y   +   D G P    + LVR+ + D NDN PIF +P     + E++     +  +SATD DS +   + YQ          +F +D  TG +   R     + + F F + ARDNG     ++  + + + D N++ P  K T + F          +  VS  EN P  + +  I VTD D+ EN  V+ S+   N ++++      I + V +     SS   + R          D+G  P SS   + I ++D+N+
Sbjct:  256 IEVHIPENSPVGTSVVQLQA-TDADVGANAEIKYMFGAQV--SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDV-------------NDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNG--KVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSP--KFTHNHF----------QFFVS--ENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVR--------AVDNGSPPCSSAAKVTINVIDVND 669          

HSP 3 Score: 70.0922 bits (170), Expect = 1.370e-11
Identity = 145/608 (23.85%), Postives = 244/608 (40.13%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCE-------SRKEVMV---VISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN--------KSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITD-----LYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+    + KY+  +  +          E ++W Q+        + + L  + K+ +   ++  D G     +  ++ + V D+N++ P  K  ES     I             EN+P  T ++ +  TD D   N  ++               F    +    RL AL++            R+E  +    +  SD    P  +T  I I + D+N+     +          T  LS K+  NT    + +S  D D    VI  I       L A    +YL  T  L     LD+E      F I   + G  +  L  T    + + D NDN P+  +P     + E+      + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G   L +   + +++LD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +   I++DN + F L P    IK  +SF    +Q     D+ A+DNG+P  S+  ++ + + D  +ND
Sbjct:  123 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFK--ESQIEVHIP------------ENSPVGTSVVQLQATDADVGANAEIK-------------YMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSAL-----LDYEGTKEYIFKIVASDSG--KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENAVVRLSILNDN-ENFILDPDSGVIKSNVSF-DREQQSSYTFDVRAVDNGSPPCSSAAKVTINVID--VND 669          

HSP 4 Score: 67.781 bits (164), Expect = 7.802e-11
Identity = 77/288 (26.74%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPK---YFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL 1134
            I   V EN  ++  +  +SA  + S +++ I+ ++    S         F +D   G++ AS   DRE        +  + + T    S   ++  + D          ENDN P F +++    V E+ P  + + +   TD D+ +N V   RL+     + F L  +  VI   V    D E   +Y   +   D G+P   S+  V IN++DVNDN PI   P     F ++      G ++ +V A D D+     +KY   S N   +  F+IDP TG+I L
Sbjct:  473 IELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAV--VRLSILNDNENFILDPDSGVIKSNVS--FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGN--VRSLFRIDPVTGNITL 736          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 209.149 bits (531), Expect = 1.302e-54
Identity = 220/808 (27.23%), Postives = 367/808 (45.42%), Query Frame = 1
Query:  268 FQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL-TSEKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFT 2619
            FQL  +     +++ V E  P N +IG ++     S+      K +Y +E +G+  ++    +D   G I     ++DRE +  C  L            S+T L++ +  +++  I I+D NDN P F +  I +++ E+T +G    +  ATD DS  NGV  Y L    +    F L+     +     L V+ +LD E  D+Y LT+ V D GTP   SS L+RI+ILD NDN P F+K  Y   + E+ P+G  +LQV A D D      + Y F   ++  +R   +D +TG I +  P+  +     +F + A+D G  P   RT +TI ++D N++ P I+I    F     + G    + +  E+ P  T +  + V+D D   N  V C +       L  +     ++K  Y L   ++ + ES KE  + I   DSG  P SST+++ +Q+ D+N+   VF++S   +   EN    +L + +   D  S          + D  AR  F     + Q+ + + LD E +   +F +  ++KG P  +   + +     +   +++   +L    F + E+    S +G +   D+D+  N+      I++S      E       GTI  +   DRE +S Y   + A D G+P  S+   +TI+VLD NDN P  + P  N +    +  T  GT +  + A D+D   +  + Y I S N  + F +    GE++    +     G + L +   D G P R     +  YI++   N  +  + L   S FT
Sbjct:   58 FQLPILGSSTKVAYRVPEEQPPNILIGSLA-----SDYGYPDSKHLYKLE-LGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI--RGFGLVTHQGG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP--SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENA-----HIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP-SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTL-VETLLGHSQFT 840          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 209.149 bits (531), Expect = 1.532e-54
Identity = 220/808 (27.23%), Postives = 367/808 (45.42%), Query Frame = 1
Query:  268 FQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL-TSEKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFT 2619
            FQL  +     +++ V E  P N +IG ++     S+      K +Y +E +G+  ++    +D   G I     ++DRE +  C  L            S+T L++ +  +++  I I+D NDN P F +  I +++ E+T +G    +  ATD DS  NGV  Y L    +    F L+     +     L V+ +LD E  D+Y LT+ V D GTP   SS L+RI+ILD NDN P F+K  Y   + E+ P+G  +LQV A D D      + Y F   ++  +R   +D +TG I +  P+  +     +F + A+D G  P   RT +TI ++D N++ P I+I    F     + G    + +  E+ P  T +  + V+D D   N  V C +       L  +     ++K  Y L   ++ + ES KE  + I   DSG  P SST+++ +Q+ D+N+   VF++S   +   EN    +L + +   D  S          + D  AR  F     + Q+ + + LD E +   +F +  ++KG P  +   + +     +   +++   +L    F + E+    S +G +   D+D+  N+      I++S      E       GTI  +   DRE +S Y   + A D G+P  S+   +TI+VLD NDN P  + P  N +    +  T  GT +  + A D+D   +  + Y I S N  + F +    GE++    +     G + L +   D G P R     +  YI++   N  +  + L   S FT
Sbjct:   58 FQLPILGSSTKVAYRVPEEQPPNILIGSLA-----SDYGYPDSKHLYKLE-LGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI--RGFGLVTHQGG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP--SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENA-----HIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP-SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTL-VETLLGHSQFT 840          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 209.534 bits (532), Expect = 1.567e-54
Identity = 220/808 (27.23%), Postives = 367/808 (45.42%), Query Frame = 1
Query:  268 FQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL-TSEKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFT 2619
            FQL  +     +++ V E  P N +IG ++     S+      K +Y +E +G+  ++    +D   G I     ++DRE +  C  L            S+T L++ +  +++  I I+D NDN P F +  I +++ E+T +G    +  ATD DS  NGV  Y L    +    F L+     +     L V+ +LD E  D+Y LT+ V D GTP   SS L+RI+ILD NDN P F+K  Y   + E+ P+G  +LQV A D D      + Y F   ++  +R   +D +TG I +  P+  +     +F + A+D G  P   RT +TI ++D N++ P I+I    F     + G    + +  E+ P  T +  + V+D D   N  V C +       L  +     ++K  Y L   ++ + ES KE  + I   DSG  P SST+++ +Q+ D+N+   VF++S   +   EN    +L + +   D  S          + D  AR  F     + Q+ + + LD E +   +F +  ++KG P  +   + +     +   +++   +L    F + E+    S +G +   D+D+  N+      I++S      E       GTI  +   DRE +S Y   + A D G+P  S+   +TI+VLD NDN P  + P  N +    +  T  GT +  + A D+D   +  + Y I S N  + F +    GE++    +     G + L +   D G P R     +  YI++   N  +  + L   S FT
Sbjct:   50 FQLPILGSSTKVAYRVPEEQPPNILIGSLA-----SDYGYPDSKHLYKLE-LGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI--RGFGLVTHQGG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP--SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENA-----HIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP-SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTL-VETLLGHSQFT 832          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 208.764 bits (530), Expect = 2.335e-54
Identity = 220/808 (27.23%), Postives = 367/808 (45.42%), Query Frame = 1
Query:  268 FQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL-TSEKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFT 2619
            FQL  +     +++ V E  P N +IG ++     S+      K +Y +E +G+  ++    +D   G I     ++DRE +  C  L            S+T L++ +  +++  I I+D NDN P F +  I +++ E+T +G    +  ATD DS  NGV  Y L    +    F L+     +     L V+ +LD E  D+Y LT+ V D GTP   SS L+RI+ILD NDN P F+K  Y   + E+ P+G  +LQV A D D      + Y F   ++  +R   +D +TG I +  P+  +     +F + A+D G  P   RT +TI ++D N++ P I+I    F     + G    + +  E+ P  T +  + V+D D   N  V C +       L  +     ++K  Y L   ++ + ES KE  + I   DSG  P SST+++ +Q+ D+N+   VF++S   +   EN    +L + +   D  S          + D  AR  F     + Q+ + + LD E +   +F +  ++KG P  +   + +     +   +++   +L    F + E+    S +G +   D+D+  N+      I++S      E       GTI  +   DRE +S Y   + A D G+P  S+   +TI+VLD NDN P  + P  N +    +  T  GT +  + A D+D   +  + Y I S N  + F +    GE++    +     G + L +   D G P R     +  YI++   N  +  + L   S FT
Sbjct:   58 FQLPILGSSTKVAYRVPEEQPPNILIGSLA-----SDYGYPDSKHLYKLE-LGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI--RGFGLVTHQGG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP--SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENA-----HIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP-SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTL-VETLLGHSQFT 840          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 208.764 bits (530), Expect = 2.858e-54
Identity = 220/808 (27.23%), Postives = 367/808 (45.42%), Query Frame = 1
Query:  268 FQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL-TSEKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFT 2619
            FQL  +     +++ V E  P N +IG ++     S+      K +Y +E +G+  ++    +D   G I     ++DRE +  C  L            S+T L++ +  +++  I I+D NDN P F +  I +++ E+T +G    +  ATD DS  NGV  Y L    +    F L+     +     L V+ +LD E  D+Y LT+ V D GTP   SS L+RI+ILD NDN P F+K  Y   + E+ P+G  +LQV A D D      + Y F   ++  +R   +D +TG I +  P+  +     +F + A+D G  P   RT +TI ++D N++ P I+I    F     + G    + +  E+ P  T +  + V+D D   N  V C +       L  +     ++K  Y L   ++ + ES KE  + I   DSG  P SST+++ +Q+ D+N+   VF++S   +   EN    +L + +   D  S          + D  AR  F     + Q+ + + LD E +   +F +  ++KG P  +   + +     +   +++   +L    F + E+    S +G +   D+D+  N+      I++S      E       GTI  +   DRE +S Y   + A D G+P  S+   +TI+VLD NDN P  + P  N +    +  T  GT +  + A D+D   +  + Y I S N  + F +    GE++    +     G + L +   D G P R     +  YI++   N  +  + L   S FT
Sbjct:   58 FQLPILGSSTKVAYRVPEEQPPNILIGSLA-----SDYGYPDSKHLYKLE-LGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI--RGFGLVTHQGG----VANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP--SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENA-----HIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP-SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTL-VETLLGHSQFT 840          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 214.542 bits (545), Expect = 4.670e-57
Identity = 225/796 (28.27%), Postives = 360/796 (45.23%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  + +  L   + F               D + K+ +  +  + N+     F+ + T+       +   A V++         P        F ++E+    S +G I   D D   N  V    +N +      ENF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+D+D   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR--------YIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADI-VYQLGPNASF--------------FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDN------ENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 85.8853 bits (211), Expect = 2.157e-16
Identity = 147/595 (24.71%), Postives = 251/595 (42.18%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  +RE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN + F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDEDAGENKAVTLSILNDN-ENFVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 71.2478 bits (173), Expect = 7.073e-12
Identity = 85/330 (25.76%), Postives = 145/330 (43.94%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHV 1239
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   +RE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ + +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKALHTLVLVFL 772          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 214.927 bits (546), Expect = 2.636e-56
Identity = 225/796 (28.27%), Postives = 360/796 (45.23%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  + +  L   + F               D + K+ +  +  + N+     F+ + T+       +   A V++         P        F ++E+    S +G I   D D   N  V    +N +      ENF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+D+D   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR--------YIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADI-VYQLGPNASF--------------FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDN------ENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 87.8113 bits (216), Expect = 6.719e-17
Identity = 147/595 (24.71%), Postives = 251/595 (42.18%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  +RE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN + F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDEDAGENKAVTLSILNDN-ENFVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 70.8626 bits (172), Expect = 1.072e-11
Identity = 85/328 (25.91%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   +RE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKALHTLVLV 770          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 214.542 bits (545), Expect = 3.470e-56
Identity = 226/796 (28.39%), Postives = 362/796 (45.48%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +        I+   P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  + +  L   + F               D + K+ +  +  + N+     F+ + T+       +   A V++         P        F ++E+    S +G I   D D   N  V    +N +      ENF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+D+D   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR------YIIS--PINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADI-VYQLGPNASF--------------FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDN------ENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 87.4261 bits (215), Expect = 8.548e-17
Identity = 147/595 (24.71%), Postives = 251/595 (42.18%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  +RE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN + F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDEDAGENKAVTLSILNDN-ENFVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 70.4774 bits (171), Expect = 1.306e-11
Identity = 85/328 (25.91%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   +RE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKALHTLVLV 770          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 214.542 bits (545), Expect = 3.592e-56
Identity = 226/796 (28.39%), Postives = 362/796 (45.48%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +        I+   P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  + +  L   + F               D + K+ +  +  + N+     F+ + T+       +   A V++         P        F ++E+    S +G I   D D   N  V    +N +      ENF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+D+D   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR------YIIS--PINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADI-VYQLGPNASF--------------FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDN------ENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 87.8113 bits (216), Expect = 6.765e-17
Identity = 147/595 (24.71%), Postives = 251/595 (42.18%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  +RE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN + F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDEDAGENKAVTLSILNDN-ENFVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 70.4774 bits (171), Expect = 1.231e-11
Identity = 85/328 (25.91%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   +RE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKALHTLVLV 770          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 214.542 bits (545), Expect = 3.592e-56
Identity = 226/796 (28.39%), Postives = 362/796 (45.48%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +        I+   P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  + +  L   + F               D + K+ +  +  + N+     F+ + T+       +   A V++         P        F ++E+    S +G I   D D   N  V    +N +      ENF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+D+D   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR------YIIS--PINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADI-VYQLGPNASF--------------FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDN------ENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 87.8113 bits (216), Expect = 6.765e-17
Identity = 147/595 (24.71%), Postives = 251/595 (42.18%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  +RE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN + F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDEDAGENKAVTLSILNDN-ENFVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 70.4774 bits (171), Expect = 1.231e-11
Identity = 85/328 (25.91%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   +RE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKALHTLVLV 770          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 9.597e-55
Identity = 231/783 (29.50%), Postives = 363/783 (46.36%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAI---MKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLS-ATSGTC----SVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISDKSIN 2574
            +T+ E  P+N  IG++     +S  ++A       +Y + S   +    L ++  + G I   S  +DRE +C   S A    C     V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  NGV  Y L + +       V  P   ++      L V   LD E  D Y + + V D GTP+  S+ ++++ + DVNDN P+FK+ +    I E+ PVG  ++Q+ ATD D      ++Y F +    A KR F ++ TTG I + R L  +      V + A D    P   R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   +    LK  Y N    Y L   S  + E  KE    I  SDSG+   + T  + +++ D N+ P +FN+    LSV EN     +   +S  D+D   +  +        S F   + T  L      D E +    F++   + G     L S  +  +T++D NDN+P        F ++E+    S +G I   D+D   N  V    +N +      +NF ++   G IK     DRE++S Y   + ATD G P  S+T  +TI+V+DVNDN+P  I P  N +     +    G+V+  + A+DVD   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D + N
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGD--APLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLR--------YIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIER---EVPFHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP--LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDN------DNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN 780          

HSP 2 Score: 90.1225 bits (222), Expect = 8.737e-17
Identity = 148/595 (24.87%), Postives = 250/595 (42.02%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFP---------AVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHL-DFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+   G+  Y+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P            + K G  +  V   EN P  T +I +  TD D   N  ++     F +      K  +  N     +    S + E      V +  SD    P  +T  + I + D+N+ P         +  N + Y LS K+  NT    + +S  D D    VI  I +     H + +   Q L+  S L D+E   +  FS +I+     +  L  T    + + D NDN P+  +P     ++E+ + G  + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE++  +   + A D G P L +   + ++VLD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  +T  I++DN   F L P    IK  +SF    +Q     D+ A D G P RS+  ++ + + D  +ND
Sbjct:  124 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP------------VFKEG--QVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYI---FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVY-LSEKDPVNTKIALITVSDKDTDVNGKVICFI-EREVPFHLKAVYDNQYLLETSSLLDYE--GTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSF-DREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD--VND 670          

HSP 3 Score: 72.0182 bits (175), Expect = 3.221e-11
Identity = 86/328 (26.22%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITI 1233
            I  +V+EN  +   +  +SA  + S K++ I+ ++    S         F +D   G++ AS   DRE     I    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    V  P+S  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN P+   P     F ++      G ++ +V A D+D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G  P    TL+ +
Sbjct:  474 IELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD-----------ENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVS---------FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLG-YPKSLHTLVLV 770          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q24292|DS_DROME (Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3)

HSP 1 Score: 206.453 bits (524), Expect = 2.024e-52
Identity = 196/720 (27.22%), Postives = 325/720 (45.14%), Query Frame = 1
Query:  418 SIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQ---LSATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL------------TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM-EQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----------------ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNS------IVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPV---LSTTGTITISVLDVNDNNPQWIFPIQNDNKINE---SIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK 2418
            S+  E  K LF ID  +G +  S ++D E        ++AT G     + ++T+LV + +            NDNPP+F      +NV ES  +   +   +A+D D+ +N    YR+            +S  V++ F +  N   IYL     LD ET D YQLT+   D GTP   +   V + +LD NDN P F+K KY   I E+   G ++  V+A+DLD  +   ++Y     N+     FQ+ P TG I    PL  + +  +  V+EARD G      R  + IHV D+N++ P+I               P + +VS  E  PP T+++ +   D+D  +N  +  S+ +  +SD   +   +  +  +  R+V     + E R    + ++ SD G  P+ +   + +++LDLN+    F  S+    V+E+    ++  SI   +  +DV+ N                 +T     + F   + +  LV+   LD E +S     I  ++     N  +S  +  I + D+NDNAP    +P    ++E T  G+ I +  A D+D   N       I  F ++N S  ++ +  FR++S  G + L   LD E    Y L + A D  + V   L T+ T+ + +LD ND+ P ++ P  +  K      S  TR+G V+  + A+D D   +  +TY I   N +
Sbjct:  916 SLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDV-----------NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAP--LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI-------------ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV----LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNES-QEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGE 1600          

HSP 2 Score: 187.963 bits (476), Expect = 1.049e-46
Identity = 213/750 (28.40%), Postives = 345/750 (46.00%), Query Frame = 1
Query:  421 IGNEQVKDLFQIDPTNGIIKASLNVDRE------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSL---RYNLSVIYL--EVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSD-ENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQD--CTSDVIVNITDLYARSHFRYLQATQQLVLF---SHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH---ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTR---VGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGEL-----SFLTTPRQGENILDIVAIDNGNPVRSNQTR-LFLYISD 2562
            +    V+    ID   G I+  + +DRE      ++   LS  +    + +LVT+ +           ENDN P F  +++ I   E+TP      L  A D D        Y + S  V   F L   R    V+YL  ++   LD ET   Y L +   D GTP       V I I DVNDN PIF + +YF  + E+  VG  +LQV A+D D+ + GLV+Y      ++ ++ F+IDP TG I++ + L  + K   + V+ A+D+G  P      ++I V D+N++ P I +   + +A      P  S     E+  P   +  I V D DS  E   V  ++   +  + +  + N      IY ++     + E      + +  +D G  P  ++ +I ++I D+N+ P  F +  Y  +V E  +  +  L +  HD+D    S +  ++ +    +H ++ Q   Q  L    SH+D ET+     ++   + G  P    L+ST +  +TI D+NDN P+  +  +F+   + E+   G  I  + A+D D  +N++V +    +    + L  F + S  G I +  ELD E+ S Y  P+LATD G   LSTT  I + + DVNDN P + +P +    + ES         T I  + A D D  +   ++Y I++ N A  F +    GE+       L+   Q  ++L+I A D GN +RSN    +FL I D
Sbjct:   61 VAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN----IRVLVTVKD-----------ENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDAS-----PKIS-----ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS-----IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP----LSSTATVLVTIHDVNDNEPIFDQ--SFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNY---TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIID 766          

HSP 3 Score: 150.214 bits (378), Expect = 4.534e-35
Identity = 193/746 (25.87%), Postives = 334/746 (44.77%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDREV-ICPQLS--ATSG-----TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSE-KVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKM-----ILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRP--LSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPL---SIHDQDCTS--DVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKI-----NVSNNKRGL---ENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT-PRQGENILDIV--AIDNGNPVRSNQTRLFLYISDKSIND 2577
            FQIDP  G+I    ++D E    PQL+  A  G     + + T+LVTI +            NDN P+F  S   ++V E+ P+G  +    A+D D   N +  Y +    K    F +R     I   +   LDFE   +Y+  +   D G     ++ ++++ + DVNDN P+F   +Y   + E            I+ V ATD D   +G V Y+  + N      F+ID +TG IF++RP  LS + +    + I A D G + +    ++ + + D     P  +     +  K              E+ P  T +  ++    D      V+ S+   + D    ++ N  N ++   L      + E++ +V++ I  +  GE P      + I++ D+N+    F  S   +SV E +     PL     HD+D  S   V  ++     +  F     +  L+L  HLD+E+       +   + G P    L++  +  + + D+NDN PV   +  + +++E     + I  + A+D D   N+ + ++ +     NV+N+       ++F I  + G I L   LDRE    Y L +LATD G P       + + VLD NDN+P++    + + +I E++  R G+V+  + A D+D   +  I Y ++  N+  F +HP+ GE+S      R+   + D+V  A D G PVRS +  + +++SD  +ND
Sbjct:  501 FQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDV-----------NDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEIC--IAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAG--IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVK--------------EDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPL------DHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPE-SAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS---LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ-KSKYEFRIEENL--RRGSVVGVVTASDLDLGENAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSD--VND 1198          

HSP 4 Score: 148.288 bits (373), Expect = 1.780e-34
Identity = 182/742 (24.53%), Postives = 317/742 (42.72%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREV---ICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFAS----------TNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSIH--DQDCTSDVIVNITDLYAR---SHFRYLQATQQLVLFSH--LDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIK--ANDSDENLNSI-VVFQKINVSNNKRGLENFRIES-------DGTIKLTKELDREKESLYYLPILATD--LGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYF 2424
            + V E+ P+ T++G + A        S +   IYS +  G       F I+  +G I+ +  +D E    +   + AT G   V            + I + D NDN P F  S + I+V ES  LG  LY  HA D DS  +G   Y L  E     F++  +    +L +   LD+E+   + L ++  D G P   ++  + +++ DVNDN P+F+K +Y   ++E   +   I+QV+A+DLD+     + Y+             ++++  + F I P +G I+L  PL  + ++ +Q  + A DNG      +T + + V D N++ P  K  +S +  +I +     S+V              +  +D D  EN  ++ S+   NS + +        + V   +      + E R+   +V+   D G   +S+   + I + D+N+  P + +     +SV+E        + +   D+D   +  +  + +  R    H  +       V+ +   LD E +S     +   + G P R  +       + + D     P     +  F + ED   G  +GSI      +D   NS+   F+ + V+     L    IE+        G + + + LDRE +S + L I A D    N   S+  T+ I V DVNDN P+W    Q+   +  S  T VGT+I    A D D  ++ ++ Y +I    +YF
Sbjct:  781 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG------YFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPV-------YGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI--DARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP--KFQKSKYEFRIEENLRRGSVVG------------VVTASDLDLGENAAIRYSLLPINSSFQV--------HPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNR---PTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI----RYF 1475          

HSP 5 Score: 143.28 bits (360), Expect = 7.397e-33
Identity = 181/681 (26.58%), Postives = 299/681 (43.91%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHIT--EDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII-------------SDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            NDNPP F       NV E    GT +    A D D   N    Y L     T     + +     +     +D ET    QLT+   D G P   S+  V + I DVNDN PIF +  Y   + E+ PVG+ IL+VSA+D D     +V Y            F++   +G I +   L  + + +++F + A D G +      +I + + D+N++ P     E   +   ++  P  S      +   +T I+ +V TD D    G+V   +   N   +  +  +      + R   LS     ++   M+ IS +D G    ++   + + I+D  + P +F K+ Y+  VKE+    TV  ++  +  D    S V  +I       +F     +  + +   LD E KS +  +I+     P    +   T   I + D+NDNAP   E +   I+  E  + G+ + +  A+D D   +  V +  +  S   +GL  F I++  G + L++ LD E    + L + ATD G P LST  TI + V DVNDN P  +F  +++  +N S    +   I +++A D+D  ++  ITY I+             SD +++F + P  G + +L  P   E      L ++A DNG P    +TR+ + + D + ND
Sbjct:  445 NDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE-FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTT--AMIKMQLTDVNDNRPVFYPREYKVS---LRESPKAS------SQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRS-TGEIFVVRPDMLS---VRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP---VYGHTQVNIEVEDVNDNAPE-FEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGL--FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP--VFE-KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWI-YLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDND 1097          

HSP 6 Score: 136.732 bits (343), Expect = 6.142e-31
Identity = 201/820 (24.51%), Postives = 352/820 (42.93%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMS-------AYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICP------QLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLT------SEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIG---TPKHCSSQLVRINILDVNDNYPIFKKPKYFT------IINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN------FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM------EQFNSDW---LIMLKFNY-INNKVIYRL-VALSSANCESRKEVMVVIS--CSDSGEKPKSSTH----TIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSIH-------DQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGN-PVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINE-SIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY---FYLHPIKGELSFLTT--PRQGENI-LDIVAIDNGNPVRSNQTRLFLYISD 2562
            F V E+     ++G +S         R   E+S   ++  Y++  +  + ++  F ID  +G +  +  +DREV          L  T+     +  +T+  ++ ++       NDN P +    I + V E+TP+GT ++   ATD D+  NG  +YRL       +E   +  SL R +     L +   LDFE    Y L +   D     T +  +S  VR+ ILD ND+ P F  P           I++   +G+++  + A D DS   G + Y+    N E +  F+I+  TG I L++ L    ++      F  +I A+D+G  P   ++ + +H+    +H    +  ++ + A I+            EN P  + ++ +        EN  +   +      + F+ DW   +I  +  +   ++  Y L V +  AN +S      V     SDS     +  H    TI I + D+N+  P     S Y LSV EN+     P  IH       D+   +D+I +IT     + F    ++ +L     LD E  S     I+  ++G  ++               ++     L   T  + ED   G+++  I A D+D  +N+ +V+   N +  +  ++       G I    +LDRE ++ Y   +LATD G   V S T  + I+VLD+NDN P  IF  +    I +     + G  + ++ A+D D  ++  I Y + ++N+     F ++P  G LS   +     G+ + L++VA D GNP +S+   + L I +
Sbjct: 1319 FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADV-------NDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR--FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATIL------------ENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSE----PGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDG----QSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP--IF--ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGE 2103          

HSP 7 Score: 124.405 bits (311), Expect = 3.916e-27
Identity = 142/587 (24.19%), Postives = 244/587 (41.57%), Query Frame = 1
Query:  619 PPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWL--------IMLKFN-YINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNL--PLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT--TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW-----IFPIQNDNKINESI 2316
            PP+F  +     VKE  P GT +    A   D        Y + S      FS+  N   I   +   LD E      L +    +G P       V I + DVNDN P F+       + E   +G  +    A D DS   G V Y         K  F ID  +GH+ L + L  +      +I    +G VP+++  L I + V+D+N++ P  +  E + N                E+   N  II +  +D D+  N R+   +     D +        +   F  + N+  IY    L   + E+R    + +  +D+G     +   +++++LD N+    F KS Y   ++EN    ++   ++  D D   +  +  + L   S F+    T ++     LD E +   +  +E  ++G P R+   +     I + D+NDNAP + +P      + E+  PG+ +  ++A D D   N+ + +  +    +  G   F I+ + G I+    LD E+ S+Y L + A+D GNP   T   + + VLD+NDN P +     +F ++ D  +   +
Sbjct:  771 PPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNI--RIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL--VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVS--------------ESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL---DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRS---ARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVV 1331          

HSP 8 Score: 106.686 bits (265), Expect = 9.357e-22
Identity = 183/793 (23.08%), Postives = 335/793 (42.24%), Query Frame = 1
Query:  310 TVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVD---REVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLY-----LKHATDF--DSLDNGVGEYR-------LTSEKVTKPFSL-RYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPK--HCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDS-----IKYGLVKY--QFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGP-VPNVNRTLITIHVK--DINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDII-FIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVAL---SSANCESRKEVMVVISCSDSGE-KPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT---------------------VSFNLPLSIHDQ----DCTSDVIVNITDLYARSHFRYL------QATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTG--TITISVLDVNDNNP-----QWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT 2466
            +V E  P  T +  + A  +   ++++I    YSI    +     LF IDPT+G+I+  + +D   R +    ++A+ G       V ++   V  +      NDN P F +S++V  V+E   LG H+      ++   D   +S++    + R       LT + +   F + R++ +++   V  +LD E    ++L +   D         S+  V+I + DVNDN P + +      ++E  PVG +I   +ATD D+     ++Y L++Y  Q   +  +A   F++D  TG + L  PL  +  + +  +++A D    V    +T +T+ ++  D N+H P      S+        G   SL  F  +     +++  IV  D+DS +NG++   +   N +     +F   +   I  LV     ++ + E      ++I   D G+ +PK S+  + + +   +  P  F ++ Y  ++ EN                      +S+ +P  + +     D    +I         S   Y+       A +Q  L S    + +SS   SI   + G H +  T   +      +  +  P         + E+++PG  I ++ A+D DE  N+ +++   +++    G   F I+S       + LDRE+ S Y L I A+D G P  S  G   ITI V D NDN P     ++   +Q D  +        GT + ++ A+D D   +  + Y + ++    F    I G+   +TT
Sbjct: 1212 SVREEQPPGTEVVRVRAVDRDHGQNASIT---YSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL------NDNRPTFTSSSLVFRVREDAALG-HVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLV---VARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSS-------GGKTASL--FISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG----RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSD--SIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSC--YGLSVPENSEPGV-IHTVVASDLDEGPNADLIY---SITGGNLG-NKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQP-KSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL--------GTSVVQISAVDADLGVNARLVYSLANETQWQFA---IDGQSGLITT 1957          

HSP 9 Score: 89.7373 bits (221), Expect = 1.541e-16
Identity = 98/368 (26.63%), Postives = 157/368 (42.66%), Query Frame = 1
Query:  403 IYSIES--IGNEQVKDLFQIDPTNGIIKASLNVDREVIC-----------PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQL-VRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIML 1461
            IYSI    +GN+     F ID ++G + A   +DRE               Q  +  G C++T+ V              D+NDN P F  S    +V+E  PLGT +    A D D   N    Y L +E   + F++     +I    V  LD E   +Y   +   D G  +  S+ + V+IN+LD+NDN PIF++  Y   +      G+ +L+V A D D      + Y   + N+     F+I+P+TG +   + L+++  K     + ARD G  P  +  LI + + +     P ++    T+             V   EN+P  T ++ +V    D     +VQ S    N D ++ L
Sbjct: 1830 IYSITGGNLGNK-----FSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFV-------------EDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ-FAIDGQSGLI--TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYR------------VMLKENSPSGTRLLQVVALRSDGRRQ-KVQFSFGAGNEDGILSL 2162          

HSP 10 Score: 86.6557 bits (213), Expect = 1.219e-15
Identity = 105/417 (25.18%), Postives = 178/417 (42.69%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN---EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGR-----VQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFE 1830
            ENDN P F+    V  V E    GT +   HA D D+  N    Y +        F +    S I    + VLD E  D Y+L +   D G P+   +  +R+ I+DVNDN P F  P     ++E   +G +I  +SA D+D+  Y  + Y+  + +    E    F +D  +G + L R L  + +  ++  + A D     +  RT++T+ V D N++ P     +      I+   P  S +S  E+   + D++ +  TD DS+ N       ++ + E F+          + +N V+   ++       S  +  V I   D+G+    S+  + +Q  D     + F ++ Y   + E     ++ L +  QD   D  + I      S F  LQ ++ +VL   LD E
Sbjct: 2262 ENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNI-VLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD---AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAIL---PAISEIS--ESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSV---------HPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-GQDAL-DQSLAIIAGNEESAFELLQ-SKAIVLVKPLDRE 2654          

HSP 11 Score: 73.559 bits (179), Expect = 1.264e-11
Identity = 69/233 (29.61%), Postives = 117/233 (50.21%), Query Frame = 1
Query: 1975 ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES--DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIIS------DNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASR--SYFTLVAVV 2634
            ++E    G+ +  + A DSD   N+ + +  ++ +++      F IE    G ++    LDRE   +Y L I+ATD G P ++ T TI + ++DVNDN P   FP  N   ++E+  T +G VIT + A DVD  ++  +TY + +      +N   F L    G+L     L    Q E  LD++A D  +  R   T L + ++D++ N  +   FLA +  +YF ++  +
Sbjct: 2278 VSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP--TFPPNNLVTVSEA--TELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNAPV---FLAQQPPAYFAILPAI 2494          

HSP 12 Score: 73.1738 bits (178), Expect = 1.561e-11
Identity = 126/483 (26.09%), Postives = 208/483 (43.06%), Query Frame = 1
Query: 1216 RTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSL-VSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSS-ANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD------VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPV-----LLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLT---KELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII---SDNAKYFYLHPIKGELSFLTTPR-----QGENI--LDIVAIDNGNPVRSNQTRLFLYISDKSINDGI 2583
            R L+T  VKD N++ P       TF        P  S+ + F EN P       +   D D +     + ++   N +    L  +   + V+Y  + +S   + E+     ++I   D G  P     T+ I I D+N+   +FN+S Y  +V EN       L ++  D  +D        +N         FR    T  + +   LDFETK      + ++ K      L +T    I + D+NDN P      L +  +  I+E  +PG  +  I  +D D    S   +  +NV+ N  G  +F + + D +I L      LDRE  S Y L ++ATD G P L  + +I + + DVNDN P++   + + N +        GT + ++ A D D+  ++ +TY +      +A++F + P  G    L T R     + E +  L +VA D G P  S+   + + I D + N+ I
Sbjct:  106 RVLVT--VKDENDNAP-------TF--------PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL--HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD----SKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME---VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG----LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPI 557          

HSP 13 Score: 64.3142 bits (155), Expect = 7.292e-9
Identity = 50/178 (28.09%), Postives = 82/178 (46.07%), Query Frame = 1
Query:  610 NDNPPMFANS-NIVINVKESTPLGTHLYLKHATDFDSLDNGVGE--YRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFET-CDAYQLTLSVCDIGTPKH-CSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRW--FQIDPTTG 1122
            NDN P+F  S      + E  PL   +    A D D  +    E  Y +TS      F++     V++  V + LD+++   +Y+L +  CD    +  CS Q  R+ + D NDN P F   +Y   + E+ PVG  + +  A+DLD   +G + Y      ++   W  F++D  +G
Sbjct: 2693 NDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLF--VNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG 2868          

HSP 14 Score: 62.3882 bits (150), Expect = 2.762e-8
Identity = 52/186 (27.96%), Postives = 88/186 (47.31%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL----TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINED--HPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPL 1146
            ENDN P F  +  V  + E+ P+G+ ++  HA+D D    G   Y +    + E   K F  R +     +    V D+E    Y + L   D+G  K  +S  VR+ I   ++  P F +  Y  ++      P G ++ QV+ATD DS   G V YQ ++ ++     F+++ ++G + + R L
Sbjct: 2802 ENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMF--RVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK--ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH----FKVNRSSGAVLIKRKL 2979          

HSP 15 Score: 62.003 bits (149), Expect = 3.648e-8
Identity = 110/433 (25.40%), Postives = 185/433 (42.73%), Query Frame = 1
Query:  430 EQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLV--TXXXXXXXXXXXXXXENDNP---PMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTP------KHCSSQLVRINILDVNDNYPIF-KKPKYFTIINEDHPVGKMILQVSATDLD--SIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPL--STQYKNFQFVIEARDN---GPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFY-ENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSD---WLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTY 1659
            E  ++ F + P+NG++  S+N+ R  + P +S +SG   V ++        + +  ++ V  NDN      F  +     + E+ PLG+ + L+     D+LD  +    + +      F L  + +++   +V  LD E  D Y+L L +     P         S   V I ILD NDN+PIF +  KY   I+E  P+   I Q+ A D D  +     V Y   S N+E    F ID  TG +F+   L   +  K+++ +I A D+    P+ ++    + +H  D N++ P   +TE                V F  EN P  + +     +D D    G++  S+    SD   W  M + +  +  V    V     + E R+   + +  SD G K  S    + ++I   +EF   F + TY
Sbjct: 2529 EPAQEGFSVHPSNGVV--SVNMSR--LQPAVS-SSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGS-VVLQLGQ--DALDQSLA---IIAGNEESAFELLQSKAIV---LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDE--HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELH--DENDNEPKFPLTE---------------YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK-MFRVDSESGLVTSAFV----FDYEQRQRYDMELLASDMGGKKASV--AVRVEIESRDEFTPQFTERTY 2921          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 3.205e-51
Identity = 201/787 (25.54%), Postives = 352/787 (44.73%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSGTC------SVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVI--------YLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNI-TDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            + + V E  P NT+IG ++A     +     +  +Y +E +G        ++D   G I     ++DRE +  C Q       C      S+T LV   +  +    I V + NDN P FA+  I + + E+T +G+   +  A+D D+  NGV  Y L +    +     + L V          L V+  LD E  D+Y LT+ V D G+P   SS L+R+ +LD NDN P F++P Y   ++E+ P+G  ++QV A D D      ++Y F       +R  ++D  TG I +  P+  +     +F + A+D G  P   R  + + VKD+N++ P I+I        I        + +  E+    T +  + V+D+D  EN  V C +       L        ++K  Y L   +  + E  K+  + I   DSG  P SST+++ +Q++D+N+   VF +S   ++  EN     V   +  S  D    ++++ ++  +  A+  F     T ++ + + LD E + S    +   ++G   +   + T     +   +++   +L    F + E+    S +G +   D D+  N+ V   +++V  +     +F I++  GTI  +   DRE++S Y   + A D G P  S    +TI+VLD NDN P    P    +K+  +  TR+G  ++++ A D D   +  + Y I   N    F +    G ++    +     G + L +   D G P R     + LY+++   N
Sbjct:   60 VVYKVPEEQPPNTLIGSLAADYGFPD-----VGHLYKLE-VG----APYLRVDGKTGDIFTTETSIDREGLREC-QNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQEL---FGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIR------GIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRG-SPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQV---QLSVEQDNG---DFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLAN 818          

HSP 2 Score: 59.3066 bits (142), Expect = 2.022e-7
Identity = 94/363 (25.90%), Postives = 161/363 (44.35%), Query Frame = 1
Query: 1606 IQILDLNEFPAVFNKSTYSLSVKENT---VSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQ----------QLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP----QWIFPI-QNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHII--------------SDNAKYFYLHPIKGELSFLTTPRQGENILD----IVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            I++ D+N+    F     +L++ ENT     F +PL+  D+D   + + +  +L A    + L   Q          QL++  +LD E   S + +I++ + G P R    S+    +T++D NDNAP    P+    ++E++  G ++  +KANDSD+  N+ + +         R L   R++ + G I +   +DRE  S     +LA D G    S    + ++V D+NDN P    + I  +   D   N S      T +  +   D D+  +  +T  +               SD+ K ++L          TTP   E + D    IVA+D+GNP  S+   L + + D  +ND
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLA-SDRDAGPNGVASY-ELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPR---ASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRL--LRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQ--------TTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVD--VND 501          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.646e-50
Identity = 218/760 (28.68%), Postives = 355/760 (46.71%), Query Frame = 1
Query:  241 YIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDM------SAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVIC---PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVI---------YLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFAS-TNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYI-NNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLP------LSIHDQDCTSDVIVN-ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFY 2427
            YI  + L+   +V+ S     ++T+ E  P+N +IGD+      S     S  ++   K +Y    +       L +I+   G I      +DRE +C   P+         V +L   +  +V I  +I D NDN P+F  + I I++ E++ + +   L  A D D   NGV  Y L   +        + L VI          L V   LD E  D Y + + V D G P+  S+ ++++++ D NDN+P+FK+ +    I E+ PVG  + Q+ ATD D  +   + + F++  +N A+R F ++ TTG I +  PL   +  N + ++ A D G +P   R ++ ++V D+N++ P I I        IV   P    V   EN P NT I  I VTDKD+D NGRV C      +D  I  +   + +N+ +    A    + ES KE  + +  +D+G+ P + +  + I++ D N+   VF +S  ++S+ EN    N P      +S  D D   +  +N +    A   F   + T  L +   LD E +    F+I   + G     LTS  + F++IID NDN+PV       F++ E+      +G I   D D   NS V    ++ +      ++F I+S  G I+     DREK+  Y   + A D G    S++  +TI+V+DVNDN P +I P  N +       T  GTV+ ++ A+D D   +  + Y I+  N +  +
Sbjct:    8 YIFAVLLAC--VVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDV------PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNI------FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIR------YIVN--PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF-----TDHEIPFRLRPVFSNQFLLETAAY--LDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----NSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNG--VPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDEN------DDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLF 724          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.719e-50
Identity = 218/760 (28.68%), Postives = 355/760 (46.71%), Query Frame = 1
Query:  241 YIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDM------SAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVIC---PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVI---------YLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFAS-TNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYI-NNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLP------LSIHDQDCTSDVIVN-ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFY 2427
            YI  + L+   +V+ S     ++T+ E  P+N +IGD+      S     S  ++   K +Y    +       L +I+   G I      +DRE +C   P+         V +L   +  +V I  +I D NDN P+F  + I I++ E++ + +   L  A D D   NGV  Y L   +        + L VI          L V   LD E  D Y + + V D G P+  S+ ++++++ D NDN+P+FK+ +    I E+ PVG  + Q+ ATD D  +   + + F++  +N A+R F ++ TTG I +  PL   +  N + ++ A D G +P   R ++ ++V D+N++ P I I        IV   P    V   EN P NT I  I VTDKD+D NGRV C      +D  I  +   + +N+ +    A    + ES KE  + +  +D+G+ P + +  + I++ D N+   VF +S  ++S+ EN    N P      +S  D D   +  +N +    A   F   + T  L +   LD E +    F+I   + G     LTS  + F++IID NDN+PV       F++ E+      +G I   D D   NS V    ++ +      ++F I+S  G I+     DREK+  Y   + A D G    S++  +TI+V+DVNDN P +I P  N +       T  GTV+ ++ A+D D   +  + Y I+  N +  +
Sbjct:    8 YIFAVLLAC--VVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDV------PLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNI------FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIR------YIVN--PVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF-----TDHEIPFRLRPVFSNQFLLETAAY--LDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPEN----NSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNG--VPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDEN------DDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLF 724          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A5K3EIU9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.817e-66
Identity = 245/911 (26.89%), Postives = 406/911 (44.57%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDL----------FQIDPTNGIIKA--SLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXE------------NDNPPMFANSNI-----VINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSE--KVTKPFSL---RY--------NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA---KRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNG-PVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTG-PNK---------------------------------SLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQ-----FNSDWLIMLKFNYINNKVIYRLVALSSANCE------------SRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT-VSFN-LPLSIHDQDCTSDVIVNI----TDLYARSH----------------FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF-------------HITEDTKPGSNIGSIKANDSDENLNSIVVF-----QKINVSNNKRGLENFRIESD---GTIKLTKELDREKESLYYLPILATDLGNP-VLSTTGTITISVLDVNDNNPQWIFP-IQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFY-----------LHPIKGELSFLTTP-------RQGENI-LDIVAIDNGNPVRSNQTRLFL 2550
            I+  V+EN    T++G ++      + +  +  +IY++  +   +V+ L          F IDP + +I+   SL +DRE +CP  S T   CS+   V++     +   +   +            ND  P F N ++      +++ E TP+GT + L HA D DSL N    Y L  +      PF+L   R+          S I L++ + LD+E  D+Y  TL+VCD G    CS+  + I++ DVNDN P+F       ++ ED PVG  +  ++ATD DS  +G ++Y   +  +++   +R F++DP +G + L   L    K F   +EARD G P   ++R+ ++I+V D+NNH P I +  +    +I+  G P+K                                 SL+  +E+N   T+I FI V+D D  EN ++ C ++      F ++  ++ +    ++K++Y+LV     +CE            S   + V I+C D G   + S H + ++ILD NEFP VF    Y   ++E   V  N L +S+ D D    V  +     +  + +SH                F   Q + ++     LD ETK   +F ++ IN G     LTST    + + +INDN P +L P                 I E+   G+    ++  D D   NS +       ++ +  + K+ L     E D   G     + LDRE ES Y   ++A D      L++T TITI +LD NDN+P W++P   +D++I   I      +ITR+ A+D D   +  + Y +  ++A + +           L  ++G    L T        + G+++ L + A D G P +S     FL
Sbjct:   53 IALFVSENAEAGTVVGILNQQLPFLQTAGGLRYQIYNLGPVQEGEVQALSHSINDTDSIFNIDPDSSVIRVADSLKLDRERLCPFASGTEKECSLIYGVSVSRRANSAPPLTPQQSWFRVKIIIQDVNDCVPKF-NYDLNRGCKTVDLPEDTPVGTKVQLPHAVDLDSLQNSQLIYHLNCQNGPTNHPFALYQTRHSAPAARDGGFSQICLQLRYPLDYEKQDSYNCTLTVCDNGMSMLCSTLPLCISVHDVNDNAPVFLNANTSLVLREDIPVGSRVTTINATDADSGAFGNIRYSLVADMHDSFRTQRHFRVDPVSGDLILTSQLEGG-KKFLIWVEARDGGQPESRLSRSTLSIYVVDVNNHAPKITVLPAASKVRILTNGDPSKTSVRPALSRVTRVPCNFGGIQETRLCQERGEESSLIQVFEDNIAPTNIAFIHVSDADVGENAQIDCQLQHQTEVPFGNNIKLVAEHQVSSSKIVYKLVLEIMLDCETHTYSKGRSICNSAWTISVRIACRDFGSPVRKSYHNVFVEILDNNEFPPVFENEQYVAELREGVPVGSNVLQVSVTDADSVVQVTSHSEQHNSKQFQQSHSGRTLRFELEPQSDLPFAIDQHSGRIYANGDLDAETKKEYSFKVKAINTGADNVTLTSTCQVIVNVQNINDNPPRILTPRMIVGTLATEKKGIVVQIPENLHKGTVFMQLRTLDPDGTDNSTIQLRGCLPRQPSQPSGKKQLPKSIFEVDKKTGKCWTLENLDRETESAYVCTLVAMDSETTDGLTSTATITIELLDENDNSPVWLYPRAPDDSRIQIGIDFPTSRIITRVRAVDPDSGQNARVIYSL--EDASFVHFNQESTCDLRGLFNVEGASGHLRTREGIKSCVKAGDSVRLLLRATDEGTPPQSKDAEFFL 959          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A158QU08 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5554 PE=4 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 4.204e-66
Identity = 245/911 (26.89%), Postives = 406/911 (44.57%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDL----------FQIDPTNGIIKA--SLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXE------------NDNPPMFANSNI-----VINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSE--KVTKPFSL---RY--------NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA---KRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNG-PVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTG-PNK---------------------------------SLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQ-----FNSDWLIMLKFNYINNKVIYRLVALSSANCE------------SRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT-VSFN-LPLSIHDQDCTSDVIVNI----TDLYARSH----------------FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF-------------HITEDTKPGSNIGSIKANDSDENLNSIVVF-----QKINVSNNKRGLENFRIESD---GTIKLTKELDREKESLYYLPILATDLGNP-VLSTTGTITISVLDVNDNNPQWIFP-IQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFY-----------LHPIKGELSFLTTP-------RQGENI-LDIVAIDNGNPVRSNQTRLFL 2550
            I+  V+EN    T++G ++      + +  +  +IY++  +   +V+ L          F IDP + +I+   SL +DRE +CP  S T   CS+   V++     +   +   +            ND  P F N ++      +++ E TP+GT + L HA D DSL N    Y L  +      PF+L   R+          S I L++ + LD+E  D+Y  TL+VCD G    CS+  + I++ DVNDN P+F       ++ ED PVG  +  ++ATD DS  +G ++Y   +  +++   +R F++DP +G + L   L    K F   +EARD G P   ++R+ ++I+V D+NNH P I +  +    +I+  G P+K                                 SL+  +E+N   T+I FI V+D D  EN ++ C ++      F ++  ++ +    ++K++Y+LV     +CE            S   + V I+C D G   + S H + ++ILD NEFP VF    Y   ++E   V  N L +S+ D D    V  +     +  + +SH                F   Q + ++     LD ETK   +F ++ IN G     LTST    + + +INDN P +L P                 I E+   G+    ++  D D   NS +       ++ +  + K+ L     E D   G     + LDRE ES Y   ++A D      L++T TITI +LD NDN+P W++P   +D++I   I      +ITR+ A+D D   +  + Y +  ++A + +           L  ++G    L T        + G+++ L + A D G P +S     FL
Sbjct:   29 IALFVSENAEAGTVVGILNQQLPFLQTAGGLRYQIYNLGPVQEGEVQALSHSINDTDSIFNIDPDSSVIRVADSLKLDRERLCPFASGTEKECSLIYGVSVSRRANSAPPLTPQQSWFRVKIIIQDVNDCVPKF-NYDLNRGCKTVDLPEDTPVGTKVQLPHAVDLDSLQNSQLIYHLNCQNGPTNHPFALYQTRHSAPAARDGGFSQICLQLRYPLDYEKQDSYNCTLTVCDNGMSMLCSTLPLCISVHDVNDNAPVFLNANTSLVLREDIPVGSRVTTINATDADSGAFGNIRYSLVADMHDSFRTQRHFRVDPVSGDLILTSQLEGG-KKFLIWVEARDGGQPESRLSRSTLSIYVVDVNNHAPKITVLPAASKVRILTNGDPSKTSVRPALSRVTRVPCNFGGIQETRLCQERGEESSLIQVFEDNIAPTNIAFIHVSDADVGENAQIDCQLQHQTEVPFGNNIKLVAEHQVSSSKIVYKLVLEIMLDCETHTYSKGRSICNSAWTISVRIACRDFGSPVRKSYHNVFVEILDNNEFPPVFENEQYVAELREGVPVGSNVLQVSVTDADSVVQVTSHSEQHNSKQFQQSHSGRTLRFELEPQSDLPFAIDQHSGRIYANGDLDAETKKEYSFKVKAINTGADNVTLTSTCQVIVNVQNINDNPPRILTPRMIVGTLATEKKGIVVQIPENLHKGTVFMQLRTLDPDGTDNSTIQLRGCLPRQPSQPSGKKQLPKSIFEVDKKTGKCWTLENLDRETESAYVCTLVAMDSETTDGLTSTATITIELLDENDNSPVWLYPRAPDDSRIQIGIDFPTSRIITRVRAVDPDSGQNARVIYSL--EDASFVHFNQESTCDLRGLFNVEGASGHLRTREGIKSCVKAGDSVRLLLRATDEGTPPQSKDAEFFL 935          
BLAST of Protocadherin-1 vs. TrEMBL
Match: K1P7M1 (Protocadherin-11 Y-linked OS=Crassostrea gigas OX=29159 GN=CGI_10008007 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 3.229e-63
Identity = 254/976 (26.02%), Postives = 429/976 (43.95%), Query Frame = 1
Query:  235 RLYIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICP--QLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS---EKVTKPFSLRY-----NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNE-AKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVI----YRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIH----DQDCTSDVIV-----NITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELSFLTTPRQ--GENI-LDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFTL-VAVVPXXXXXXXXXXXXXXXXVVRRQNARNKNRRTQIN--------SKTIESLSRKQC------HMSNPKEKL------LQTKIIDNQPNQNI-------EMQHNIDTLDLTQTKPLPKVSYQCLVTND----MDMCSADSGEGASEDD 2976
            R+Y + + +S F    +     + +++ E  P  T IG+++    +  + +       +   +  E    +F ID T+G +  +  VDRE +CP   +   S   S    +      + ++I I D ND+ P+F  S++ + + EST +G    +  A D D+  N    Y L S   E+   PFSL +       SV+ L V   LD E  D+Y L +   D G P      LV + I DVNDN P+     Y   + ED PVG +IL + ATDLDS K   ++Y+ ++  +E  K+ F+ID  TG + + +PL     N ++ ++EA D G  P   +  + + V+D  N+ P+I +T            P   +    E+      I  +VV D+DS  NG V C           ML + Y     +    Y++      + E      + I C D+G    +STHT    ILD N+    F+ + Y  S+ EN       + +     DQ    +V       N+T  Y         +T ++      D ET  +  F +   +KGP    L+ST +  + +ID ND AP  LE    F ++E    G+ +G + A D DE +N    F        + G + F +  DG +K T  LDREK+ +Y   +  TD G P  S++  + I++ D NDN+P+++FP   +N +  S  T+ G +I R+ A+D D   +  ITY I   N ++ FY +   G++       +  G+   L  VA D G+  ++ +   F+ ++        G D+L S S   + + +V + + + +   I+  + ++R  +   KN++  +         S T E +S+            +P  K+      +    I+ +P   +       + + N    +    +PLP      +  N     M+  ++DSG G S+D+
Sbjct:    2 RMYSVFLCVSIFASCIVGEDINVVYSIDEETPNGTYIGNVAMDSNLRSQMTKSDFETLTFSLLSGESYVSMFTIDETSGNLYTARVVDREKLCPFTAVCKISFEASAKSTIRSFFTKIKLVIYIQDINDHSPVFPRSSMSLEIPESTLIGNSFTIDGAKDADTSPN----YTLNSYTLEQSDSPFSLSFVQNLDGTSVVKLVVDKELDREVQDSYNLVVIAADGGNPPRSERLLVNVRITDVNDNAPMLSSTIYNVSVKEDEPVGSIILTLKATDLDSGKNAEIRYRLSNHQSENIKQLFEIDEITGQLRIAKPLPYNDGNPYRVIVEASDLGDQPLTVQASVKVLVEDSANNPPEIHVT----------LLPTSDIARISEDASVGAVIAHVVVIDRDSGMNGYVTC-----------MLDYPYFKIDRLEVNEYKVTVAQPLDREQLPNHTITIVCRDAGTPSLTSTHTFTAIILDSNDNAPKFSSNIYQGSIPENNRKGTQVIQVQATDVDQGQNGEVQYQLLQNNVTQQY---ELAIDSSTGKVTTGITFDRETTPTFVFKVIASDKGP--TTLSSTATVMVKVIDENDVAPAFLEKVFLFKVSEQKAAGTVVGRLIARDFDEGVNGEFEFYA------ESGTQPFEVAKDGVVKTTMSLDREKQEVYDFTVFVTDKGQPPKSSSARVKITIDDENDNSPKFVFPSSTNNTVMVSQNTKPGAIIARIRAVDPDKEQNGEITYSIEGANFSEVFYSNNHTGDIIAKKGLEEYSGQTFSLVAVARDLGSAFQATRVEFFVRVA--------GADYLDSTSQTNITIVIVLVTVTLALSGFIILTICIIRWLDHNRKNQKDIVKVEKTFSSPSDTTEEVSKLSIANRYIEGADDPSRKISNISRYVDHSEIEKRPRNQVTFAPYTKDEETNFSVPNPVYGEPLPSFPSHQIEDNQSNCSMNSTNSDSGRGLSDDE 933          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A401PYL8 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0015792 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.603e-62
Identity = 220/811 (27.13%), Postives = 377/811 (46.49%), Query Frame = 1
Query:  253 IFLSSFQLVYISCV-------------------NPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVIC---PQLSATSGTCSVT-LLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNIT-----DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            + LSS +L+ + CV                   N + F++ E  P NT+IG+      + + +     R++ +E IG    K   ++D T G +      +DRE +    P         SVT  L   +  +V   ++IVD NDN P F++  I I++ E T  GT + +  ATD D+  NGV  Y +   +    FSL+    +   +  L V   LD E  D Y LT+ V D G P   S+ ++RI +LD+NDN P F++  Y   + E+ PVG  ILQV ATDLD      ++Y FA     A+R  ++D ++G I + RP+   Q   F+F + A+D  P+P  +R  + I V+D N++ P I+I        I        + +  E+   ++ +  + V+D+D  EN  V C +       L     +    K  + L   +  + ES +E ++ I   DSG  P SS++T+ +Q++D+N+   VF ++   +S+ EN   +N  + +   D  S     +T     D   +  F     T ++ + S LD E +    F +   +KG   +   + T     + + +++   +L   +F + E+  P S +G +   D+D+++N+ V    ++  N +  ++N      GTI      DRE++S Y   + A D G P  S   ++TI+VLD NDN P +I    N    + +  T +G  + ++ A D+D  ++ N+TY I+  N    +     G ++    +     G + L +   D G P R     + +Y++D  +N
Sbjct:   38 LGLSSLKLMDLPCVPTLLWLLLFLWPLPVCRAQNSVKFSLPEEQPPNTLIGNPGETLGLEKNN-----RLFKLE-IG----KPFLRVDETGGNLYTTETPIDREDMSCESPMECFLEFEISVTDTLYYTVPVLVEGKVLIVDINDNTPSFSSPVISISIPEHTNAGTIVNIPTATDRDAGTNGVASYEVLGTETHGLFSLQVAEEHGEKLPQLIVTGRLDREQRDTYDLTIRVVDGGKPPRTSTAILRIAVLDINDNAPKFERSSYEGTVEENSPVGTSILQVRATDLDLGDNSQIEYTFAQAAESARRLLRLDKSSGWITVQRPVDREQVSQFKFFVHAKDKAPIPKQDRAAVIITVRDKNDNAPSIEIR------GIGLVTHKDGVANIDEDVSIDSPVAVVQVSDRDEGENAAVTCIVAGDVPFQLKPASGSSSERKKKFFLQTTTPLDYESVQEYLIEIVAVDSGNPPLSSSNTLKVQVVDVNDNAPVFTQNVIHVSLHENNQPYNTIVKVEATDADSGSNAELTYSLHPDSSTQGLFDINPDTGEIRVNSILDREEQEHYEFKVAAADKG-TPSLKGTATVVVNVLDENDNDPKFMLNSYSFSVRENLPPSSPVGMVTVTDADKDMNAQVTL-FVDPDNGEFEIQN----GTGTILSRVSFDRERQSTYTFQLKAVDGGTPPRSAYVSVTINVLDENDNTP-FITQPSNSTFQHMNPLTTIGAQVDQVKAEDMDIGANANLTYSIVGGNPFDLFQVSPGGSVTLEKEILRRHYGLHRLVVRVTDGGTPARFATALVHIYVNDTMVN 825          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A401SS95 (Uncharacterized protein (Fragment) OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0011743 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 3.069e-62
Identity = 220/777 (28.31%), Postives = 372/777 (47.88%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI---CPQLSATSGTCSVT-LLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTS----DVIVNI-TDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNS-IVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESI--YTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFL-----TTPRQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            + F++ E  P NT+IG+      + + +     R++ +E IG    K   ++D T G +    + +DRE +    P         SVT  L   +  ++   I I+D NDN P F++  I I++ E T  GT + +  ATD D+  NGV  Y L   +    FSL+    +   +  L V   LD E  D Y LT+ V D G P   S+ ++RI +LD+NDN P F++  Y   + E+ PVG  ILQV A DLD      ++Y FA     A+R  ++D T+G I +  P+   Q   F+F + ARD  P+P  +R  +TI V+D N++ P I+I        I        + +  E+ P ++ +  + V+D+D  EN  V C +       L     +    K  + L   +  + ES ++ ++ I   DSG  P SS++T+ +Q++D+N+ P +F ++   +S+ EN   +   + +   D  S    ++I +I  D   +  F     T ++ + + LD E +    F +   +KG   +   + T     + + +++   +L   +F + E+  P S +G +  +D+D+++NS I +F  ++  N +  ++N      GTI      DRE++S Y   + A D G P  S   ++TI+VLD NDN P   F  Q  N   + I     +GT + ++ A D+D  ++ N+TY I+S N   F L  I  +   L     +    G + L +   D G P R     + +Y++D
Sbjct:   51 VKFSLQEEQPPNTLIGNPGETLGLDKNN-----RLFKLE-IG----KPYLRVDETGGNLYTTEIPIDREGMNCETPLQCFLEFEISVTNTLYNSVPILMEGKIHILDINDNTPSFSSPVISISIPEHTTAGTIVNIPTATDRDAGTNGVASYELLGSEAHGLFSLQVAEEHGEKLPQLIVTGRLDREQRDTYDLTIRVVDGGKPSRASTAILRITVLDINDNAPKFERSSYEGTVEENSPVGTSILQVRANDLDLGDNSQIEYTFAQAAESARRLLRLDKTSGWITVQGPVDREQISQFRFFVHARDKAPIPKQDRAAVTIAVRDKNDNAPTIEIR------GIGLVTHKDGVANIDEDVPVDSPVALVQVSDRDEGENAAVTCIVAGDVPFQLKPASESSSERKKKFFLQTTTPLDYESVQDYLIEIVAVDSGNPPLSSSNTLKVQVVDVNDNPPIFTQNVIRVSIHENNQPYIPIVKVQATDADSGSNAELIYSIHPDPSIQGLFDINPDTGEIRVNAILDREQQEHYEFKVAAADKG-TPSLKGTATVVVSVLDENDNDPKFMLNSYSFSVRENLPPSSPVGMVTVSDADKDMNSQISLF--VDPDNGEFEIQN----GTGTILSRVSFDRERQSTYTFQLKAIDGGTPPRSAYVSVTINVLDENDNTP---FITQPSNSSFQHINPLAHIGTSVEQVKAEDMDIGTNANLTYSIVSGNP--FGLFHISHDGIILLDKEISRRHYGLHRLVVRVKDGGTPSRFATALVHIYVND 799          

HSP 2 Score: 107.842 bits (268), Expect = 7.543e-20
Identity = 152/581 (26.16%), Postives = 250/581 (43.03%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTI--------INEDHPVGKMILQVSATDLDS--------IKYGLVKYQF---ASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQ-FVIE--ARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN----LPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT--TF-HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDN 2262
            NDN P F  S+    V+E++P+GT +    A D D  DN   EY       +    LR + +  ++ V   +D E    ++  +   D           V I + D NDN P  +      +        I+ED PV   +  V  +D D         I  G V +Q    + +++E K+ F +  TT       PL   Y++ Q ++IE  A D+G  P  +   + + V D+N++ P        F   +++       VS +ENN P   I+ +  TD DS  N  +  S+   + D  I   F+   +    R+ A+   + E ++     ++ +D G      T T+V+ +LD N+    F  ++YS SV+EN    +    + +S  D+D  S + + +        F     T  ++     D E +S+  F ++ I+ G P R+   +  S  I ++D NDN P + +P+  +F HI      G+++  +KA D D   N+ + +    VS N  GL  F I  DG I L KE+ R    L+ L +   D G P    T  + I V D   N
Sbjct:  260 NDNAPKFERSSYEGTVEENSPVGTSILQVRANDLDLGDNSQIEYTFAQAAESARRLLRLDKTSGWITVQGPVDREQISQFRFFVHARDKAPIPKQDRAAVTIAVRDKNDNAPTIEIRGIGLVTHKDGVANIDEDVPVDSPVALVQVSDRDEGENAAVTCIVAGDVPFQLKPASESSSERKKKFFLQTTT-------PLD--YESVQDYLIEIVAVDSGNPPLSSSNTLKVQVVDVNDNPP-------IFTQNVIR-------VSIHENNQPYIPIVKVQATDADSGSNAELIYSI---HPDPSIQGLFDINPDTGEIRVNAI--LDREQQEHYEFKVAAADKGTPSLKGTATVVVSVLDENDNDPKFMLNSYSFSVRENLPPSSPVGMVTVSDADKDMNSQISLFVDP--DNGEFEIQNGTGTILSRVSFDRERQSTYTFQLKAIDGGTPPRS---AYVSVTINVLDENDNTPFITQPSNSSFQHINPLAHIGTSVEQVKAEDMDIGTNANLTYSI--VSGNPFGL--FHISHDGIILLDKEISRRHYGLHRLVVRVKDGGTPSRFATALVHIYVNDTMGN 803          

HSP 3 Score: 92.4337 bits (228), Expect = 4.618e-15
Identity = 137/592 (23.14%), Postives = 243/592 (41.05%), Query Frame = 1
Query:  910 RINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGH-------IFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS-------FNLPLS---IHDQD----------CTSDVIVNITDLYARSHFR----YLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRV--GTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLT--TPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            +I+ILD+NDN P F  P     I E    G ++   +ATD D+   G+  Y+   +  EA   F +     H       I   R    Q   +   I   D G     +  ++ I V DIN++ P  K   S++   +             EN+P  T I+ +   D D  +N +++ +  Q       +L+ +    K    +      + E   +    +   D    PK     + I + D N+           L   ++ V+        + P++   + D+D             DV   +      S  R    +LQ T      + LD+E  S  ++ IEI+        L+S+ +  + ++D+NDN P+  +      I E+ +P   I  ++A D+D   N+ +++  I+   + +GL  F I  D G I++   LDRE++  Y   + A D G P L  T T+ +SVLD NDN+P+++      N  + S+   +   + +  +   D D   ++ I+  +  DN ++   +     LS ++    RQ      + AID G P RS    + + + D++ N
Sbjct:  142 KIHILDINDNTPSFSSPVISISIPEHTTAGTIVNIPTATDRDAGTNGVASYELLGS--EAHGLFSLQVAEEHGEKLPQLIVTGRLDREQRDTYDLTIRVVDGGKPSRASTAILRITVLDINDNAP--KFERSSYEGTV------------EENSPVGTSILQVRANDLDLGDNSQIEYTFAQAAESARRLLRLD----KTSGWITVQGPVDREQISQFRFFVHARDKAPIPKQDRAAVTIAVRDKNDNAPTIEIRGIGLVTHKDGVANIDEDVPVDSPVALVQVSDRDEGENAAVTCIVAGDVPFQLKPASESSSERKKKFFLQTT------TPLDYE--SVQDYLIEIVAVDSGNPPLSSSNTLKVQVVDVNDNPPIFTQNVIRVSIHENNQPYIPIVKVQATDADSGSNAELIY-SIHPDPSIQGL--FDINPDTGEIRVNAILDREQQEHYEFKVAAADKGTPSLKGTATVVVSVLDENDNDPKFML-----NSYSFSVRENLPPSSPVGMVTVSDADKDMNSQISLFVDPDNGEFEIQNGTGTILSRVSFDRERQSTYTFQLKAIDGGTPPRSAYVSVTINVLDENDN 697          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 224.172 bits (570), Expect = 1.212e-59
Identity = 218/783 (27.84%), Postives = 351/783 (44.83%), Query Frame = 1
Query:  286 SCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVI--CPQLSATSG-----TCSVT-LLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS-EKVTKPFSLRY----NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVN-----ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            S +  I++ + E  P NT++G ++A + + +        +Y +E  G        ++D   G I    + +DRE +  C  L            S+T L+      ++   I I DENDN P F +  + + + E+T +G H  +  A D D+  NG+ +Y+L S       FSL+     +  V  L V+  LD E  D Y L++ V D GTP   SS L+RI I D NDN P F++  Y   + E+ PVG+ +LQV A D D    G V Y F   +   +R   ID  TG I +   +   +    +F ++ARDNGP    ++ ++TI VKD N++ P I+I      A          + +  E+ P  T +  + V+DKD  EN  V C +       L     +   +K  Y L   +  + E  KE  + I   DSG    SST+++ +Q+ D+N+   VF+ S Y +   E     +  L +   D  S          ITD   +  F     T ++ + + LD E K    F +E  +KG   +   + T     +   +++   +L   +F + E+  P S +G +   D+D+  N+ V    +   N K  ++N      GTI  +   DREKES Y   + A D G+P  S+   ITI+VLD NDN P    P  +  K  + + T   T + ++ A D+D   +  + Y I   N    F +    GE++     T    G + L +   D G P R     + +++++
Sbjct:   30 SSLASITYQLREEQPPNTLVGSLAADQGLPDTG-----HLYKLEVGG-----PYLRVDGKTGDIYTTDVPIDRETLKDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAH------EDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKG-VPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQL-SVEPENGKFVIQN----GTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPL-TSPDTRVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFVNE 789          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 220.32 bits (560), Expect = 1.693e-58
Identity = 217/785 (27.64%), Postives = 358/785 (45.61%), Query Frame = 1
Query:  286 SCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTC------SVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS-EKVTKPFSLRY----NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD-----VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            S +  I + V E  P NT+IG ++A + + +        +Y +E +G        ++D   G I    + +DRE +          C      SVT L+   +  +    I V + NDN P F +  + ++V+E+  +G    +  ATD D+  NGV +Y L++  + +  FSL+        +  L V+  LD E  D+Y LT++  D GTP   SS L+R+ I D NDN P F+K  Y   ++E+ PVG  +LQV A D D    G ++Y     ++   +  QI+ +TG I +  PL   +  +F+F + ARD GP P  + T ++I V D N++ P ++I              +  + +  E+ P  T +  + V+DKD  EN  V C +       L     + ++NK  Y L   +  + E  ++  V I   DSG    SST+++ +Q+ D N+   +F+   + +   E        L +   D  S      V   I D   R  F    ++ ++   S LD E K    F +   +KG   HR    + T     +   +++   +L   +F + E+  P S +G +   D D+  N+ V   +++V  +   + NF +++  GTI  +   DREKES Y   + A D G P  S+   +TI+VLD NDN P    P  N +    S      +V+  + A D+D  S+  + Y I   N  + FY+ P  GE+     LT    G + L +   D G P R     + +Y+++
Sbjct:   20 SALGGILYHVREEQPPNTLIGSLAADQGLPDSG-----HLYKLE-VG----APYLRVDGKTGEIFTTEIPIDRETLK-DCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTH------SDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRG---TATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQV---QLSVEPD---VGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP-SNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 777          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 220.705 bits (561), Expect = 2.693e-58
Identity = 215/785 (27.39%), Postives = 361/785 (45.99%), Query Frame = 1
Query:  286 SCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTC------SVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS-EKVTKPFSLRY----NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSI----HDQDCTSDVIVN-ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            S +  I + V E  P NT+IG ++A + + +        +Y +E +G        ++D   G I    + +DRE +          C      SVT L+   +  +    I V + NDN P F +  + ++V+E+  +G    +  ATD D+  NGV +Y L++  + +  FSL+        +  L V+  LD E  D+Y LT++  D GTP   SS L+R+ I D NDN P F+K  Y   ++E+ PVG  +LQV A D D    G ++Y     ++   +  QI+ +TG I +  PL   +  +F+F + ARD GP P  + T ++I V D N++ P ++I              +  + +  E+ P  T +  + V+DKD  EN  V C +       L     + ++NK  Y L   +  + E  ++  V I   DSG    SST+++ +Q+ D N+   +F+   + +   E        L +     D    ++++ + I D   R  F    ++ ++   S LD E K    F +   +KG   HR    + T     +   +++   +L   +F + E+  P S +G +   D D+  N+ V   +++V  +   + NF +++  GTI  +   DREKES Y   + A D G P  S+   +TI+VLD NDN P    P  N +    S      +V+  + A D+D  S+  + Y I   N  + FY+ P  GE+     LT    G + L +   D G P R     + +Y+++
Sbjct:   56 SALGGILYHVREEQPPNTLIGSLAADQGLPDSG-----HLYKLE-VG----APYLRVDGKTGEIFTTEIPIDRETLK-DCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTH------SDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRG---TATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQV---QLSVEPD---VGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP-SNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 813          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 214.157 bits (544), Expect = 1.991e-56
Identity = 213/789 (27.00%), Postives = 358/789 (45.37%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKR---IYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTCS----VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQGENILDIVAI---DNGNPVRSNQTRL-FLYISD 2562
            + + E   +N +IG++     +S  ++A       +Y + S   +    L ++    G I   S  +DRE +CP  S     CS    V +L      ++ I I++ D NDN PMF +  I I++ E+T + +   +  ATD D   N V +Y L + +       V  P   ++      L V   LD E  D Y + + V D G+P+  S+ ++++ + DVNDN P+FK+ +    I E  PVG  ++Q+ ATD D      +KY F +  + A +R F ++ TTG I + RPL   +  N +  + A D     +  R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   D    LK  Y N    Y L   +  + E  KE +  I  SDSG+   + T  + +++ D N+ P +F +    L+V EN          + +D     I    +   R+     Q       F   D + K+ +  +  + ++     FL + T+       +   A V++         P        F ++E+    S +G I   D+D   N++V    +N +      ENF ++   G IK     DRE++S Y   + A D G+P  S+   +TI+V+DVNDN P  I+P  N +     +    G+V+  + A+D D   +  + Y I++ N K  F + P+ G ++    P + ++ L  + +   D G P   +   L FLY+++
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDN--PLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGS--SSSARATVTINVTDVNDNAPNIDLR--------YIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEK---DVPFHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSEN----------NKRDLYLTTITATDEDSGRNAEIVYQLGPNASFF---DLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDN------ENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVLVFLYVNN 775          

HSP 2 Score: 69.3218 bits (168), Expect = 1.966e-11
Identity = 142/608 (23.36%), Postives = 243/608 (39.97%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANC-----------ESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN--------KSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITD-----LYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYF---YLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D     + KY+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P  K  ES     I             E++P  T ++ +  TD D   N  ++               F    +    RL AL+S              E+    + V++   S     S+  T+ I + D+N+     +          T  LS K+  NT    + +S  D D    VI  I       L A    +YL  T  L     LD+E      F I   + G  +  L  T    + + D NDN P+  +P     ++E+ K    + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE +  +   + A D G   L +   + +++LD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  ++  I++DN  +    Y   IK  +SF    +Q     D+ A+D+G+P  S+  ++ + + D  +ND
Sbjct:  123 RLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFK--ESQIEVHIP------------ESSPVGTSVVQLQATDADVGANAEIK-------------YMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSS---SSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSAL-----LDYEGTKEYIFKIVASDSG--KPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSF-DREQQSSYTFDVRAVDSGHPPCSSAAKVTINVID--VND 669          

HSP 3 Score: 65.855 bits (159), Expect = 2.191e-10
Identity = 73/293 (24.91%), Postives = 129/293 (44.03%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPK---YFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL 1134
            I  TV+EN  ++  +  ++A  + S +++ I+ ++    S         F +D   G++ AS   DRE        +  + + T    S   ++  + D          +NDN P F +++    V E+ P  + + +   TD D+ +N V    + ++    +  P++  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN PI   P     F ++      G ++ +V A D D+     +KY   + NN  K  F+IDP TG+I L
Sbjct:  473 IELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILD----------QNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVS---------FDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN--KGLFRIDPVTGNITL 736          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 213.772 bits (543), Expect = 3.066e-56
Identity = 213/789 (27.00%), Postives = 358/789 (45.37%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKR---IYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTCS----VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQGENILDIVAI---DNGNPVRSNQTRL-FLYISD 2562
            + + E   +N +IG++     +S  ++A       +Y + S   +    L ++    G I   S  +DRE +CP  S     CS    V +L      ++ I I++ D NDN PMF +  I I++ E+T + +   +  ATD D   N V +Y L + +       V  P   ++      L V   LD E  D Y + + V D G+P+  S+ ++++ + DVNDN P+FK+ +    I E  PVG  ++Q+ ATD D      +KY F +  + A +R F ++ TTG I + RPL   +  N +  + A D     +  R  +TI+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   D    LK  Y N    Y L   +  + E  KE +  I  SDSG+   + T  + +++ D N+ P +F +    L+V EN          + +D     I    +   R+     Q       F   D + K+ +  +  + ++     FL + T+       +   A V++         P        F ++E+    S +G I   D+D   N++V    +N +      ENF ++   G IK     DRE++S Y   + A D G+P  S+   +TI+V+DVNDN P  I+P  N +     +    G+V+  + A+D D   +  + Y I++ N K  F + P+ G ++    P + ++ L  + +   D G P   +   L FLY+++
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDN--PLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGS--SSSARATVTINVTDVNDNAPNIDLR--------YIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEK---DVPFHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSEN----------NKRDLYLTTITATDEDSGRNAEIVYQLGPNASFF---DLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDN------ENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVLVFLYVNN 775          

HSP 2 Score: 69.3218 bits (168), Expect = 2.202e-11
Identity = 142/608 (23.36%), Postives = 243/608 (39.97%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANC-----------ESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN--------KSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITD-----LYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYF---YLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D     + KY+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P  K  ES     I             E++P  T ++ +  TD D   N  ++               F    +    RL AL+S              E+    + V++   S     S+  T+ I + D+N+     +          T  LS K+  NT    + +S  D D    VI  I       L A    +YL  T  L     LD+E      F I   + G  +  L  T    + + D NDN P+  +P     ++E+ K    + +I A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE +  +   + A D G   L +   + +++LD NDN+P++       F  +N  K     Y+ VG VIT     D D   +  ++  I++DN  +    Y   IK  +SF    +Q     D+ A+D+G+P  S+  ++ + + D  +ND
Sbjct:  123 RLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFK--ESQIEVHIP------------ESSPVGTSVVQLQATDADVGANAEIK-------------YMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSS---SSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSAL-----LDYEGTKEYIFKIVASDSG--KPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSF-DREQQSSYTFDVRAVDSGHPPCSSAAKVTINVID--VND 669          

HSP 3 Score: 65.855 bits (159), Expect = 2.390e-10
Identity = 73/293 (24.91%), Postives = 129/293 (44.03%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPK---YFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL 1134
            I  TV+EN  ++  +  ++A  + S +++ I+ ++    S         F +D   G++ AS   DRE        +  + + T    S   ++  + D          +NDN P F +++    V E+ P  + + +   TD D+ +N V    + ++    +  P++  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN PI   P     F ++      G ++ +V A D D+     +KY   + NN  K  F+IDP TG+I L
Sbjct:  473 IELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILD----------QNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVS---------FDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN--KGLFRIDPVTGNITL 736          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 203.371 bits (516), Expect = 6.902e-54
Identity = 228/807 (28.25%), Postives = 364/807 (45.11%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGTCSV-----TLLVTXXXXXXXXXXXXXXE--NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL--TSEKVTKPFSLRYNLS-----VIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQF------ASTNNEAKRWFQIDPTTGHI----FLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIML-KFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTV--SFNLPLSIHDQDCTSDV-IVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFT 2619
            +S+ V E   +   IG+ S   ++++ +  +  ++  + S   +    L +++P  G +  A   +DRE +C         C V      L V        I + I  E  NDN P FA   + ++V E+ P G    ++ A D DS  NGV  Y L  +       F L    +     V YL V   LD E    Y++ L   D G+P H  S ++RIN+ D NDN P+F + +    I E+ PVG  ++Q+ A+D D+     V Y+       A +    KR F++D  +G +     L R  S  Y+    +I A D GP P      +T+ V D+N++ P I+I +      IV   P   ++   E +  N  +  I V+D D   NG V C +  +N +    L K  Y N    Y L    + + E++ E +V I  +D+G    S T ++ I++LD N+   VF + TY +SV EN V     + +S  D+D   +  +V      A + F     T  + L   LD E K+  N+S  I+ K      L    +  + ++D+NDN P   L    F++ E+    S +G +   DSDE  N  V    +   N  R L +   ES G I+     DRE+   Y L + ATD G PV S+T  + I V+D+NDN+P  + P  N         T  GT++T + A+D D   +  + YHI+  N    F++ P+ G ++    LT    G + L +   D G  V+ +   L     ++++ +    ++L + S  T
Sbjct:   39 VSYRVAEELREGAFIGNPSVDLRLADYNLELTYKV--MLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGD-ECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYR---IIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRD------IV--APVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYI--YNPEVPFQLKKLTYPNQ---YLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKA--NYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDN--RQLFSIDPES-GMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENATYIEWLIAGSLQT 821          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 180.259 bits (456), Expect = 1.018e-46
Identity = 189/693 (27.27%), Postives = 314/693 (45.31%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMS--AYRKVSEKSSA---IMKRI-YSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXE---NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL-TSEKVTKPFSLRYNLSVIYLEVV--HVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFAS-TNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIK---ITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTV--SFNLPLSIHDQDCTSDVIV--NI--TDLYARSHFRYLQ---ATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEP------TTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELD----REKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNN 2265
            + + + E  P  T++G +S     +V+E  S    +M+R  +S           L  ++  +G + A   +DRE  C Q  A S      +L T+   +  ++   V+    ND+ P FA S + + + ES  LGT + L+ A D D   N +  Y L  +E+       R +    Y E+V    LD E    Y L L+  D G P    + LVRI +LD NDN P+F +      + ED   G ++L ++ATD+D    G V Y F+S  + E +R FQ+DP TG + L   L  +    ++  I+ARD GP        + +HV+DIN++ P+IK   I +S  +   V  G      + YE+      +  + V+D DS ENG V C +       L+  + +Y+       +V  SS + E   +  +V+  SD G  P+ +     +++LD N+    F++STY  S+ EN    ++   ++  D D   + ++  N+  +++   S   Y+    ++  +     LD+E  +S+ F ++  + G  P    L +  +  + I+D NDNAPV+  P          +  D   G  +  ++A DSD   N  + ++   V  N+R L  FRI   G    T            + + L ++  D G+P LS T  I I V    D +
Sbjct:   31 VKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFS-----------LVHVEEADGTVSAREVIDREQQCGQ--APSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTD-GAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEG------AAYESF-----VGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYV-------VVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPP----LVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRI--VQGNERNL--FRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGD 683          

HSP 2 Score: 69.3218 bits (168), Expect = 3.657e-12
Identity = 94/431 (21.81%), Postives = 172/431 (39.91%), Query Frame = 1
Query: 1231 IHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIH----DQDCTSDVIVNIT---DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGP-----HRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI---ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN------AKYFYLHPIKGELSFL 2460
            + + DIN+H PD   +E                V   E+    T +      D D   N      +++ N  + + L+      K    LV  S  + E   E  + ++  D G+ P+S T  + I +LD N+   VF +++ +++V+E+     + L+++    D+    +V+ + +   D   R  F+    T +L L   LD E  S    SI+  + GP     H   L           +I  +  +     T  ++E     S +G +  +D D   N +V         + RG  +F++     D  +     LDRE+ + Y+L + A+D G P        T+ +LD NDN P++       + +  +     G  +T + A D D   +  I Y+++         + Y  ++P  G +  L
Sbjct:  124 VELLDINDHAPDFARSEMH--------------VEISESVALGTRVPLEGARDLDVGGNALRAYHLDE-NERFGLALRARTDGAKYA-ELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVAC-------HLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENN---SPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYAL 528          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.948 bits (450), Expect = 2.415e-45
Identity = 188/735 (25.58%), Postives = 328/735 (44.63%), Query Frame = 1
Query:  304 SFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-------YKNFQFVIEARDNG-PVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNL--PLSIHDQDC--TSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKS--SINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF-HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDRE-KESLYYLPILATDLGNPV---LSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFY 2427
            SF V EN    T++G +SA     + ++ +   I S +  G+      F I+ + G I  +  +DRE        +       +G  SV++LV  +             N++ P+F  ++  +++ E  P+ +  +   ATD DS  NG  +Y +      + F + +    +Y  V + LD ET + Y LT+S  D G     SS  V + +LDVNDN P+F    Y     E+  VG ++  V ATD D+   G V Y F     + +  F++D  TG I  +R    +         +F F + A D G P P  +R  + + V+D+N++ P  +  +S + A + ++  N             T ++ +  +D D   NG ++ ++ + N       KF    +    ++  L S + E      +V+S +DSG  P +++ T+ +Q+LD N+ P  F +S  S+   E+T    L   L+  D+D   + DV   I      + F   ++T  + L   LDFET+    +N S E   + P  +     T   + + D NDN P  L    F  I E+   G+ + ++ A D D ++N  + +   +++       +F I+ + G I    E+DRE    L+ + + ATD   PV    S    +T+ V D NDN P+++ P      + + +    G+V+  L A D D+  +  + Y +   +A   +
Sbjct:  664 SFVVFENVAPGTLVGSVSA--STLDLNANVTYLIVSGDQRGS------FSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDV-------------NNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGI-FPDGQLY--VRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF----EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPP--QFAKSVYQASVSESASNL------------TQLLRVTASDVDEGVNGALRYAINEGNEGG----KFTV--DASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSS----ATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHY---SIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTA---ILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILF 1340          

HSP 2 Score: 138.658 bits (348), Expect = 3.541e-33
Identity = 169/659 (25.64%), Postives = 281/659 (42.64%), Query Frame = 1
Query:  610 NDNPPMFANSNIV-INVKESTPLGTHLYLKHATDFDSLDNGVGE--YRLTS---EKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSD-ENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKP--KSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDV-------IVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHIT--EDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI---LDIVAIDNGN 2517
            NDN P F    ++ +  KE   +G  + L  A D D   NGV    Y++ S   E    P       + ++L     LD E   +Y L +   D G+P+      V + + D NDN P F+KP Y   + ED PVG  +      DL     G +   F             DP TG +   +PL  +  + +   + A D G  P   R    I + D+N++ P I         + V   P     S  E+  P T    + VTD DS   NG +  S+   N     +L    +    + ++   S  + E      + I  SD+G KP  +S+T ++V+ + D+N+    F  S Y+ ++ E   + +    +   D  S +       IV+  DL     F   ++T  +     +D E  SS+  +I   ++G       +  +     +   ++ P L   T +  T  E++ PG  + S+ A DSD   N  V +   +     +  E FR++S  G +   K LDRE+   Y L + A D G+P L +T  +T+ V D+NDN+P + +P+Q    I E+     GT +T + A D D  ++  + Y + + +A  F ++ + G +S   +  + E     L + A+D G+
Sbjct:   17 NDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPF-------------DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAI---------RFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVA--SQLDRERIPMYNLTILASDNG-KPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL---GWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPK---TAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY-NFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPVQYFASILEN--EPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGH 635          

HSP 3 Score: 132.88 bits (333), Expect = 2.235e-31
Identity = 156/582 (26.80%), Postives = 257/582 (44.16%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY-FTIINEDHPVGK----MILQVSATDLDSIKYGLVKYQFASTNNE--AKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEAR--DNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVS-FYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPK---SSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLP-LSIHDQDCTSDVIVN---ITDLYARSH--------FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW 2274
            NDNPP+FA   + + V+E+T  G  ++   ATD D   N +  Y + S       +   + +   L     LD E   +Y LT+   D GT  H +   + + + D NDN P F +  Y F +  +  P GK    +I  V A D DS  +G V Y  A + +   A   F + P TG + + RPL  + +   +V+ AR  D G +    R  + ++V D N++ P ++               N SL +   E+ PP T ++ I  TD D   N  ++ S+   + +     +F   N+  +    AL   + E +    +V+  SD    P    SS   + + + D+N+    F     +L+ +++ V   +  +   D D   +  V     TD              F     T ++ L   LD E + S   ++  ++KG  R  LTST +  +T+ D NDNAP          I ED  PG+ +  + A D DE  N  + +     S +  G  +FR++   GT+ + + LDRE+ + Y L + A D G P  S T ++ +++ DVND +P +
Sbjct: 1510 NDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLS---GSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD-GT--HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRAC-YVLRARATDGGGLAATAR--LYVNVLDANDNAPSVQ---------------NDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEG----RFAVGNDGQLSVARAL---DRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKG--RPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDI--ASGDPTG--DFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAF 2054          

HSP 4 Score: 131.724 bits (330), Expect = 4.560e-31
Identity = 189/757 (24.97%), Postives = 322/757 (42.54%), Query Frame = 1
Query:  445 LFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXEN---------DNP-PMFAN---SNIVINVKESTPL-GTHLYLKHATDFD--------SLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGT-----PKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSME-QFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNF-LXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQ-----KINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQN-DNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIIS-DNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            LF++D   GII+ S  +DRE         SG  + TL V  +            EN         ++P P F     S I +   ++ P+  ++L+L+H  D++        +L  GV         +  P+ + ++L+   + +V            L  S+ D G      P   S   V I++ DVNDN P+F  P+    + E+   G++I  +SATD D  +  LV Y   S +  A   F +D  +G +   R L  + + ++   + A D     +     +++ V+D N++ P       +F+         K+  +          I  ++  D DS   G V  ++    +SDW       +  + V   L      + ESR   ++    +D G    ++T  + + +LD N+  P+V N S  +  V E+    T    +  +  D+   +++  +I+       F  +    QL +   LD E +S  N  + + ++  H    L+S     + + D+NDNAP    P +    ED+  G+ + +++A D D   NS V +      +        G   F + +  G ++L +ELDRE    Y L +LA D G P L++T T+ ++V D NDN P+  FP +  +  I E      GT + RL A D D+ ++  + Y I S D    F L P+ G L+    L   R     L + A D G P RS+   + + +SD  +ND
Sbjct: 1339 LFRLDRRTGIIETSTELDRE---------SGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDYESPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVF---------SSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGA---FVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAV---------IGTVLAGDADSGPFGEVTYALAPSEDSDWA---DGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGL--AATARLYVNVLDANDNAPSVQNDS-LAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRF-AVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPR--FPRREYEAAIAED--EPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSD--VND 2049          

HSP 5 Score: 129.028 bits (323), Expect = 2.828e-30
Identity = 185/751 (24.63%), Postives = 322/751 (42.88%), Query Frame = 1
Query:  319 ENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREV-------ICPQ-LSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHV--LDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSD--WLIMLKFNYINNKVIYRLVALSSANCESRKE------VMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE----NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVV--FQKINVSNNKRGLENFRIESD-GTIKLTKELDREK------ESLYYLPILATDLGNP-VLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELSFLTT 2466
            E  P  + + D++A    S  ++ +   I S   +G       F +D + G++     VDREV       I  Q   A   T   +L VT+++            ND PP+F  +  V    E++  G  +    A D D  +NG   Y    +   + +   + L  +  +V  +  LD E  + Y L +   D G+P   S+  V + + D+NDN+P+F   +YF  I E+ P G  +  V+ATD D    G V+YQ   T  +A R FQ++  TG +     L  + +  +Q  + A D G +   +  ++TI V D  +  P     + +F                +EN  P T +             G V  S    N++  +LI+      +  + +    + +AN   R+E       +V  S   +GE       ++ + + D+N    VF++++Y +S+ E    N+  F++  +  D     +V   I +      F      Q  V +  LD ET+   + ++  ++ G     L+S+ +  +T++D+NDN P+    +  FH  E+ + GS +G+++A D+D   N  V   F+K  V        NF ++S+ G I   +  DRE        + +   ++ATD G P  L    T+ + V DVNDN PQ+   +     ++ES      T + R+ A DVD+  +  + Y I   N    F +    G+++ L +
Sbjct:  352 EGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG------WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDV-----------NDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQ-YREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL--TAGDAAR-FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSF--------------VVFENVAPGTLV-------------GSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEA------SVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRY-ELDRETREEYSLTVSAMDTGVEP--LSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQV--------NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQ-ASVSESASNL--TQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGS 1034          

HSP 6 Score: 112.079 bits (279), Expect = 4.219e-25
Identity = 93/369 (25.20%), Postives = 153/369 (41.46%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGT-PKHCSSQLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFAS-------TNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT 1683
            NDN P   N ++   V E  P GT L    ATD D   N   E+ ++S      F++  +     L V   LD E    Y L + V D    P    S  VR++++  DVNDN P F  P+   +  ED PVG ++  V A D DS +   V+Y  A+               F ++  TG + L+R L  + + ++   + A D G  P  +   + + V D N++ P  +     + A I             E+ PP T+++ +   D D   NG ++  +   +      L      + V+  L      + E      + +   D G   +S T ++ + + D+N+    F  S Y++  +ENT
Sbjct: 1723 NDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQ---LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRS-ALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAP--RFPRREYEAAIA------------EDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRL------DPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENT 2067          

HSP 7 Score: 103.605 bits (257), Expect = 1.768e-22
Identity = 69/244 (28.28%), Postives = 113/244 (46.31%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLR-----YNLSVIYLEV--VHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGP 1317
            NDN P F +    +   E +P+G  +    A D DS  N   EY L ++              + L+ +  EV  V  LD E   +Y LT+   D G P   S+  + + + D NDN P F + +Y   I ED P G  +L++SA D D    G ++Y  AS +      F++DP  G + + RPL  +   +++  + ARD G     +   + + + D+N+  P  +++  T +A+    GP
Sbjct: 1830 NDNAPAFTSPRSAL-APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGP 2070          

HSP 8 Score: 98.9821 bits (245), Expect = 4.189e-21
Identity = 163/689 (23.66%), Postives = 274/689 (39.77%), Query Frame = 1
Query:  259 LSSFQLVYIS-----------CVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQL---SATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKE-STP--------LGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVI--YLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNV---NRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSME-------QFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTK-PGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATD 2196
            +SSF  V IS            V  +   V EN  +  +I  +SA     +  +A++   YS+ S G+E     F +D  +G+++AS  +DRE     L    A+ GT +    +++              NDN P F+      +V E + P        +GT L    A D DS   G   Y L   + +      + L  +   L V   LD E+   Y L     D G     ++  + +N+LD NDN P  +       + ED P G  +L++SATD D      +++  +S + E +     D   G + + R L  + ++F   V+   D    P     +   +++ + D+N++ P               T P  +L    E++P    +  +   D DS  N  V+ ++                    N +  +V  RLV     + E+R+   + +   D G  P +ST T+ + + D N+    F +  Y  ++ E+    T    L     D+    ++  +I        FR       L +   LD E  +S   ++   + G P R+    T S  +T+ D+ND +P   L P T H  E+T+ P   I  + A D D   +  V +     ++       F +  DG + L + LDRE +  + L I ATD
Sbjct: 1496 MSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSAT-DADQGQNALV--TYSVLS-GSEGA---FVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDA---------NDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVL----AGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND---GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-------------TSPRSALAP--EDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEV--RLV--RELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARS---DTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGG----AFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 9 Score: 82.0333 bits (201), Expect = 6.761e-16
Identity = 139/587 (23.68%), Postives = 241/587 (41.06%), Query Frame = 1
Query:  907 VRINILDVNDNYPIFKKPKYFTI-INEDHPVGKMILQVSATDLDSIKYGLVKYQFA-STNNEAKRWFQIDPTTGHIFL----IRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAV----FNKSTYSLSVKENTVSFNLP--LSIHDQD---CTSDVIVNITDLYARSHFRY----LQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKP-GSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISD-NAKY---FYLHPIKGELSFLTT---PRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            VR+ + DVNDN P F +P    +   ED  VG+ +L  +A D D    G+  + +   + NE  R     P T   FL      PL  +   ++   ++A D G      R  + + V+D N++ P  +  +  + A + +  P  + +                   +D    GR             + + F+     V  R       + E+R++  + +  +D G  P S   T VIQ+LD+N+  PA+       +  S SV E+     +   +++ D D      ++ V+I     R HF      +   + L + S LD E     N +I   + G      ++T S  + + D+ND+AP            +  P GS +  + A D+D  LN+ + +    VS N  G   F + ES G +    ++DRE  S   L I A D G    +   ++T+++LDVND  P +         +  S+    G  +  + A D D   +  + Y+   D  A+Y   F L  + G+++ L +       E  L + A D G+P   +  ++ + + D  +ND
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFE--KPAYRASVAEDSPVGAAL-------------------RDLLHRGR-----------GPLAVPFDPKTGMVSTR----QPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNG-KPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI--VSGNDLGW--FSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSL---PGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGD--LND 549          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 8.605e-40
Identity = 173/675 (25.63%), Postives = 283/675 (41.93%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKV----TKPFSLRYNLSV-----------------IYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTI-INEDHPVGKMILQVSATDLDSIKYGLVKYQFAS--TNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF---QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVF--------NKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYL----QATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD---GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVI-TRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTT 2466
            ND+ P F   ++ +++ ES  +G  + L  A D D+  N +  YR+++         PFSL  +                      LE+   LD E   +Y+L L   D G PK   S L+ I ++D NDN P+F  P    + I E   VG  ++Q+ A D D+   G + Y F +  T+   +    +D TTG + +        +     + V+ ARD G +       +T+ + D N++ P  ++       + +  G     V   EN P  T ++ I V+D D   +G V   +E      L         NKV + L      + E  ++  V +  +D G    S    ++I ++D+N+   VF        + + Y +S++EN    TV  NL  +  D      +   +++L        L      T QL L + LD E +     S+E  + G P R    +     +T++D NDNAP  +  +        F + E+T  G+ +G++  +D DE  N+ V    +     + G +      D   G ++    LDRE    Y L + A D G P LS +  ++I+V D NDN P    P  ND   +   ++  G ++   + A D+D   +    Y II  N K  F L+   G LS   T
Sbjct:  138 NDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVI--ALQGEYLPDGG----VKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELAS------PNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRK---ARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVR----EAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLART 793          

HSP 2 Score: 88.1965 bits (217), Expect = 6.972e-18
Identity = 135/625 (21.60%), Postives = 256/625 (40.96%), Query Frame = 1
Query:  907 VRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDP---------------------TTGHIFLIRPLSTQY-----KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMV---VISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN----KSTY----SLSVKENTVSFN--LPLSIHDQDCTSDVIVNI-------TDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH---------ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIY---TRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGE----------LSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            V++ + D+ND+ P F+ P     I+E   VG+ +    A D D+    +  Y+ ++ + +     Q+ P                       GH  L+  L  Q       +++ ++   D G        L+TI V D N++ P             V   P    V   E++   T ++ +   D D+  NG +  S   F++    +     ++      LV + +A    R+ + V   V+   D G+  +S++ T+ +++ D N+   VF     +  Y     + + EN  S    + +S+ D D  S   V++        +L + +  ++L  T +L     LD+E     N S+   ++G  +  L+   +  I+++DINDN PV + P +           + E+   G+ + ++ A D+D   N  + F    ++  +   E F +    G + L   LDREK   Y L + A D G+P       + ++VLD NDN P ++    + N + +      T VGT +  +   D+D+  +  +  +++ +    +    I G           L  L    + +  L + A+D+G P  S   R+ + +SD + N
Sbjct:  130 VQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDG---LQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLE-LREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAP-------------VFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYS---FHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRL-----LDYEEAQQYNVSVLAADRGTPK--LSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDW----IGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDN 723          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 6.806e-35
Identity = 162/642 (25.23%), Postives = 269/642 (41.90%), Query Frame = 1
Query:  532 SGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIG-TPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNL-PLSIHDQDCT--SDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWI-------FPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY 2421
            +GT +VT+LV              DENDN P F  + +   V E  P+G+ + L +ATD D+  N +  YRL        FS+  N S   +     LD E  ++Y L ++  D G TP   SS  + + + DVND+ P F    Y        P G  +  V+A D D+   G +++   S +  A   F +DP  G I   R L     +    +   D G  P    T +T+  +D    +P              +  P     SF E+ PP T I   VV  + S   G V   +    +   +           ++R +     + E +    +V+   DSG  P S+   + + +LD+N+    F+ S +   V ENT    +  L+  D+D      V  +I D    + FR    + ++   S LD E  +S   +++  ++G        T    I++ D NDN+P   +  + H+ ED   G  +  +   D+DE  N+ + F  ++ S        F I  S G I +++ L+RE  S Y + + A+D   P  + +  +TI V DVNDN P++        FP  ++ +           ++ R+ A D DD ++  + + + S    +
Sbjct:    7 TGTGTVTVLV-------------EDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGD--GHFSV--NPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRF---SLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDA-GEFP--------------RFAPGPRSFSFREDQPPGTTI--TVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRAL-----DHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHC--TVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS------LPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGE----------ALVARVSASDADDGANGQVFFFMRSQTENF 585          

HSP 2 Score: 127.487 bits (319), Expect = 8.640e-30
Identity = 138/544 (25.37%), Postives = 233/544 (42.83%), Query Frame = 1
Query:  877 GTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIE--ARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN-----TVSFNLPLSIHDQDCTSDVIV---NITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKI--NVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW--IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELS 2454
            G P+   +  V + + D NDN P F   +    + ED P+G  +  V+ATD D+    ++ Y+    +      F ++P+TG I     L  + +   +V+E  A D GP P ++ +  + + V D+N+H P         NA  V   P+ +        P  T +  +   D D+  NG ++ S+    S    +         VI+   AL       R ++ + +  SD G  P+S+  T+ ++  D  EFP  F     S S +E+     T++     S       S  +    N+ D++A         + ++ +   LD E +      +E  + G  P   +L       + ++DINDNAP       +    +  P   I  + A D D  +N  V +  I  N+ N       FR+  + G I+    LDRE  + Y L + ATD G+P    T  + ISV D NDN+P++  IF       + E     VG  + R+  +D D+  +  IT+ ++ D +  F +HP  GE++
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGH----FSVNPSTGQIITTASLDREGRE-SYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF------LNAPYVAYAPSSA--------PAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDP----RRGVIHAARALQG----PRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPR-FAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVD-----PQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYL----KLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGN------VFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAH----VRED--AAVGFPVLRVSTLDADEGPNAAITFSLL-DPSLPFSIHPSTGEIT 495          

HSP 3 Score: 122.094 bits (305), Expect = 4.675e-28
Identity = 161/675 (23.85%), Postives = 278/675 (41.19%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVI-------YLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIVNIT-DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDD-LSHTNITYHIISDNA-KYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            NDN P F  +   I   E +     +    A+D D   NG   + + S+  T+ F +  +   I       Y +          + Y   ++  D G P   S   V INI+  N N P F + +Y T +      G  IL +SA D D    G + Y     N  A R F +D   G + L   L+    + F   +EARD G  P  +R    I V + N + P        F    ++       +S  EN+P  + +  +  TD D+  NG +  S+   +   L  +      ++    ++ +   + E+ K   + +  +D G + K+    + I + D+N+ P + N S Y   + EN  S    L +   D D  S+ +   + D      F   Q T  L     LD+ETK +   ++   N      F  ST    + I  +N+  P  ++    F ++E    G+ +GS+ A D D  ++  V +     S +K     F + E  G I ++ +LDRE+E+   L ++A + G+        + ++V   + N+P          +++E+    VGT +  + A D D        ++ I S NA + F ++   G L  + +P   E++    L +VA+D G P  +  T + + + D  +ND
Sbjct:  533 NDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQ--TENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGN--ASRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAP-------RFAHPPLE-------LSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDI------SRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNY--PDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSK----GFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEA--ASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTG-LIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALED--VND 1171          

HSP 4 Score: 114.39 bits (285), Expect = 9.293e-26
Identity = 158/693 (22.80%), Postives = 272/693 (39.25%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFY----ENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLS---IHDQDCTSDVIVNITDLYARSH---FRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH--ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVD-DLSHTNITYHII-SDNA--KYFYLHPIKGELSFLTTPR------QGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYF 2616
            N N P F        V  +   GT +    A D D   NG   Y +     ++ F +       +L +   L  +    + +T+   D G P   S     I++ + N   P F  P     + E+HP G  + +V+ATD D+   G + Y  AS +      F I   +G + L+  L  +  K +   + A D G       + ++I V D+N++ P +  ++                  +Y    EN P  T ++ +   D DS  N     S++   +D  ++       N+    L      + E+++   + +   +  +    ST  + +QI  +NE+   F +  Y+  V E +     P+      D+D   D  V    L+  S    F   + T ++++ S LD E ++S    +   N G  R F        + +   + N P +     +H  ++E    G+++  + A+D D           I   N  R    F I +  G I +   LDRE   LY L ++A D+G P  + T  + +++ DVNDN P   F + +  K+ E+     G  +  L A D D   +    T+ ++ SD A   YF L         L T R      + E  L +   D G+P  ++   L L + D++ N     D     +YF
Sbjct:  645 NANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGG---FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSG--LFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASD------------------YYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVL-------NQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSE-SAPVGAPVGSVFATDRDAGIDGTVFYM-LFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGF--DVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRA---FSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP---FLLTSSAKVTEN--QPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS----SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYF 1291          

HSP 5 Score: 109.383 bits (272), Expect = 3.304e-24
Identity = 139/561 (24.78%), Postives = 241/561 (42.96%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVI--QILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVN---ITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLN-SIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDN 2262
            EN   P FA+  + +++ E+ P G+ L    ATD D+  NG   Y + S   +  F +      + L  V  LD+ET   Y L++   D G         V I++ DVNDN P+     Y+ +I E+ P G  +L + A D DS    +  Y   S ++     F ++  TG +     L  + K  ++  + A +     + +   + + +  +N ++P     E  F            +VS  E+ P    +  +  TD+D+  +G V      F   +       +  N+    ++  S  + E      + +   ++G         +++   I D N+ P VF+ + Y   V E  +  +  + +S HD D           I    A   F     T  +V+ S LD E+    N ++  ++ G      T TT   + + D+NDN P LL  ++  +TE+   G  + +++A D D   N     FQ +      RG   F + S G +K  + +DRE++  ++LP+   D G+P L++T T+ +SVLD NDN
Sbjct:  748 ENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLL--VGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMY---SLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNF------------VVS--ESAPVGAPVGSVFATDRDAGIDGTV------FYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMG--EPPATGTTVVVVALEDVNDNGPFLLT-SSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGY--FSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 171.785 bits (434), Expect = 3.792e-43
Identity = 205/788 (26.02%), Postives = 341/788 (43.27%), Query Frame = 1
Query:  295 NPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVI-------------CPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS----FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRG-LENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP-----QWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELSFLTTP----RQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
             P  F ++E+ P  T +G ++A  +    + A+   I S    GN+   + FQ+DP +GI+     +DRE I              PQ S T+      L V                NDN P F  S     ++E   + + +      D D   NG     L+ E  +  F++    S  ++     LD+ET  AYQLT++  D G+P   ++  V+I I++VNDN P F  P   T I ED  +   +++++ATD D          F      A   F+ID ++G I + + L  +   N+  V+ A + G          TI V D+N++ P        FN       P     S +EN P    +  +  TD+D  EN +V   +   ++      KF    N     +      + E +    + ++  D G+  +S+   I + I DLN+    F++S Y+L+V ENT +      +  S  D      V  +I      + FR    T ++ +   +D E  +S N +I   + G P      ST    IT+ D NDN+P+     T++ I E    GS +  + A D DE  N+ V +  +      RG    F I + +G + + KE++RE    Y L I A+D G+P++++   +T+ V DVNDN P      +I  ++ ++  + S+ T        + A D D  ++  + Y IIS N  K F ++   G +   TTP     + +  L++ A D+    ++N T   + ++D
Sbjct:  792 GPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIIS----GNQ--GNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDV----------------NDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEG-SDNFTID---STGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDG-----TPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAP-------VFN-------PGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTS-----KFEV--NPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPP---WVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV------RGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLT--------VAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVI-MTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLND 1509          

HSP 2 Score: 169.474 bits (428), Expect = 2.012e-42
Identity = 171/630 (27.14%), Postives = 284/630 (45.08%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALS-SANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD----VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYT-------RVGTVITRLHAIDVDDLSHTNITYHIISDNAKY-FYLHPIKGELS 2454
            NDN P FA S     V E   +G+ +    A D D   N    Y L S   T  F++    S   +      D ET  +YQ+ L   D G+P       V I ILDVNDN P+F   +Y   ++ED  +G  ++ V+A+D D+     ++Y F S N      F +D  TG + + R L   Q  ++   +   D G  P  + + + I+V DIN++ P    + S + +++             EN P  T    +  TD+DS  NG +   + + N D +  +  +         +++++ S + E++    + +   D G   K  T  + I I D+N+   VF+ S YS  + E+TV  +  +++   D  S     +   +     +  F     +  + + S LD ET  S  +S+++  +       +S+T   I + DINDN+P+   P  F ++E + PG  IG + A D+D++ N  V +    +S+N    + F I  S G I L  +LD EK++ Y + + A D G P  S+   + + V DVNDN PQ+           +S+YT         G  +  + A D D  ++  I+Y I+S N    F +    GE++
Sbjct:  162 NDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD-TSYFTVD---SQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGN--TNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP--VFSPSAYQSRV------------KENTPAGTQ---VSATDRDSSTNGALVFGIIKGNDDGVFTIDGS-------TGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPS--YSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYA---LSDNT---DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFA----------KSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEIT 743          

HSP 3 Score: 164.466 bits (415), Expect = 6.366e-41
Identity = 169/625 (27.04%), Postives = 285/625 (45.60%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN---LPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF--HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELSFL 2460
            NDNPP FA S     V E+   G  +    ATD DS  NG   Y + S      F++      I   V   LD ET  +Y LT++  D    +  ++  V I+I D NDN P F  P  F  I+ED P G  + Q++ATD D    G V Y   S N      FQ+DP +G + +   L  +   ++  V++A D G         I + V D+N++ P  +  +S F+ +I             E+   ++ ++ + V DKD   NG +  S+    SD   +    ++ +K        +  + E+     + ++  D G   KS+T  + I I+++N+    F       S+ E+ V+ N   + L+  D D T  +  +I +  A S F+  Q++  + +   LD ET ++    +     G     +    +  I ++D+NDNAPV   P ++   + E+   G  +  + A D DE  N+ V ++ ++V +  +    F +  + G +   + LDRE ++ Y L + A D G P  S    IT+++ D+NDN+PQ+    Q+   +  +  T  G+ I R+ A D D  ++  +TY IIS N    F +    G ++ +
Sbjct:  679 NDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVP--LDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFN-ISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQ--GNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAP--RFEKSLFSGEI------------REDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSK--------TPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPED-VAINTHVVKLNATDSDGTP-LTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESV--YNNATIRVLDVNDNAPV-FNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYE-LSVGDTSK----FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQF---SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVV 1263          

HSP 4 Score: 158.303 bits (399), Expect = 5.781e-39
Identity = 180/666 (27.03%), Postives = 313/666 (47.00%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALS-SANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD--VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF--HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT---PRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            ENDN P F  ++ V N++E+TP    + +  ATD DS  N    Y L S +    F +  N     +  V  LD ET D+Y + +S  D    KH +  +  I + DVNDN P F    Y T + ED  VG ++ Q++A DLD      + Y   S +     +F +D + G I        + K ++Q  + A+D G      +  + I + D+N++ P     + T               S  E+      ++ +  +DKD+  N  ++ S    N++    L         +  +V +S S + E R    + +S +D G  P + T  ++I + D+N+ P VF+ S Y   VKENT +    +S  D+D +++  ++  I        F    +T  + +    D+E K+  + +++  ++G    +   T    I I D+ND++PV   P+ +   I E T  GS + ++ A D D      + ++ I  S N +G  N    S G+I+++ ELDRE    Y L + A D G+   S++  +TI++ D+NDN+P +  P     +++ES  +  G  I ++ A D DD S+ ++ Y  +SDN   F ++   G ++  T     ++ + ++ + A D G P RS+ T + + + D  +ND
Sbjct:   63 ENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSGE--NKFMM--NSKTGEIRTVTPLDHETKDSYTMRISAFD---GKHTTF-VPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS---YFTVD-SQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYT--------------ASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTL-------DAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPA-GTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKY--DTAQVTIFIEDVNDHSPV-FSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLI--SGNVKGAFNIDANS-GSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYV--FRVSES--SSPGHQIGQVAATDADDSSNGDVRYA-LSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDD--VND 680          

HSP 5 Score: 157.918 bits (398), Expect = 7.095e-39
Identity = 176/728 (24.18%), Postives = 313/728 (42.99%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXE-------NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIVNITDLYARSHFRY-LQATQQLVLFSH-LDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVS-NNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            F+ID ++G+I  +  +DRE           T + TL+V           +  +        NDN P+F   +   ++ E+ P+G  +    ATD D  +N    Y L+    +K      N +   +     LD E   +Y L ++  D G P   +   + + I D+NDN P F + KY   + E+   G  IL+V A+D D+   G V Y   S N+     F+ID TTG I ++  +  +   ++   I A+D+G  P V+   + I V D N++ P     E+++                 E     + +  +  TD+D   N +V  S+ + ++    +   N +       L      N E+     + I  SD G    +S   + + + D+N+ P VFN  +Y  SV+EN+      L ++  D D  ++ ++  + +      R+ + +T  +++ +  LDFE KS     +   +      +   T      I   +       +  T  + E++   +++  + A+D D        F  ++ S    +  + F I+   G I     LDRE  SLY + +  TD GNP LS    +TI +LD NDN+P++     + + +  S  +   +   +L A D D+ ++  ITY++  ++A  F +    G ++ L  P   EN     L I A D+G P +++   + + + D  IND
Sbjct: 1042 FKIDQSSGLISVAKRLDRET----------TANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK---FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNH--GNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYG--------------IDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGV-------LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS----KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS-------FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPS---SFSFKLAATDADEGTNARITYNLSRNDA--FMIGASSGVIT-LAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVID--IND 1714          

HSP 6 Score: 144.05 bits (362), Expect = 1.418e-34
Identity = 184/706 (26.06%), Postives = 321/706 (45.47%), Query Frame = 1
Query:  304 SFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRI-YSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICP-QLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNK------VIYRLVALSSANCESRKEV---MVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTV--SFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPG-SNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVD 2367
            + TVTEN    + I  + A    S+  +    R+ YSI S GN    + F+ID T G I     VDRE +    L+ ++    V   V+     + +      ENDN P+FA++     + E   +G+ + +  ATD D   N    Y +     T  F++     V  L V   ++ ET   Y LT+   D G+P   S + + + + DVNDN P+F    Y   + E+      +L V+A D D     +++Y   S N+E  + F+I+ T+G I    PL  + K+ +   + A D+      N T+  I++ DI   +     T+  + A            S  EN+P +T ++ +  +D+DS            F S     L ++ +  K      +  R   +S+A+   R+ V    + +  +D+G  P S+   + I+ILD N+    F+ S+YS S+ EN+   SF+  L+  D D  ++  +   +L     F    ++  + L   LD E KS+ + +I+  + G  P  + +T   +            P++   +      + +P  +++  I A+D+D  LN+ + F  +  SN  + +  F ++ + G I     LDRE++++Y L I   D GNP LS+   + I V+D +DN P++  P + +  I+ES+    G  I ++ A D+D
Sbjct: 1209 TLTVTENTANGSNILRVLA----SDPDAGANGRVTYSIIS-GNH--GNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVAD----ENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD-TSAFAINAMNGV--LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE--KRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAF-----TQQNYTA------------SVRENSPTSTSVVKVSASDRDS------------FGS-----LSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITY-NLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHR----PLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLL--SNEHKSV--FTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF-QPTEYNVTISESLPR--GASIVQVTARDID 1852          

HSP 7 Score: 142.895 bits (359), Expect = 2.825e-34
Identity = 197/785 (25.10%), Postives = 340/785 (43.31%), Query Frame = 1
Query:  295 NPISF--TVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN--TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRV--GTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            NP S+  ++ EN P    IG   A    +++      ++    S+G+      F+++P  G++     +DRE           +     + S   ++TL +  +             NDN P F+ S   + V E+T  G+++    A+D D+  NG   Y + S      F  R + +   + VV V+D E   +Y LT+S  D G P   S+  V I + D NDN PIF   +    I+E   +G  +  V+ATD D      V Y     +  A   F I+   G + + + ++ +    +   I A D G     +   +T+ V D+N++ P        FN++         + S  EN+  +T ++ +   D D   N  ++ S+   N +     K N  +  VI     L   + E + +  + ++ +DS    K++   + I++++LN+    F +  Y+ SV+EN  T +  + +S  D+D    +  +I        F   Q +  +     LD E  S     + + + G  P  N     T   I I+D NDN+P       +  I E++ P S    + A D+DE  N+ + +   N+S N    + F I  S G I L + LDRE +S Y L I A D G P  +++ TI ++V+D+ND+      P+ N + +  S+       T + R+ A D D   +  +T+ ++S+  K  F L    G++S    L   +Q    L I   D GNP  S+   + + + D+  N
Sbjct: 1100 NPGSYAKSLHENLP----IGQTVAKVTATDRDEGENAKVTYELSVGDTS---KFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDL-------------NDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAF--RIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA---FAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP-------VFNSQ-------SYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEK--RFKINSTSG-VIMTTTPL---DFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNL----TWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITY---NLSRN----DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHR-----PLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDN 1820          

HSP 8 Score: 123.25 bits (308), Expect = 2.835e-28
Identity = 150/543 (27.62%), Postives = 238/543 (43.83%), Query Frame = 1
Query:  823 LDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN----TVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH--ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFY 2427
             D E+   Y+LT+   D     H    +V I++ D NDN P F    Y   I E+ P  ++ + V+ATD DS     + Y   S  N+    F ++  TG I  + PL  + K+ +   I A D      V   LIT  V D+N++ P        F   + KTG        YE+    + +  +   D D   N R+  S+   ++ +  +     I  K  +        + E++    V +   D G   +S   T+ I+ILD+N+   VF+ + Y+ SV E+         +  S  D    +D+  + T       F     T  + +   LDFE +SS    + + ++G     LT T+   I + DINDN PV   P+ +   + E+T  G+    + A D D + N  +VF  I    N  G+  F I+ S G I + K  D E ++ Y L + A D G PV   T  +TI + DVND++P +  P     +I ES  T +G+ +  + A D+D      + Y +IS N K  +
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSLFSGENK----FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFV--PLIT--VDDVNDNAP-------FFALSVYKTG-------VYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAF--------DRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPP--LTDTSHLLINVNDINDNPPV-FSPSAYQSRVKENTPAGTQ---VSATDRDSSTNGALVFGIIK--GNDDGV--FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-SPSNYSKQIPES--TVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAF 526          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 160.229 bits (404), Expect = 3.308e-40
Identity = 217/830 (26.14%), Postives = 370/830 (44.58%), Query Frame = 1
Query:  325 CPKNTIIGDMSAYRKVSEKSSAIMKRI-YSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQL--VRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNG--PVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGP-NKSLVS--------------FYENNPPNTDIIFIV--------VTDKDSDENGRVQCSM-EQFNSDWLIMLKFNY-----INNKVIYRLVALSSANC------------------ESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTV--SFNLPLSIHDQD-----CTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHI--TEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTT--GTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQ------GENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
             P++  +G         ++ +A+  R+ YSI S   E   D F ID   G++++S   D E        V      +   +   T+ V I +            NDN P+F        V E+TPLGT +    A D DS  N    Y + +      F++  +   I        DFE  + Y LT+SV D G P   S     V I ++D NDN P F + +Y   + E+  VG ++L+V+A D DS    ++KY   S N +    F I   +G I L +PL  +  +N+  V+   D G  P+ ++ R ++ + V  +N H P  +     +NA I +  P   S+V                Y      +  +F+V          + D +   R +  M E   S   ++  F +     IN +V Y +V  S                      ES  +  +++   D G  P++++  + +++LD N+ P VF    Y+L + E T   +  L +S +D+D       +++   + D      F     T Q+ +   +D+E +SS +F +   + G  R  LT ++S  ITIID+NDN P  L PT +++   E+   G+ +  + A+D D +LN  V+F  +  +++ +    F I+ + G +   K LD E  + Y L I ATD G+P L+++  G + +SV+++NDN+P +   + +   I+E+  T VG VI R+ A D+D   +  + + I+  N+   ++  +      +TT +        E  L I A D G+P  ++     L++S  +IND
Sbjct:   12 IPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTE--SDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDT-----------NDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGSFTIDNSTGEIMTR--KEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTD--DAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAP--RFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEAR--LTGSSSVRITIIDVNDNRPYFL-PTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGK----FVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYS-ASIDEN--TTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFV--VDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNIND 810          

HSP 2 Score: 104.375 bits (259), Expect = 1.076e-22
Identity = 180/728 (24.73%), Postives = 307/728 (42.17%), Query Frame = 1
Query:  313 VTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ---------YKN-------FQFVIEARDNGPVPNVNRTLITIHVKDI---NNHYPDIKIT-----ESTFNAKIV----------KTGPNKSLVSFYE--NNPP-----------------NTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPL-----SIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTT--GTITISVLDVNDNNP 2268
            V+EN P  TI+  + A   V + S++    IYSI++ GN      F ID + G I      D E                P LS+ +    V ++V              DENDNPP FA       V E+  +GT +    A D DS  N + +Y + S      F +  +   I L+    LD ET + Y L L V D+G P   S + + +N++   VN++ P F    Y   I E+ P+G  I++V A + D +  G  ++ +   +  + + F ++  TG I L R L  +         Y+N              RD G    V   ++T  VK +   N+    + +T     ES +   ++          +T      V   +  +NPP                  T I+ +   D+D  + G V   +  F  D ++  KF+   N    ++    + + E R      +  SD GE   + + ++ I I+D+N+    F  + Y + + EN V+   P+     S  D      V+ +I    +   F   Q T  +     LD+E  +     I+  + G      +      +++++INDN+PV  +   +  I E+T  G  I  + A+D D +LN  V+F  +  +++ + + +   ++ G +   K LD E  + Y L I ATD G+P L+++  G + +SV+++NDN+P
Sbjct:  118 VSENTPLGTIVARVKA---VDKDSTSNADLIYSIQN-GNNNGS--FTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVV--------------DENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLD--KPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVE-DDVSVG-ARFIYVIKDAASSKVFLVN-QTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEG-VNAEIRYFLKDAIVSKKFSI--NDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVEN-VAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVD---QNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSP 813          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 160.229 bits (404), Expect = 1.258e-39
Identity = 177/613 (28.87%), Postives = 294/613 (47.96%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNL----SVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNR-TLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSH---LDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN 2412
            NDN P F      + ++ES  + T   +  ATD D+ +NG  +Y + S   T  FSL        S + +     LD ET D YQL ++  D GTP      L+ I ILD ND+ P+F +  Y   I E+   G  IL+VSA D DS   G +KY       ++   F +D +TG I   + L  + KN + F + A D G VP+ N    +TI+V D N++ P +KIT       +     +K++ S  EN+  NT+I +I+VTDKDS+ N   Q  ++  N D     K  ++     Y +      + E      + ++ +D G   +S+   ++I + D+N+    F  + Y+ ++ E     S+ L L+  D D   +  V+ + +   +   + Q   Q  L +    LD E  SS+  +I   + G      T +T+  +TIID NDN P  ++ +    I+E    G+ +  + A D D   N  + ++  +      GL     ++ G +    +LDRE +SLY   +LA D G+P L ++  + +++ D+NDN P + +P++    I E+     G ++ ++ A D D+ ++  I+Y II  N
Sbjct:   89 NDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGG-VPSKNDLATVTINVLDTNDNSPQLKIT------YLPPHNGDKAIRS--ENSLINTNIAYILVTDKDSNTNS--QTELKITNGDDEGCFKVEFLG---FYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYS-ITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPK--TGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQT-GVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEYFASIMEN--EPPGKLL-QVTATDADEGTNAVISYDIIGGN 679          

HSP 2 Score: 148.288 bits (373), Expect = 6.031e-36
Identity = 181/719 (25.17%), Postives = 314/719 (43.67%), Query Frame = 1
Query:  433 QVKDLFQIDPTNGIIKASLNVDREV----ICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFA-------NSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN-LPLSIHDQDCTSDVIV--NITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL-EPTTFHITEDTKPGSNIGSIKANDSDENLN---SIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNP 2520
            Q   +F +D + G+I+   N+D EV        +++  G  S   L T+  ++++        NDN P          N +  I   E++ + T++     TD DS  N   E ++T+      F + + L   ++++   LD E    Y LTL+V D G P   +   V I++ DVNDN P F    Y   I+E    G  +LQ++ATD D    G V Y     N+    WFQ+D  +G +   +PL   Q  +    I A+D+G  P    T +T+ + D N++ P  +  +S++   I             E       ++ +  TD DS +NGR+  + E  +SD  +   F    N     L   S  + E++      +   D G+    S+  + + I D+N+   VF    Y  S+ EN      L ++  D D  ++ ++  +I       +F    +T  +   + LD E +    FS+ I  K     +   T    +T+++  DN PV L E   F + E+   G+ +G + A   D+N +   +IV     N+         F ++S  G IK+  ++DRE+++ Y L ++A       LS   T+ I VLD NDN PQ+     +   ++      VG V+    A+D+D   +  + Y + S+     +++   G +     LT   + +  + ++A D+G+P
Sbjct:  251 QSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDT-------NDNSPQLKITYLPPHNGDKAIR-SENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEF-LGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLG--WFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKP--RFMKSSYKGTI------------SEGASIGATVLQVSATDVDSGDNGRI--TYEISSSDAQVNGLFEL--NTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEF--FSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNL---------FLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF---STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSP 926          

HSP 3 Score: 144.05 bits (362), Expect = 1.093e-34
Identity = 204/773 (26.39%), Postives = 346/773 (44.76%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE----NTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDN-KINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELSFL------TTPRQGENI-LDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            FTV EN PK T++G +  Y    +K+ +I   I S +        +LF +D T GIIK + ++DRE     L A          V  ++    + I ++D NDN P F+ S++++++  +  +G  +Y   A D D+  NG+  Y+LTS        L  N +   +++   L       Y + +   D G+P   S+  + I  L +N + P F    Y T +    P+      V A D DS K G + Y     N E    F I P  G +++ + L    K  +  ++ A D G VP+ + ++ +TI+++D N+H        +TF   +             EN+ P T +  +V    D      +  S+    S + + ++   I  +V      L   N  S   +M   +  +     K     +++ + DLN+   VF+++ Y+++V E     +  F +     D+   +    ++        F    +T +L L   LD ET SS N  ++  +       L ST    IT+ D ND  PV  E   T +ITED   GS + ++ A+D D   N ++   K ++SN       F +ES  G + + K LD E   LY L I A D G   LS+T  +T++VLDVNDN P  +FP Q     + E++ T  G  + R  A D D  ++ +I + + S   +K F ++    E++ +      T P   ++  L ++A D G+P  S +  + + ++D++ N
Sbjct:  748 FTVYENVPKGTLVGRV--YATTKDKNGSISYAIVSGDP------TNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGT---VKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGL---LWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHIT-LSIN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEG--LFGIFPG-GKLYIRKSLLQALKGSYDLIVRATDGG-VPSFSASVPVTIYIQDSNDHRS--LFVNNTFRFAVA------------ENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIK-NTGSNVYIMQAEAMYND-TTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNAN--LYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLI---KYSISNGNLAAM-FDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFPTQPVTLTVRENVNT--GFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDN 1474          

HSP 4 Score: 135.961 bits (341), Expect = 3.992e-32
Identity = 166/630 (26.35%), Postives = 277/630 (43.97%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFK---KPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIF--LIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNS-DWLIMLKFNYINNKVIYRLVALSSANCESRKE---VMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD----VIVNITDLYARSHFRYLQATQQLVLF--SHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRV--GTVITRLHAIDVDDLSHTNITYHIISDNAKYFYL 2430
            END+ P+F  ++ + ++ E+T  G  +    A D DS  NG  +Y +  + +        + S   +     LDFE  ++Y   +   D G P       V IN+LD NDN P  K    P +     I +E+  +   I  +  TD DS      + +   TN + +  F+++   G  F  L +PL  +   F    +   D G         + I V D+N++ P    T + + A I +   N S V            + +  TD D  +NG V  S+   N   W           +V ++   +++A    R++   V + I+  D G  PK+ + T+ + I+D N+    F KS+Y  ++ E        L +   D  S     +   I+   A+ +  +   TQ  VL+  S LD ETKS  +F++   + G  +  L S+    +TI DINDNAPV      F    + +P   +  + A D+DE  N+++ +  I  +NN     NF I+S  G I     LD E E  + L I A D GN   + T  + ++VL+  DN P +++ +      N ++Y  V  GT++ R++A   D   + +I+Y I+S +    +L
Sbjct:  199 ENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI--TNGDDEGCFKVE-FLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSP--AFTSNAYTANISELAQNGSYV------------LQLNATDPDEGDNGTVSYSITGGNDLGWF----------QVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQ--LMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNG----NFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEM-----YNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFL 788          

HSP 5 Score: 118.242 bits (295), Expect = 8.828e-27
Identity = 168/671 (25.04%), Postives = 293/671 (43.67%), Query Frame = 1
Query:  613 DNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIF---------LIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTV--SFNLPLSIHDQDCTSDVIV--NITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESL------YYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI--LDIVAIDNGNPVRSNQTRLFLY 2553
            ++PP F  S+ V +V  S PL    +   A D DS  NG   Y +        F + +    +Y+    +   +   +Y L +   D G P   +S  V I I D ND+  +F    +   + E+   G ++  + A  LD  +   + Y   S    ++  F +D  +G I          LI+   +     Q   EA  N      ++ ++ + V D+N++ P        F+  +         ++  E + P + +  I   D D  +N +   S+         M KF +IN+     L    + + E+     +V+  +D+      ST  I I + D N+   VF +S Y++++ E+ +  S  + L+  D+D   + ++  +I++    + F    AT +L++   LDFET      +I   + G  P    L+ST +  + ++D+NDNAP+   +P T  + E+   G  +G   A+D D   N+ + F   + + +K     F + S  T ++T     + E++      + L ++ATD G+P LST  +IT+ V D NDN+P ++ P       + ++ T        + A D D  S+  +TY IIS N  YF LHP  G+L  +        I  L I A D G P R  QT + ++
Sbjct:  941 NHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGI-FPGGKLYIRKSLLQALK--GSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLIS----SESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQ--AEAMYNDTTIKRDKAIVIVTVTDLNDNAP-------VFSRAVYA-------ITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTG----MDKF-FINSST-GELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIP----LSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSK----TFSVNS-ATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMT--------ITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVF 1565          

HSP 6 Score: 114.775 bits (286), Expect = 1.291e-25
Identity = 155/683 (22.69%), Postives = 285/683 (41.73%), Query Frame = 1
Query:  295 NPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLL---VTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCE--------------SRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYA-RSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYY-LPILATDLGNPVLST-TGTITISVLDVN 2256
            N   F V EN    T++G + A+     ++  I+  + S ES         F +D  +G I   + +DRE +     +         +    TI  D   +++ + D NDN P+F+ +   I V E +  G+ ++   A D D  DN    Y L S      F +  N S   L +   LD ET  +Y L +   D       S+  + I + D ND  P+F +  Y   I ED  +G +++ ++A+D D  + GL+KY  ++ N  A   F ++  TG + + + L  +    ++  I A+D+G +P  +   +T++V D+N+            NA +  T P    ++  EN      +     +D+D+  N  +  SM                 ++   +  +++SA CE               R    +V+  +D G    S+  +I +Q+ D N+  P   +    +     N ++    ++  D D  S+  V  + +     +F    +T QL +   +  +  +    +I+  + G P R           T++ +    P+   PT         +TE+   G+++ ++ A     +LN  + +  +   ++K G E   ++S G +K T+ +DRE     + L + A D   P   T + T+TI+V DVN
Sbjct: 1053 NTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES--------HFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFI--NSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAA--MFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVND------------NAPLFPTQP--VTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMY----------------SQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMT----ITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIP-DNPTIYQLTIQASDGGQPSRQ--------TQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYY-LTSDSSKGGFE--VVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 7 Score: 102.064 bits (253), Expect = 8.448e-22
Identity = 173/683 (25.33%), Postives = 286/683 (41.87%), Query Frame = 1
Query:  631 ANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPT---TGHIFLI---RPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSA-------NCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEF----------PAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRY-LQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGEN------ILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            A S+   +V+E  P GT+               VG+    S     P    +N +   +     +D ET    Q++L +  +       S  V++ + D+NDN P F    Y   I E   V       +ATD D+   G V Y  AS +N A   F +  T   TG    +   +PL  +  +F Q  I A D G    +   LI I + D N+H P    T++++            L S  EN  P   I+ +   D+DS  NG ++ ++     DW      + I +  I+ L + +         + E +      +  SD G   K+   T+ I +LD N+           P   +K+  S +   NT    + ++  D +  S   + IT+      F+        + L   LD E     N ++ + +KG P R+ L       I + D+NDN+P       T +I+E  + GS +  + A D DE  N  V +  I   N+   L  F+++   G +   K LDRE+ S   + I A D G+   + + T+T++++D NDN P++   +++  K   S    +G  + ++ A DVD   +  ITY I S +A+   L  +  +   L T  Q +          ++A D+G+P   +  ++ L ISD  IND
Sbjct:    8 AGSSYTFHVQEEQPPGTY---------------VGKVDGASAFEGSPKQFGFNSNTGVISTTARIDRETT--TQISLQLRTLNPSNQPIS--VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTAT--FSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAP--VFTQNSY------------LGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI-----DW------DAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTL---GFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSY-SITGGND---LGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRF---MKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISD--IND 632          

HSP 8 Score: 77.0258 bits (188), Expect = 3.895e-14
Identity = 167/731 (22.85%), Postives = 288/731 (39.40%), Query Frame = 1
Query:  406 YSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVIC-------------PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIH-------DQDCTSD----------------VIVNITDLYAR-SHFRYLQATQQLVLFSHLDFETKS---SINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREK------ESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGEL 2451
            Y I S  + QV  LF+++   G++     +DRE                PQL +   +  V L ++ +             NDN P+F       ++ E+ P G  L +  ATD D   N V  Y +        FS+  +  VI    +  LD E  + + L +S  D G      + +V + +L+  DN P+F    Y   + E+ P G ++ +V AT  D  K G + Y   S   +    F +D T G I +   +  + K  +   + AR     P   +  + I V D N++ P  + + S+    I  T     LV     N    D+        D+ +NG V+  +   N++ L+ +     +   + +L    +   E++  V V+   SDSG  P+ ST TI I  L +N  P  F  S+Y   V  +      PLS         DQD   +                 I     LY R S  + L+ +  L++ +  D    S   S+  +I I +   HR+   + T                     F + E++ PG+ +G++ A+  D +    +V+  I+  +      +F ++   G I     LDRE+       ++Y +   A      +      + ++V D+NDN P +   +     I  S  +  G+ + R+ A+D D+  +    Y ++S      F+++   GEL
Sbjct:  567 YEISS-SDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMS---SVKVELTISDI-------------NDNAPVFYPVEYFASIMENEPPGKLLQVT-ATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVI--STLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVS--GDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAP--QFSTSSVIVDIDGTW----LVGQVVYNAAAVDL--------DAGKNGLVRYQLTS-NAEGLLWIN----STSGVIKLARKLTDGDETQYTVQVL--ASDSGSPPQHSTMTIHI-TLSINH-PPKFTLSSYVTHVLASQ-----PLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRA-TDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFR-------------------FAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES------HFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVY---AITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGEL 1216          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 158.688 bits (400), Expect = 5.119e-39
Identity = 176/666 (26.43%), Postives = 288/666 (43.24%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFN---YINNKVIYRLVALSSANCE-SRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAVFNKSTYSLSVKENTVSFNLPLSI---------HDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLG---NPVLSTTGTITISVLDVNDNNPQWIFP----IQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLH------PIKGELSFLTTPRQGENILDIVAIDNGNP 2520
            ND  P+F N +   +V E+TP  +++    ATD DS +NG   Y   S+  T  F LR N   I+++    LD E  + Y L +   D GTP+  SS  V++ + DVNDN P F++  Y   + E+ PV   +  VSA+D D    G V Y+F    +     F +D  TG I   + L  + K ++ F I A D G  P V++T +T+ V+D+N+  P              K   NK  V+  E+ P  + ++ ++ TD D           +  NSD   M+      +  N+V   L  +S  + E + + ++ V++    G +   +   I I +LD+N+ +P   N++T+       TV   LP+            DQ     V   I +      F+  + T  +     LDFE  +     +   + G  +   +            ++       P    I E+    +N+ +IKA+D D  LNS + +      +++    +F+I S+ G I+ T  +DRE+ S Y L + ATD        L  T T+ I + D+NDN P+++      +  D   N          +T + A+D D     N+ Y I+S +   F L        + G L +   P+     L I A D G+P
Sbjct:  906 NDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLR-NGGKIFIK--SKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRF----DTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSP--------------KFSKNKYSVTVNEDLPVGSSLLTLIATDDD----------QQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTF------KTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWY----TIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQ--------VTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQY---TLHISATDLGSP 1519          

HSP 2 Score: 148.288 bits (373), Expect = 7.139e-36
Identity = 207/796 (26.01%), Postives = 340/796 (42.71%), Query Frame = 1
Query:  304 SFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE-------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIV---INVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNL----SVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAK--RWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQ----------LVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENF-RIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW-----IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            S T+ EN    T I  +SA  K    ++ I    YSIE+  + Q   +F I PT G+I  ++ +D E       V+  +   +S   S + +V I    V         NDN P+   S  +     V E+  +GT +     +D DS  N  GE  +T E     FS+++++    S+I   V   LD ET D + L     D G P   + +  RIN+ DVND  P F +  Y T + E+  V  ++  V+A D D      + Y  A+T        WF IDP++G I     L   Q       +   D G  P  +   + +++ D N++ P     +S++NA            S +EN+P  + ++ ++  D D  EN  +  S+   N+ + +  +   + N          + + E +      ++ +D G   +S   T+ + + DLN+   VF+ S+YS+   ENT        I    C    I   +  +A + F   Q              + L   LD ET+ +   +++ ++ G   +   +     IT++D+ND  P+  +    F I E ++  S IG + A   D+  N+ VV+     S +K   +N   I S GT+ L  E+D EK    YL + A D G P L     +TI+V+D+NDN+PQ+     +  +  D  I  + YT        +   D D      +++ ++S+    F L    G LS       G +     L + A D G+P RS+   L L + D  +ND
Sbjct:  178 SGTIPENIDVGTSILQVSASDKDIGTNAEIQ---YSIETHSDPQA--IFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDV---------NDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKN--GEVNVTLEGGDGYFSMKFDVLNDESII--AVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDP--YFNQSSYNA------------SLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNS--------RTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENT-------RIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSV--NKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVY-----SISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYT--------VSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVD--VND 907          

HSP 3 Score: 137.887 bits (346), Expect = 1.146e-32
Identity = 167/618 (27.02%), Postives = 276/618 (44.66%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDF-ETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN--TVSFNLPLSIHDQD---CTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKP-GSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI-ESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTT-GTITISVLDVNDNNPQWIFPIQNDNKINESIYTRV--GTVITRLHAIDVDDLSHTNITYHIISDNAKYFY 2427
            NDN P F +S+I++ + E TP+G   Y     D DS   G   + L S   T  F+L  N     L +  ++D+  +  +Y L +   D G+P   S+ ++ + ++DVND  P+F    Y   + E  P    I++V ATD+DS + G + Y F S  + +K   +     G IF+   L  +  + +   + A D+G     +   + + V D+N++ P  +     F  K              EN P  T +  +  +D D   NG V    +   + +++        +K   ++      + E++   +  I  +D G  P+     + + + D+N+    F+K+ YS++V E+    S  L L   D D     SD+   I  +     F   Q T  L L S LD E        +   +KG +++ L + T   I ++D+NDN PV +  TTF    +  P GS + ++ A DSD+  N  V ++ +N   N  G   F+I E+ G I   + LD E  + Y L + ATD+G     T+   +TI V D NDN P +     + N I   IY  V   T +T + A D D   ++ I Y I S + +  +
Sbjct:  801 NDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTL-FNLDSNTGA--LSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLR---NGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVK--------------ENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIV--------DKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI--VAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQS-LETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVN--GNTDG--TFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF-----DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHF 1378          

HSP 4 Score: 137.887 bits (346), Expect = 1.156e-32
Identity = 198/735 (26.94%), Postives = 326/735 (44.35%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDREVICP---QLSATSG---TCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYA------RSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNK----INESIYTRVGTVITRLHAIDVDDLS-HTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGE----NILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            F +DP  G++  S  +D EV      Q++AT G   +C+ T+ V++ +            NDN P+F  S+  +   E+T +G  +    A D DS    +  + +      + FS+  +     + +  +LD ET D Y LT+   D G     +  +V I +LDVND  PIF K +Y   I E      +I  V A   D      V Y  +  N +         +TG ++L   +   +  +    ++A+D G  P      +TI V DIN++ P        FN+  +       LV   E+ P       + V D DS   GRV  S+   N   L    FN  +N     L  L      +R   + V    D G  P+SST  + ++++D+N++  VF   +Y+  V E T   +  + +   D  S     I+  YA       S F  L+   ++ + S LD E     N  +  I+ G P R+   S+    + + D+NDN P   + +  F + E+    + +G++ A+DSDE  N  V ++          +  F ++   G I  ++ LDRE ++ Y   I+ATD G+        +T+ V DVND +P++     + NK    +NE +   VG+ +  L A D D    +++ITY I++   K F L+ + G L+ L +P   E    +IL +VA D G   +S +T  ++ I+   +ND
Sbjct:  544 FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDL-----------NDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSG---LITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLIN---STGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQ-------FNSSSI-------LVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLS-NPGTL----FNLDSNTGALSLTKLIDYGNSARSYTLPV-QAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRIS--YAFDSKVDTSKFG-LRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRS---SSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRF------DTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF-----SKNKYSVTVNEDL--PVGSSLLTLIATDDDQQGPNSDITYMIVA-GPKAFSLNQVTGVLT-LVSPLDREVTHRHILHVVASDKGGN-QSLETITYIEINVLDVND 1219          

HSP 5 Score: 125.561 bits (314), Expect = 6.221e-29
Identity = 186/731 (25.44%), Postives = 322/731 (44.05%), Query Frame = 1
Query:  295 NPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVP-NVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE----NTVSFNLPLSIHDQDCTSDVIVNIT-DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDS--DENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELS 2454
            NPI   + EN P NT +  + A+    +  S +  RI+   +I ++  +  F+I+   G+I+ +  +DRE I         T         + +   + III D NDN P F + N+   V E  P    +    A D D+   G  EYR+ S    K FSL  +L    L+++  LD+E    Y L +S  D+G+P   S QL  + ++DVNDN P F +  +   ++E+ P G  +++V+A D DS     + Y   S     K  F ID  +G I     L  + K+  F+         P  V+ T + I+V D N++ P  K        K+ +  P + + +             + V D D   N +V  S+   N+D    +       +    L   +  + E++    + +   D      ++   I I I D N+ P VF +S YS ++ E     T   NL  S  D     +++  ++ D Y      Y   ++  +++S   FET     ++   I K   ++   +     I I D N++AP   + P   HI  +T   + +  + A D+  D++ N  V + +++ S N   L  F +ES+ G+++ +       +  + L I+A D G+P L   G + I + ++ D+ P+++   Q   +++    ++VG+ IT + A    D     +TY IIS N  + FY+ P  G +S
Sbjct: 1333 NPIITWIYENVPINTNVTTIKAH----DDDSGLNSRIW--YTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK-FSL--DLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK--FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPP--KFISPVVTLKVPENSPARLIYT-------------LTVQDLDYGNNTKVLYSIMSGNTDGAFTI------GRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYG----VYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTY-RLDDSKNSTSL--FVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLN--QTPARVSIPENSKVGSYITTVRARASSD---AQVTYSIISGNKGRAFYVDPFTGVIS 2018          

HSP 6 Score: 123.25 bits (308), Expect = 3.060e-28
Identity = 165/631 (26.15%), Postives = 280/631 (44.37%), Query Frame = 1
Query:  700 ATDFDSLDNGVGEYRLTSEKVTKPFSL---RYNLSVIYLEVVH-----VLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIF-LIRPLSTQYKNFQFVIEARDNGPVPNVNRT-LITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIH--DQDCTSD-----VIVNITDLYARSHFRYLQ---ATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIF-PIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELS---FLTTPRQGENILDIVAIDNGN 2517
            A D D   N    Y + S  V   F L   R     +Y ++V       +D E  D+Y L +S  D G P +     + I + D NDN P F    Y   I E+  VG  ILQVSA+D D      ++Y    T+++ +  F I PTTG I   +R      +++  V++A D G    ++ + ++ I V D+N++ P I ++ +   +  V            EN    T +  + V+D DS +NG V  ++E    D    +KF+ +N++ I  +    S + E+     +   C D G+ P+++  +  I + D+N+    F++ TY   V EN     L   ++  DQD  S+      I N T+  +RS+  +     ++  +   + LD E    +  ++ + ++G     L+   S  + + D NDN P   + +    + E++  GS +  + A D D   NS++++  I   N    L+  +    G +  ++ LD E +S Y   + ATD G    S   T+ +S+ D+NDN P  +F P     +  E+  TR+G  I +L AID D        + I   NA   +     G ++    L    Q   +L + A+D G 
Sbjct:   81 AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI-ETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVT-----------ENATIGTQVARVSVSDADSGKNGEVNVTLE--GGDGYFSMKFDVLNDESI--IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTE--SRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPP--LSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYS-ILTPNTPFFLDPRK----GLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQP--VFDPSSYSVEYFEN--TRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGG 680          

HSP 7 Score: 118.627 bits (296), Expect = 8.538e-27
Identity = 171/701 (24.39%), Postives = 295/701 (42.08%), Query Frame = 1
Query:  613 DNPPMFANSNIV-INVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGK--MILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYP------DIKITESTFNAKIVKT-------GPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKE-VMVVISCSDSGEKPKSSTHTIVIQILDLNEF--PAVFNK-------STYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL-------EPTTF-------HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTT--PRQGENI------LDIVAIDNGNPVRSNQTRLFLYISDK 2565
            D+PP F N     +++ E++ +G+++    A    S D  V  Y + S    + F +     VI +     LD+E+   ++L L     G        ++ IN++D NDN P F        + ED    K   +++V+ATD+DS   G V Y    T NEA   F ID TTG I   + L  +   +F  VI   D+G  P      + + V D+N++ P      ++ I E T    +V +         ++   +    + P   I+ +  TD+DS  N +++ S    NSD     + +Y  +     + A  + +   R   + + +   D G  P+ +   + I I    +F  P+ F K        T  L+V+    +  LPL          +  NI +    ++FR  Q +  + +   LD+ETK               R FL   ++   T        PV +       E   F         +E    G+ + ++ A D D   N  V F  I   ++K    +F I+   G I+  + LD E    +++ + ATD G+P + T  ++TI VLD+NDN P +  P  ND ++ E++   + + +  ++A D D  ++  +++ +I    +  +L  I     +LTT      EN       L I A D GNP  S+   + + ++D+
Sbjct: 1957 DDPPRFLNQTPARVSIPENSKVGSYITTVRARA--SSDAQV-TYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIW-TGNEAG-VFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSD-----QIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPL--------GRISYNIEN---SNYFRIGQRSGVISVNKPLDYETK---------------RRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWF-AIQSGDDK---GSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENL--PLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFL--IDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADE 2613          

HSP 8 Score: 117.472 bits (293), Expect = 1.991e-26
Identity = 165/660 (25.00%), Postives = 283/660 (42.88%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKP-FSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKH-CSSQLVRINILDVNDNYPIFKKPKYFTI-----INEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEAR--DNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSH-LDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHIT--EDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP-----QWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNP 2520
            NDN P F+N +    + E+  +GT +    A+D D   N   +Y + +    +  F +     VI   V   LD+E   +Y + +   D G+     SS +VRI +LDVNDN P+      +T+     + E+  +G  + +VS +D DS K G V       +      F +      I + + L  +  +  F ++A   D G  P        I+V D+N+  P  K    T+  ++            +EN   NT +  +   D+D   N  +  ++         +  F    +  +  +   +  + E   +V++ +   D G  P S   ++++ + D N+    FN+S+Y+ S+ EN+ S +  + L   D D   + ++  + L   + F +L   + LV  S  LD E +SS  F +   + G      +   +  +++ D+NDN PV  +P+++ +   E+T+ G +I  +KA D D    +I  F    +       E F ++  G I L K LDRE +  Y L + A D G         + I+VLDVND  P     ++ F IQ         +++  +VI  +HAI  D  ++  + Y I   N     L    G L +L +    E I    L + A D G P
Sbjct:  166 NDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNV--RLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVS--YTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHD-HFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAP--KFDRHTYETRV------------WENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGM--ITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPF-FLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGR----SCNATVHVSLTDLNDNQPV-FDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRF----IIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQE--------HSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTL-YLQSEVDHEKIPSLYLTVQAKDKGTP 785          

HSP 9 Score: 103.99 bits (258), Expect = 2.311e-22
Identity = 90/299 (30.10%), Postives = 130/299 (43.48%), Query Frame = 1
Query:  823 LDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQ-YKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCS-----------MEQFNSDWLIM-LKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKEN 1680
            LD+ET   + L +S  D   P       V IN+ DVND  P+F +  Y    +E  PVG +++ VSA D DS   G V   FA  + + K  F ID  TG I   R L  +  K     + A D G  P      +TI V D+N++ P  ++            GPN   V   EN P N+ +  I  TD+DS  N R+  +           +++F S WL   + F+Y N  V                +  + I  +D+G  P SS  TI++ + D +E+   FN+  Y   V  N
Sbjct: 2365 LDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRV--WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRV-----------PGPND--VQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKF-SGWLTTNITFDYENTAVY---------------QYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGN 2632          

HSP 10 Score: 95.1301 bits (235), Expect = 1.311e-19
Identity = 156/640 (24.38%), Postives = 258/640 (40.31%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKH--ATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKM----------------------------ILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN--FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPN----TDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNY-INNKVIYRLVALSSA-------NCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTY----SLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--EPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYY--LPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVD 2367
             NDN P F  SN++  + E T      ++    ATD DS  NG   Y + +      F++      I      +LD ET  ++ L +   D G P   ++  V++ + D+NDN P+F  P     I ED   G +                            IL+VSATD DS     +KY F  TN++ +  ++ID  TG I   R +  + ++   Q  ++A D G  P   R L+ + +                    I+   P   L S++   P N    T ++ + VTD                N+  L + + +Y I N   +R+   S         + E+++  ++V+S  D     K     + I + D+N+   VF +S Y    S  +   T+  N+  +  D      V   I     +  F   + T  +     LD ET  + + S+   ++G     + +  S  I ++D+NDN PV     P    + E+    S +  I A D D   N+ + F  I      +GL  F I+   G +      D E  ++Y   L I ATD GNP LS+  TI ++V D ++ +P +    + D K +     ++G  + ++ A D D
Sbjct: 2060 RNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEI--TTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF-DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSD-QIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP--QRALVYVRI--------------------IITREPKFELPSYFGKVPENAMMGTSVLTVRVTD----------------NAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPP--MHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVI--GGTGQGL--FLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF---NRMDYKFDVPGNAKIGDFVGQVTATDRD 2648          

HSP 11 Score: 89.7373 bits (221), Expect = 5.632e-18
Identity = 163/587 (27.77%), Postives = 255/587 (43.44%), Query Frame = 1
Query:  769 PFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKK---PKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTN-NEAKRWFQIDPTTGHIF--LIRPLST------QYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIV-IQILDLNEFPAVFNKSTYSLS----VKEN-TVSFNLP-LSIHDQDCTSDVIVNIT----DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIY--TRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKG 2445
            P  L YN  VI  + V  LD E   AY LT  + +  TP    + LV +   D+NDN P F +    K     N+     K+I    A D D        Y   S N     +      T G ++  L+   S+      +  ++   I A D G   N     ++I V+D N++ P+        N     T P        EN    T I+ +  +DKD   N  +Q S+E  +SD   +    +    VI   V L   + E+++  ++V+   D G   + S+  IV I++LD+N+   V + S Y+L     V EN T+   +  +S+ D D   +  VN+T    D Y    F  L     + +   LD ET          I+KG P R   T+  SF I + D+ND AP     T    + E+    + +  + A D D   NS +V+   N + ++  L  F I+ S G I    +LDRE+     L +L  D G+P LS   ++ +++ D NDN+P +     N +  N S++  +  G+ + +L A D D   ++ I Y I++ N   F+L P KG
Sbjct:    4 PADLEYNAGVITTKTV--LDREKVSAYNLT--IVEFSTPPKSYTVLVYVQ--DLNDNSPSFVRGTSAKLVVFENDKDFRQKLI----AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFS------NVSYSGTIP--------ENIDVGTSILQVSASDKDIGTNAEIQYSIET-HSDPQAIFGI-HPTTGVIVNNVRL---DYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVS-YTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPR---TTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYF-----NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP-FFLDPRKG 551          

HSP 12 Score: 78.5666 bits (192), Expect = 1.514e-14
Identity = 69/275 (25.09%), Postives = 118/275 (42.91%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTI-INEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-----FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRV 1416
            ND  P+F  S  +    E  P+GT +    A D DS  NG   + + S      F++     VI  +    LD ET   + +++   D G+P   +   V I +LD+NDN P+F+ P    + + E+ P+   + +++ATD DS      +  F       +  F ID  +G  +L   ++  Y+N     +   I+A D G  P  +   I ++V D + + P     +  F+       P  + +  +           +  TD+DS + GRV
Sbjct: 2401 NDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQ--RALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDS--GANARLSFTVIGGTGQGLFLIDKFSG--WLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDV------PGNAKIGDFVGQ--------VTATDRDSGDQGRV 2655          

HSP 13 Score: 67.0106 bits (162), Expect = 5.126e-11
Identity = 79/294 (26.87%), Postives = 121/294 (41.16%), Query Frame = 1
Query:  316 TENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGT----------CSVTLLVTXXXXXXXXXXXXXXENDNPPMF--ANSNIVINVKESTPLGTHLYLKHATDFDSLDN---------GVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQ--LTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHI 1128
            +E  P  TI+ ++SA    ++K S    R++     G++  K  F ID   G+I+    +D E I     +   T           SVT+ V  +             NDNPP+F     N V  V E+ PL + LY  +ATD DS  N         G G+     +K +            +L      D+E    YQ  LT+   D G P   S+  + +N+ D ++  P F +  Y   +  +  +G  + QV+ATD DS   G V + F    N      +++ TTG I
Sbjct: 2417 SEGIPVGTIVVNVSA----ADKDSGANGRVWFAIQSGDD--KGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDL-------------NDNPPVFRVPGPNDV-QVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSG-----------WLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFY---NPTSNALKMNATTGII 2676          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 153.295 bits (386), Expect = 1.684e-37
Identity = 173/670 (25.82%), Postives = 277/670 (41.34%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNL-PLSIHDQDCTSD--VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWI------FPIQNDNKINESIYTRVGTVITRLHAIDVDDLS-HTNITYHIISDNA-KYFYLHPIKGELSFLTTPRQGEN---ILDIVAIDNGNPVRSNQTRLFLYISDKSIN 2574
            NDN P+F +    +++ E+   GT +    ATD D+ DN    Y          F++  +   IY       D ET D Y + ++  D G P   S+ +V + + D NDN P F    Y   I ED  VG  I  VSA+D D  +   + Y   S     K  F ++P TG I + + L  +  N+   + A D G  P      IT+ V D N+H P        F + I         V   EN  P T+II +   D DS  N  ++ +    NS+    +      N +  RL    + + E+     + +   D G   K S   + + + D+N+   VF  S Y+  V E  V  N+  +   D+D  SD  V   IT       F   + T  + + + LD ETKS     ++  + G     L+S     + ++D ND+APV    T T  + EDT  G+ +  + A D D   N+ V +    ++ N+             I           ++Y L + A ++  P       I I VLD ND+ P +I      F +Q+            G  I R+ A+D  D   +  + Y  IS N    F + P  GE+   ++ R   N    + + A D G P  S+   +++ +++++++
Sbjct:    9 NDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSYATYGGSHGNKFAIDASSGRIY--TTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPE---KATFSMNPVTGEITVGQRLDREGANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRP-------VFLSHI-------GTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTI------NSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPA--LSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYSTGMITLNR------------AIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGS---------GVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLH 630          

HSP 2 Score: 135.191 bits (339), Expect = 6.411e-32
Identity = 167/686 (24.34%), Postives = 295/686 (43.00%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNG-----VGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYG---LVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT-----VSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGN----PVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDN-AKYFYLHPIKGELSFLTTPRQ------GENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +ND+ P+F  + + + V+E T  GT +    A D D   N       G   L      KPFS   N ++                Y LT+   +I  P + +   ++I +LD ND+ P+F K  Y     +D   G  I +V A  +D   YG   LV+Y+  S N   +  F++ P TG + +   L     K +   + A D G     +   + + V + N H P        F+  + +T  N+ +          + ++ +  TD+D   NG +   +   NS     +    + N  +Y    L   + E ++   + +S +D G++PK+S  T+ I + D+N+   VF+   Y   + ENT     V  ++  +  D+     V  +I     +  F   + T ++      DFE   S    I   ++G  P R       S  I I  +N+  PV ++   T  + E+   G ++  + A D D+  + +V++  +  S+N++G   F ++S+ GT+ ++ +LD E+  +  L ++A +L      P      TI ++V D ND  P+++  + + +    S   R+G V+T + A+D DD    +I Y I + N    F +  + G   F+ T  +       E  L + A DNG P  +    L + + D  IND
Sbjct:  425 QNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYSTGMITLNRAIAFKPFSALPNPNI----------------YNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEA--VDKFDYGPNALVRYEAISGNGTGR--FRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPP-------VFSKAVYQTSENEDIAV-------GSALLTVTATDRDFGRNGEISYDIIAGNSQEYFGIG---LTNGSLYVSKPL---DYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRT-ADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLG-SDNQQG---FDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGS---RIGHVVTNVTAVD-DDSDIRSIRYGISAGNTGNAFVMDAVTG---FVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDD--IND 1055          

HSP 3 Score: 126.331 bits (316), Expect = 3.199e-29
Identity = 143/599 (23.87%), Postives = 258/599 (43.07%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATD-FDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSST---HTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCTSDVIV--NITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXA---PVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVD 2367
            ND+ P+F  S  ++   +    G  +    A D FD   N +  Y   S   T  F +      +   +   L  +    Y + +   D+G PK   +  V + + + N + P+F K  Y T  NED  VG  +L V+ATD D  + G + Y   + N  ++ +F I  T G +++ +PL  +++ N+   + A D G  P  +   + I ++D+N++ P                 P +      EN  P + ++   V   D DE G+                K  ++ ++    + A    + E      ++I+  D G  P+ +     ++ I I  +NEF  VF +S ++ +V EN    +  L +S  D+D   D +V  ++     +  F     T  L +   LD E    +  ++ +I K   +N +T ++    TI+    +A   P  L+   + H+TE ++ G  + ++ A D D ++ SI    +  +S    G         G ++   ELDRE  + Y L + ATD G P ++   T+ +++ D+NDN P  + P+    ++ E+     GT +  L+A D D
Sbjct:  522 NDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVL--IASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGN--SQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFS--------------PIEYRCELAENTTPRS-VVVCSVRATDRDERGQQSVRYSILGGSG----KDKFVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIV--TLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDPPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRSI----RYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPH-LTPLPCIGRVTEN--KPQGTQVMTLNAEDPD 1088          

HSP 4 Score: 97.4413 bits (241), Expect = 2.407e-20
Identity = 122/504 (24.21%), Postives = 213/504 (42.26%), Query Frame = 1
Query:  907 VRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYK-NFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKV-IYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSH----FRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVL-LEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITY 2394
            V I + DVNDN P+F   ++   I E+   G  ++ V+ATD D+     V Y  A+        F ID ++G I+       + K ++   + A D+G     +  ++ + V D N++ P        F+                E+      I  +  +D D  EN R+  S+    S        N +  ++ + + +    AN   R      ++ +D G  P S++  I + + D N+   VF     ++ + EN       +++   D  S V   I   +   +    F     T +L    +LD ET       +   + G P ++ +T+ T     + D     PV  +      ++E     SNI ++ A D D   +  V +    ++  + G      E+ GTI +T +LDRE +S Y L + ATD G+P LS+   + ++VLD ND+ P +  P     K+ E   T  GT + ++ A+D D  S+ ++TY
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSY--ATYGGSHGNKFAIDASSGRIYTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFD--------------IAEDAAVGASIGTVSASDADIGENARLTYSIV---SPEKATFSMNPVTGEITVGQRLDREGANYSIR------VTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQ---PVFTMSEYAAEVSEGVVE-SNIVTVVAEDRDIGSDGSVTYC---ITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFT-PATLTVKVQED--TGSGTTVIKVSAVDGDVGSNADVTY 469          

HSP 5 Score: 94.3597 bits (233), Expect = 2.140e-19
Identity = 147/575 (25.57%), Postives = 227/575 (39.48%), Query Frame = 1
Query:  607 ENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDH-PVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTL-----ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVI-----SCSDSGEKPKSSTH-TIVIQILDLNEFPAVFNKSTYSLSVKENT----VSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG--PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIE-SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQ 2271
             N +PP+F+ +    +  E   +G+ L    ATD D   NG   Y + +    + F +      +Y  V   LD+E  + Y L +S  D G     S   VRI + DVNDN P+F   +Y   + E+  P   ++  V ATD D      V+Y     + + K  F ID  TG I        +     F+ I A+D G  P   RT      + I +  +N   P     +S F A +             EN P    ++ +  TDKD   +G V   +   ++     L  N     V        S + ++ +  +V +     +   +   P S  H TIV+ + D N+ P  F KS YS  V E +    V  N+     D D  S +   I+     + F     T  +   + LD E  +    ++   + G  P     T   +      +     P+   P    +TE+   G+ + ++ A D D N N      K ++S +  G  +FR+  S G +   K LDREK+  Y + I  TD     LS      I V D NDN P+
Sbjct:  627 RNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNSQEYFGIGLTNGSLY--VSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDK--FVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQ--RTADPPASVHILITGVNEFLP--VFVQSVFTATVA------------ENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTGTLSV--------SGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRS-IRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPL---PCIGRVTENKPQGTQVMTLNAEDPDLNPNRGPF--KYSISGSDYG--SFRLNVSSGVVSTVKSLDREKQDAYNISIKVTDARG--LSAVNFCMIHVEDQNDNRPK 1162          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 219.164 bits (557), Expect = 3.207e-58
Identity = 216/780 (27.69%), Postives = 349/780 (44.74%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGT-------CSVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS-EKVTKPFSLRY----NLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTS----DVIVNIT-DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGP--HRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            I + V E  P NT+IG ++A   + +        +Y +E +G        ++D   G I    + +DRE +    S   G         SVT L+   +  +    I V + NDN P F  S + I+V E+T +G    +  ATD DS  NGV +Y LT+       F L+        +  L V+  LD E  D+Y LT+   D G P+  S  L+R+ + D NDN P F+ P Y   ++E+ PVG  +LQV A D D    G ++Y      +   +  +ID TTG I++  PL  +  N   F + ARD GP P  ++T +TI V D N++ P ++I        I     ++ + +  E+ P  T +  + V+DKD  EN  V C +       L     +  +NK  Y L   +  + E  KE  V I   DSG    SST+++ +Q+ D+N+   VF+ + + +   E        L +   D  S    ++  NI  D Y +  F     T ++   + LD E K    F +   +KG   H+    + T     +   +++   +L   +F + E+  P S +G +   D D+  N+      +++S    G +       GTI  +   DREKES Y   + A D G P  S+   +TI+VLD NDN+P    P  N +    S      + +  + A D+D   + ++ + I   N  + F + P  GE++    +T    G + L +   D G P R     + +Y+++
Sbjct:   24 ILYRVQEEQPPNTLIGSLAADHGLPDSG-----HLYKLE-VG----APYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIR------GIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKG---TATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENA-----HVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP-SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 778          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 219.164 bits (557), Expect = 9.937e-58
Identity = 216/780 (27.69%), Postives = 349/780 (44.74%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNG-IIKASLNVDREVICPQLSATSGT-------CSVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS-EKVTKPFSLR----YNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTS----DVIVNIT-DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGP--HRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            I + V E  P NT+IG ++A   + +        +Y +E +G        ++D   G I    + +DRE +    S   G         SVT L+   +  +    I V + NDN P F  S + I+V E+T +G    +  ATD DS  NGV +Y LT+       F L+        +  L V+  LD E  D+Y LT+   D G P+  S  L+R+ + D NDN P F+ P Y   ++E+ PVG  +LQV A D D    G ++Y      +   +  +ID TTG I++  PL  +  N   F + ARD GP P  ++T +TI V D N++ P ++I        I     ++ + +  E+ P  T +  + V+DKD  EN  V C +       L     +  +NK  Y L   +  + E  KE  V I   DSG    SST+++ +Q+ D+N+   VF+ + + +   E        L +   D  S    ++  NI  D Y +  F     T ++   + LD E K    F +   +KG   H+    + T     +   +++   +L   +F + E+  P S +G +   D D+  N+      +++S    G +       GTI  +   DREKES Y   + A D G P  S+   +TI+VLD NDN+P    P  N +    S      + +  + A D+D   + ++ + I   N  + F + P  GE++    +T    G + L +   D G P R     + +Y+++
Sbjct:  101 ILYRVQEEQPPNTLIGSLAADHGLPDSG-----HLYKLE-VG----APYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIR------GIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKG---TATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENA-----HVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP-SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 855          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000005325.2 (protocadherin-16 [Source:NCBI gene;Acc:101171352])

HSP 1 Score: 210.305 bits (534), Expect = 1.536e-54
Identity = 205/747 (27.44%), Postives = 332/747 (44.44%), Query Frame = 1
Query:  238 LYIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLS---VIYLEVV--HVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTV--SFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH---ITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRI-ESDGTIKLTKELDR-EKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFY 2427
            LY  +I L S  ++ +     +   + E  P  TI+GD+SA     E +     R+Y I       V     ID T GII     +DRE         ++ T  T  V++ V  +             ND+ P F     ++ + E T +GT   L  ATD D        Y +    V   F L    S   V+YL++V   +LD E   +Y L +   D G+P+      + + + D+ND+ P+F + +Y  II+E  P G  ILQV A D D    GLV Y+     ++ +R+F ID  +G I L RPL  + K   + V++ARDN   P V    +TIHV+D N++ P + I        I  +      +S  E   P   +  I VTD D  E   V  S+E  +  + +  K     + +IY +      + E R    + +  +DSG  P  +  +  IQ+ D+N+ P +F++  Y  ++ E     SF L ++  D+D   +  V  + L  +  F     T  +   + LDFE++ +   S+ +I     R  L+ST    I + D+NDNAPV    + F+   + E+T  G+    + A D D      + +  + + +       F I +  G +     LDR E    Y L + ATD G   LS+   + + V+D+NDN P + +P+     ++ S ++  GT + ++ A D D   +  ITY  +   +  F+
Sbjct:   15 LYAFVILLQSTLVLGV-----LELQLDEGQPAGTIVGDISAGLPPGETA-----RLYFISDHEGTGVGSDLDIDETTGIITTKRRLDREERDHYSFIAVTMTGITIEVSITVNDI-------------NDHAPEFPKKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPERYFVIDLKSGVITLNRPLDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTI--------IFLSEDGSPRIS--EGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTK-----DSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGKKWFSIDPITGIITTATALDFESEPAP--SVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVF--SSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITY-ALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGGG--LSSAVGVRVKVMDINDNRPTF-YPVL--YTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPFF 713          

HSP 2 Score: 163.31 bits (412), Expect = 5.496e-40
Identity = 190/746 (25.47%), Postives = 332/746 (44.50%), Query Frame = 1
Query:  295 NPISFTVTENC-PKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANC---ESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLY-----ARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY-FYLHPIKGE--------LSFLTTPR 2472
            +P++  + EN  P  +I    +  +  S  +S +    YSIE     Q  DL  +DP +G++     +DRE           T     L       V   + + DENDNPP+F++ +  I+V E  P+G  +    A D D  +NG   YR+ S      FSL  N     L ++  LD E  + + LT+   D G P+  +SQ++ + ++DVND  P+F++ ++ T + E+   G  +L+V+ATD D    G + Y   + +      F I+P TG I   + L  + +N +   + ARD G  PN  + ++ + V+D+N++ P     +  +  ++ +             N P  ++ F+  TD DS   G ++  +   + D    L           R  ALS+++    E + +  + +   D G    S+T T+ +++LD+N+   VF+K++Y++ V EN       L +   D   D  +N   LY     A   F   + T ++   + LD E  +S NF +  ++  P    + S+    +TI+D+NDNAP  ++          +    + ++KA D D   N  V ++          ++ F I S  G I+ T+ L    ++   L + A D G+P  S  G + + V +V  N  ++    +N   ++       GT + +  A +  D +   I+Y + S N K+ F +    GE        L F  TPR
Sbjct: 1421 DPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELR---YSIEHQW-PQTSDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPS-AISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPNTG--SLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTEDG-----FVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAP--VFAKMWYGLEVPE-------------NQPAVELCFVKATDPDSGPGGELEYKIAAGDPDGDFQLH---------SRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVLQVSATDV--DEGLNGKILYFLSQEADGAFAVDEDTGRITTAAPLDREKLASYNFRVFAVDLSPSVP-INSSAQVKVTILDVNDNAPFFIQDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATP------VKGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRF---SKNARDVSIQENASKGTAVAQAQA-EYPDGTRQGISYSLFSGNKKHLFKISSSTGEIWVESSNGLDFEETPR 2117          

HSP 3 Score: 148.288 bits (373), Expect = 2.093e-35
Identity = 164/659 (24.89%), Postives = 289/659 (43.85%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVG---EYRLTSEKVTKPFSLRYNLSVI--YLEVVHVLDFETCDAYQLTLSVCDIG---TPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRT-LITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNL---PLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPV-LSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRS 2529
            ND+ P F+   + I + E+   G  +Y   A D D    G G   E R + E      S    L  +   L +   LD E+     L +   D     + +   S   R+ + D NDN P+F  P   +++ ED PVG +IL V A D D  + G V Y+  S NN  +  F + P TG + +++ L  + +  F   I A D+G +P ++ + ++ + V D+N+  P  +  E  F   ++            EN  P T ++ +  TD+D   NG +          +  + +  ++ N +   +      + E +   ++ +   D G  P  +   + +++ D+N+   VF K  Y L V EN  +  L     +  D     ++   I        F+    T  L     LD E K      +  +++G     L++T +  + ++D+NDN+PV  + + T  + E+ + G  +  + A D DE LN  +++    +S    G   F ++ D G I     LDREK + Y   + A DL   V ++++  + +++LDVNDN P +I     D  I E    R   V+  + A D D  ++ ++ Y   +   K F ++ + GE+     L +  Q +  L + A+D G+P +S
Sbjct: 1412 NDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQD----GSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPSAISVM-EDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGR--FSLSPNTGSLSILKALDREEQEVFNLTIVAEDHG-IPQLSTSQVLCVQVIDVNDEAPMFQQAE--FGTHVM------------ENKGPGTTVLKVTATDRDQGSNGHIT---------YGGVTEDGFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVELCFVKATDPDSGPGGELEYKIAAGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRG--SPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVLQVSATDVDEGLNGKILY---FLSQEADGA--FAVDEDTGRITTAAPLDREKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFI----QDPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATP-VKGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQS 2027          

HSP 4 Score: 137.117 bits (344), Expect = 4.896e-32
Identity = 187/686 (27.26%), Postives = 302/686 (44.02%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDS---IKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFV-IEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFN---YINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPL-------SIHDQDCTSDVIV------NITDLYARSHF---RYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQN-DNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK---YFYLHPIKGELSFLTTPRQGENI----LDIVAIDNGNPVRSNQTRLFLYISDK 2565
            NDN P F   N V  +KE+      +    A D D   NG   Y + S  ++  F +      I      ++D E     +L ++  D G+P+      + + I+D NDN P    P+    I E+  +G  I  V+  D+DS   + Y L+       +  A   F I   TG + +  PL  + K +  V ++A D+      N   ITI V+DIN++ P        F   + +       +S  E+ PP + +I +  TD+DS ENGRV   +     +   +   N   +IN++  +            R  V +VI  SD G    SS  T+ + I D+N+   VF++S Y   V E+T   +  L        +  ++C  D  +      N+  + +   F   R  Q    L+L   LDFETKS  N ++ + ++G P R+   S+ +  ITI D+NDN PV   P  T  ++E    G+ I  + A D D   N+ V +    +S+    +  F I+   G ++L + LDRE +S + + I ATD G    +    I + V DVNDN+P   FP++     I E++     + +T LHAID D      + Y+++  +      F +    GE+     P   E I       VA+D+GN   +   ++F+   D+
Sbjct: 2143 NDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSSMSGLFKIDPVTGSI--TTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQEIR-IPENTLIGTEITLVTGNDVDSSPALSYSLL------LDPTALGKFGIHRYTGGVSITGPLDFEEKTWYTVTVQATDSQHQTEAN---ITIVVEDINDNAP-------LFTHDLYQ-------ISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFD---------PERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRS---SSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQY---TISSGDE-MNLFSIDQWTGALRLQRALDREHQSTHVVIIQATD-GQGYFALVPVI-VDVKDVNDNHP--YFPVETLTATIQENL--PANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRS-KIPFDFEKINSFNFVAVAVDSGNHSATVTVQVFVTGEDE 2779          

HSP 5 Score: 134.035 bits (336), Expect = 4.514e-31
Identity = 189/753 (25.10%), Postives = 315/753 (41.83%), Query Frame = 1
Query:  448 FQIDPTNGIIKASLNVDRE---------VICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFK--KP---KYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTL-ITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDII-----FIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALS--SANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSF---NLPLSI-HDQDCTSDV--------IVNITDLYAR--SHFRYL--QATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            F I P +G +    ++DRE         +   + S T  T S T+ VT+ +           ENDN P  +   + + V+E+   GT      ATD D+  N    YRL      K F +      I   +   LD E   +YQL + V D GTP   ++    I++LD ND+ P F   +P   + F  + E  P G M+  V+A D D  + G V Y  + +  E    F ++P TG +    PL   +   + F + A D+G  P ++ T  I I V   +   P   +   T N  +  T P   + S  + + P ++++     ++VV   D D    V    ++   D  ++ + +Y         V +S  S    +   V + I+  DS +     +   V  ++  N+ P     S Y+    +   S     L  SI H    TSD+        ++ I     R  + F YL  +AT Q V  S   + + ++  F ++  N  P                      PV   P+   + ED   G  I  + A+D+DE  N  V + +I   NN      F +  + G++ + K LDRE++ ++ L I+A D G P LST+  + + V+DVND  P +    Q +   +       GT + ++ A D D  S+ +ITY  ++++   F ++P+ G ++    L    Q   +L + A D G P   N  +  + +  + +ND
Sbjct: 1040 FGIMPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRTGSATVRVTVTD-----------ENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLL--HADKHFQINSQTGEISTRL--ALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFE-VREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVE---RFSLNPNTGELKTASPLRWAERAEYTFTLTAADHG-TPGLSSTCQIRIQVISSSRSIPKPNVLSMTLNV-VEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMV----DRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGA---SIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLF-VKDENDNP----------------------PVFSSPSAISVMEDQPVGFVILHVMAHDADEGENGRVSY-RIQSGNNA---GRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMF---QQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTEDG--FVINPLTGVITTTKELDAELQNHYVLTVYARDGGLP--PNFAKAVVRVEVQDVND 1730          

HSP 6 Score: 114.005 bits (284), Expect = 6.577e-25
Identity = 165/683 (24.16%), Postives = 289/683 (42.31%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQY-KNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQ---CSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYA------------RSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINK--GPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF-HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDN----KINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGEL---SFLTTPRQGENILDIVAIDNGNPVRSN--QTRLFLYISDKSI 2571
            NDN P F      +++   +  GT +    A D D+ +NG   YR      +  F+L  +  VI L     L  +      + ++  D        +  V ++I+  + + P+F++ +YF  ++ED   G  +  V A     +  G + Y  +S + +   +F +D T+G I    PL  +   +    I+AR   P P+   + + I + DIN++ P       TF     ++     +          T I  I  TDKDS  NG++     S     S        +  + +V  RL+   S +   R ++ V+    D G    SST T+V+ I   +     F+  TY + ++EN       L +   +  +      +   +             + F  +  +  L + S LD E K     ++   ++  G  R     + +  +T+ D NDN+P L +   F  + E+   G+  G + A D D  LN+ + ++ ++        ++F+I S  G I     LDRE++S Y L ++  D G P  S TGT  ISVLD ND+ P +   ++ D     ++ E + +  GT++  + A D D+  +  + Y +     + F L+P  GEL   S L    + E    + A D+G P  S+  Q R+ +  S +SI
Sbjct:  659 NDNRPTFYPVLYTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPFFTLNKDTGVISLS--RSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVFEQAQYFFTVSEDVLRGTAVGVVRAATKTGVSKG-IYYSISSGDPDG--YFTVDSTSGTIRTALPLDHETCSSLDLEIQARYGSP-PSYGISRVHISISDINDNAP-------TFLPSSSESLLLPEVTKM------GTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDRGSGEV--RLIGSLSYDSVPRYDLQVI--AKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGDAAGFGIMPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRT---GSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLLHAD------KHFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTH-VRPDTERMFEVREGLPS--GTMVGSVAAKDPDEGENGTVYYSLSGSRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSI 1306          

HSP 7 Score: 114.005 bits (284), Expect = 7.038e-25
Identity = 165/684 (24.12%), Postives = 286/684 (41.81%), Query Frame = 1
Query:  406 YSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQ---LSAT-------SGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL--IRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKD-SDENGRVQCSMEQFNSDWLIMLK--FNYINNK---VIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN--LPLSIHDQDCT--SDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP-----QWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDL 2373
            YSI+S     +  LF+IDP  G I  +  +DRE+       ++AT       +G  ++T+++               +NDN P        I + E+T +GT + L    D DS         L    + K    RY   V    +   LDFE    Y +T+   D    +H +   + I + D+NDN P+F    Y   + E  P G  ++ V+ATD DS + G V Y+  S+  E    F IDP+ G +F+        +  +   VIEA D G     + T + +H+ DIN+            NA +      +++VS  E+  P + ++     D D S EN     ++   N   +  ++    ++  +    +  L+     + E++    + +  SD G   +SS+   +I I D+N+ P VF++  Y++++ E  VS    + L+  D D T  ++V   I+     + F   Q T  L L   LD E +S+    + II     + +              +++    +E  T  I E+    S +  + A D D  +   + +  +  S + R  ++F IE + G ++     D EK + +    +A D GN   S T T+ + V   ++ +P      + F +    K  +SI    G V+ R     VD +
Sbjct: 2186 YSIQS---SSMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIID-------------QNDNSPTIPLPQ-EIRIPENTLIGTEITLVTGNDVDSSPALSYSLLLDPTALGKFGIHRYTGGV---SITGPLDFEEKTWYTVTVQATD---SQHQTEANITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEG---FYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDIND------------NAPVFHQSEYRAMVS--EDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGALRLQRALDREHQST---HVVIIQATDGQGYFALVPVIVDVKDVNDNHPYFPVETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGR--DSFVIEQNSGEVRSKIPFDFEKINSFNFVAVAVDSGN--HSATVTVQVFVTGEDEYDPLFTSTDFAFEVPEGAKKGQSI----GQVLARDEDGGVDGI 2818          

HSP 8 Score: 112.079 bits (279), Expect = 2.223e-24
Identity = 169/656 (25.76%), Postives = 278/656 (42.38%), Query Frame = 1
Query:  649 INVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHI----FLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSS----ANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT--VSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSH-LDFE-TKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFH-------ITEDTKPGSNIGSIKANDSD------------ENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIIS-DNAKYFYLHPIKGELSF---LTTPRQGENILDIVAIDN 2511
            ++++E+   GT +    A   D    G+  Y L S      F +  +   I++E  + LDFE     +L +    + +    +  LV   + DVNDN P F+   Y   + E       I+QV A D+D  + G V Y   S++      F+IDP TG I     + R + TQ K    V+ A D G         +T+ + D N++ P I + +                +   EN    T+I  +   D DS                + ++L    +    I+R     S     + E +    V +  +DS  + +++   I I + D+N+   +F    Y +S+ E+T   S  + ++  D+D   +  VN   + +     Y+  +   +  +H  +F+  + S+N  IE  + G     L+S T+  + I DINDNAPV      FH       ++EDT PGS +   +A D+D             N N   VFQ   + ++ R LE    ++ GT+ L + LD E +SLY L ++ +D G P  S++    I++ DVNDN P +  P +    ++E   +  GT I RL A D D   +  + Y I S D    F +    G L     L    Q  +++ I A D 
Sbjct: 2053 VSIQENASKGTAVAQAQAEYPDGTRQGI-SYSLFSGNKKHLFKISSSTGEIWVESSNGLDFEETPRLRLVVKAETVSSTSFMAFNLV---LQDVNDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSSMSG--LFKIDPVTGSITTTAIMDREIFTQTK---LVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQE---------------IRIPENTLIGTEITLVTGNDVDSSP-----------ALSYSLLLDPTALGKFGIHRYTGGVSITGPLDFEEKTWYTVTVQATDSQHQTEAN---ITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGG--SPALSSLTTVQVHISDINDNAPV------FHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQ---IESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRP-EYTVALSEGAVS--GTEIIRLTATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGALRLQRALDREHQSTHVVIIQATDG 2656          

HSP 9 Score: 108.227 bits (269), Expect = 3.684e-23
Identity = 170/642 (26.48%), Postives = 264/642 (41.12%), Query Frame = 1
Query:  739 YRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCS-----SQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSD---------VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEI--INKGPHRNFLXXXXXXXXXXXXXXXXAPVLLE-PTTFHITEDTKPGSNIGSIKANDSD-ENLNSIVVF---QKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTT-GTIT--ISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIIS-DNAKYFYLHPIKGELSFLTT-PRQGENI--LDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            YRL  +     F +  +    +L V   LD E  D Y LT+    + T +H       S  VR+ + D NDN P   + + F  + E+   G    +VSATD D+     + Y+       A + FQI+  TG I     L   Q  ++Q  +  +D G  P        I V D N+H P       TF      T   + +    E  P  T +  +   D D  ENG V  S+     +   +       N     L   S      R E    ++ +D G    SST  I IQ++  +      N  + +L+V E T   ++  S+   D             ++V+ TD         L+    + L   LD+E  SS    +E+   +K    ++L       I + D ND+AP   E P T  I E+ +PG++I + +A D D    NS + +    +   +++   L+       G + + ++LDRE     YL + ATD    +     G++T  + V D NDN P +  P    + I+      VG VI  + A D D+  +  ++Y I S +NA  F L P  G LS L    R+ + +  L IVA D+G P  S    L + + D  +ND
Sbjct: 1029 YRLRPDGDAAGFGIMPDSG--WLFVRSSLDREAKDMYLLTV----LATSRHSGTGRTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLL----HADKHFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAP-------TFTHVRPDT---ERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVERFSL-------NPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRG--DVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYL---VKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPL----SGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSP----SAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVID--VND 1628          

HSP 10 Score: 107.842 bits (268), Expect = 5.344e-23
Identity = 192/801 (23.97%), Postives = 316/801 (39.45%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE--------VIC-----PQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFA----NSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTI---INEDHPVGKMILQVSATDL--DSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARD-NGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKD-SDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSG---EKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN-LPLSIHDQDCTSD--VIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKG-PHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTF--HITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNP----QWI-FPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIIS-DNAKYFYLHPIKGELS---FLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
              V EN    T  G +SA  + +  ++ +  R+              FQI+   G I   L +DRE        V+      P  SAT GT  +++L               DEND+ P F     ++  +  V+E  P GT +    A D D  +NG   Y L+  +V + FSL  N     L+    L +     Y  TL+  D GTP   S+  +RI ++  + + P   KP   ++   + E    G +I  V   D    ++  G V Y       +    F +D   G ++L+R L   +  ++   +E  D +   PN     + I+V+D N+H P       T              +   EN  P   I      D+D S  N  ++ S+E        +L  + ++  +  R       + ES   + +V+  +D      + +  + T  + + D N+ P VF+  +    +++  V F  L +  HD D   +  V   I        F     T  L +   LD E +   N +I   + G P    L+++    + +ID+ND AP + +   F  H+ E+  PG+ +  + A D D+  N  + +  +         + F I    G I  TKELD E ++ Y L + A D G P       + + V DVNDN P     W    +  +    E  + +         A D D      + Y I + D    F LH   G LS    L   ++ +  L++VA+D G+P  S    + + + D  +ND
Sbjct: 1105 LAVRENLVAGTGFGRVSATDRDAGLNARLTYRLL--------HADKHFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSAT-GTAHISVL---------------DENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVER-FSLNPNTG--ELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIP---KPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTY-LVVDGTDRDGTFMVDRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVT--------------IVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIR----QQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQ---LSTSQVLCVQVIDVNDEAP-MFQQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTE-------DGFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVELCFVK---------ATDPDSGPGGELEYKIAAGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLD--VND 1834          

HSP 11 Score: 106.686 bits (265), Expect = 1.096e-22
Identity = 142/560 (25.36%), Postives = 241/560 (43.04%), Query Frame = 1
Query:  310 TVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGII----KASLNVDREVICPQLSAT-SGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFD----------SLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGP-----VPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQ-CSMEQFNSD---WLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENT---VSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLD--------FETKSSINF-SIEIINKGPH 1881
            ++ E+ P  + +  ++A  + S ++  +  R+ S         ++ F IDP+NG +    +A  + +R  +   + A+  G+ +++ L T+   I +I       NDN P+F  S     V E T  G+ L +  A D D          ++ NG        E   +    R   +V  L +   LDFET   Y LT+ V D G P+  SS    I I DVNDN P+F +P+Y   ++E    G  I++++ATD DS     V+Y  +S   +    F ID  TG + L R L  ++++   VI    +G      VP      + + VKD+N+++P   +   T  A I             EN P N+ +  +   D D+   G+++   ME+  S    ++I      + +K+ +    ++S N         V    DSG    S+T T+ + +   +E+  +F  + ++  V E      S    L+  D+D   D IV  + L +  +F   + T   V+F  LD          TK      ++E+   GPH
Sbjct: 2362 SLPEHTPPGSAVITVTATDRDSGENGRVNYRVMS-------STQEGFYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDI-------NDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISS--GDEMNLFSIDQWTGALRLQRALDREHQSTHVVIIQATDGQGYFALVP------VIVDVKDVNDNHPYFPV--ETLTATI------------QENLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFN--------FVAVAVDSGN--HSATVTVQVFVTGEDEYDPLFTSTDFAFEVPEGAKKGQSIGQVLA-RDEDGGVDGIVLYSLLPSSPYFDVNKTTG--VIFLKLDSSSSSSGSGRTKRETRLMTLEVKAHGPH 2872          

HSP 12 Score: 87.8113 bits (216), Expect = 6.750e-17
Identity = 153/692 (22.11%), Postives = 268/692 (38.73%), Query Frame = 1
Query:  307 FTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLS----------ATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKES-TPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLR-YNLSVIYLEV--VHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDS--------IKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQF--VIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN----KSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQ-----ATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDEN--LNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVL-STTGTITISVLDVNDNNPQW 2274
            FTV+E+  + T +G + A  K     + + K IY   SI +      F +D T+G I+ +L +D E  C  L            + G   V + ++ +             NDN P F  S+    +    T +GT +Y   ATD DS  NG   + L S         R + +     EV  +  L +++   Y L +   D G P+  S+  + ++I   +   P F    Y   + E+ P+    LQV A + ++             + Y+     + A   F I P +G +F+   L  + K+     V+    +          + + V D N++ P              +    +  ++  EN    T    +  TD+D+  N R+   +   +  + I  +   I+ ++        + + E +    + +   D G  P+S+T T  I +LD N+    F      +     V+E   S  +  S+  +D   D   N T  Y+ S  R  +      T +L   S L +  ++   F++   + G      T      +     +   P +L   T ++ E T PGS IGS+   D  E+  L   V +  ++ ++        R+  D  + L +ELD EK S Y L +  +D       S    + I+V D ND+ PQ+
Sbjct:  777 FTVSEDVLRGTAVGVVRAATK-----TGVSKGIYY--SISSGDPDGYFTVDSTSGTIRTALPLDHET-CSSLDLEIQARYGSPPSYGISRVHISISDI-------------NDNAPTFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGDAAG--FGIMPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRTGSATVRVTVTDENDNSP--------------RLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLLHADKHFQINSQTGEISTRL--------ALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKD--PDEGENGTVYYSLSGSRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLS-MTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRGD--VYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQF 1418          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 206.068 bits (523), Expect = 6.727e-54
Identity = 219/791 (27.69%), Postives = 352/791 (44.50%), Query Frame = 1
Query:  322 NCPKNTIIGDMSA---------YRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCS----VTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK-------VTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEA-KRWFQIDPTTGHIFLIRPLSTQYKNF-QFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVS--FNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLL--------EPT------TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIES-DGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAK-YFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRL-FLYISD 2562
            N PK+  I   SA         YR VS+   + + R+     +GN           T  I   S  +DRE +CP  S     CS    V +L      ++ I II+ D NDN PMF +  I I++ E+T + +   +  ATD D+  N V +Y L + +       V  P   ++      L V   LD E  D Y + + V D G+P+  S+ ++++ + DVNDN P+F++ +    I E+ P+G  ++Q+ ATD D      + Y F +  + A KR F ++ T+G I + RPL  +     +  + A D    P   R  + I+V D+N++ P+I +             P    V   E +P NT I  I V+DKD+D NG+V C +E+   D    LK  Y N    Y L   +  + E  KE    I  SDSG+   + T  + +++ D N+ P +F +    L+V EN     F   LS  D+D   +  + +  L   + F               D + K+ +  +  + ++     FL + T+       +   A V++         P        F ++E+    S +G I   DSD   N+ +    +N +      ENF ++   G IK     DRE++S Y   + A D G P  S+   +TI+V+DVNDN P  I+P  N +     + +  G+V+  + A+D D   +  + Y I+S N K  F + P+ G ++    P     G + L +   D G P   +   L FLY++D
Sbjct:   42 NIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRV-----LGN-----------TGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWP----QLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLR--------YIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEK---DVPFHLKAVYDNQ---YLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEI-VYQLGPNASF--------------FDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDN------ENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHTLVLVFLYVND 775          

HSP 2 Score: 82.0333 bits (201), Expect = 2.799e-15
Identity = 147/603 (24.38%), Postives = 247/603 (40.96%), Query Frame = 1
Query:  901 QLVRINIL--DVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNN----------EAKRWFQIDPTTGHIFLIRPLSTQYKN-FQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSM-EQFNSDWLIMLKFNYINNKV------------IYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKE--NTVSFNLPLSIHDQDCTSDVIVNITD-----LYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQW------IFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHP----IKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSIND 2577
            +L++I I+  D NDN P+F  P     I E+  +       SATD D+    + KY+  +  +          E ++W Q+        + + L  + K+ +   I+  D G     +  ++ + V D+N++ P  +               N+  V   EN+P  T ++ +  TD D   N  +      Q +     +   N  +  +            I++L  L+S    S     V+I+ +D  + P +         +DL    +  N + + LS K+  NT    + +S  D D    VI  I       L A    +YL  T  L     LD+E     NF I   + G  +  L  T    + + D NDN P+  +P     + E+ K    + ++ A D D   N+ +V+Q   +  N    +  R    G +  ++  DRE +  +   + A D G P L     + ++VLD NDNNP++       F  +N  K     Y+ VG VIT     D D   +  I+  I++DN + F L P    IK  +SF    +Q     D+ AID+G P  S+  ++ + + D  +ND
Sbjct:  123 RLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQL-------IVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFR--------------ENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPN---------IDLRYIISPINGTVF-LSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSAL-----LDYEGTKEYNFKIVASDSG--KPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQ---LGPNASFFDLDR--KTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPK-----YSTVG-VIT---VTDSDAGENAAISLSILNDN-ENFILDPFSGVIKSNVSF-DREQQSSYTFDVRAIDSGRPPCSSAAKVTINVID--VND 669          

HSP 3 Score: 70.8626 bits (172), Expect = 7.079e-12
Identity = 83/316 (26.27%), Postives = 137/316 (43.35%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDRE----VICPQLSATSGT----CSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEK---VTKPFS--LRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKY---FTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFL-IRPLSTQYKNFQFVIEARDNG 1197
            I   V EN  ++  +  +SA  + S K++ I+ ++    S         F +D   G++ AS   DRE     +    +  +GT        ++VT+++           ENDN P F +++    V E+ P  + + +   TD D+ +N      + ++    +  PFS  ++ N+S          D E   +Y   +   D G P   S+  V IN++DVNDN PI   P     F ++      G ++ +V A D D+     +KY   S NN  K  F+IDP TG+I L  +P  T     + V+   D G
Sbjct:  473 IELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNAS--------FFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLD-----------ENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVS---------FDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLG 758          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 206.068 bits (523), Expect = 1.149e-53
Identity = 186/694 (26.80%), Postives = 316/694 (45.53%), Query Frame = 1
Query:  610 NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSE---------------KVTKPFSLRYNLSVIY---------------LEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLS-TQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLK----FNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNIT---DLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPT-TFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNA-KYFYLHPIKGELSFLTTPRQ---GENILDIVAIDNGNPVRSNQTRLFLYISD 2562
            NDN P F +  + ++V+E+ P+GT   L  ATD D   NG+  Y L  +                  + F    + S ++               L +   LD E  D+Y+LTL V D G P   S  ++R+ I DVNDN P F+K  Y   + E+   G  ILQ+ A D D    G ++Y F +     +R  ++D +TG + ++  +   +    +F + ARD G  P +++  + +++KD N++ P I+I       KI +      + +  E+   +T I  + V+D+D  ENG V C++     D    LK         NK  Y L   +  + E+ +E  VVI   DSG    +S +++++++ D N+ P +F+K+   +S  EN        ++   D  S     I+   D      F     +  + + ++LD E K    F +   +KG   N L  + +  + + D NDN P  ++   TF++ E+  P S +G +   D+D+  N+     ++ +   +           GTI  T   DRE+++ Y   + A D G+P  S T T+++ V+D NDN P   FPI +   +     T V TV+  + A D D   + ++ Y II  N  + F +    G +S +    Q   G + L +   DNG P +S  T + +Y+++
Sbjct:  137 NDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIR------KIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVV---GDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKG--INTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNA-----EMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSST-VRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNE 813          

HSP 2 Score: 105.531 bits (262), Expect = 1.598e-22
Identity = 163/706 (23.09%), Postives = 292/706 (41.36%), Query Frame = 1
Query:  691 LKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLV--RINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNE-------------AKRWFQIDPTTGHIFLIRPLST------------------QYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNE-FPAVFNKSTYSLSVKENT------VSFNLPLS---IHDQDCTSDVIVNIT-------DLYARSHFRYLQATQQLVLFSH--LDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTT-FHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESD-GTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWI-----FPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGEN--ILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFTLV 2625
            L+  ++F  +DN  GE   T+EK      L+    +I+ E    +DFE          V  IG P      L   ++ ILD+NDN P F  P     + E+ P+G + L  +ATD D  + G+ +Y+    N E              KR F    +   +F ++   T                  Q  +++  +  RD G  P  ++ ++ + + D+N++ P  +  +S + A +             EN+ P + I+ +   D D   NG+++            +L+     ++    L  L   + E   ++   +   D G+ PK    T+V+ I D N+  PA+  +    + +K+        V  + P++   + D+D   + IV  T        L   S     Q  ++  L +   LD+ET    N  I  ++ G     LTS  S  + + D NDN P+  +        E+  PG  + ++ A D+D   N+ + +   ++ ++  G+  F I+SD G I++   LDRE++  Y   ++A D G   L  + T+ + V D NDN P+++     F ++ +   N    + VG V      ID D   +  +   I  +   +   +      S L+  R+ +      + A+D G+P RS    + L++ D+  ND   T      S +TL+
Sbjct:   68 LESGSEFFKIDNITGEL-TTNEKRIDREKLQ-QCQMIFDENECFIDFE----------VSVIG-PAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNP--RFEKSVYEADLP------------ENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRL----DESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPS--LTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISY---SLDSSVNGI--FSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPN----SPVGMVT----VIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDE--NDNAPTVTFPINSSYTLL 725          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000026621.1 (SMESG000026621.1)

HSP 1 Score: 1682.15 bits (4355), Expect = 0.000e+0
Identity = 910/920 (98.91%), Postives = 916/920 (99.57%), Query Frame = 1
Query:  148 MPKXXXXXXXXXXXXXXXXXXVKNSFYSHRLYIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFTLVAVVPXXXXXXXXXXXXXXXXVVRRQNARNKNRRTQINSKTIESLSRKQCHMSNPKEKLLQTKIIDNQPNQNIEMQHNIDTLDLTQTKPLPKVSY 2907
            MPKSKVILSSSIT+CSIQSLLVKNSFYSHRLYIIIIFLSSFQLVYISC+NPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTIMNDIVNI+IIIVDENDNPPMFANSNIVINVKESTPLGTHLYLKHATD DSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLTSTTSFFITIIDINDNAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKL KELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQG+NILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFTLVAVVPIMILICILMLILCLLLVVRR+NARNKNRRTQINSKTIESLSRKQCHMSNPKEKLLQTKIIDNQPNQNIEMQHNIDTLDLTQTKPLPK  +
Sbjct:    1 MPKSKVILSSSITNCSIQSLLVKNSFYSHRLYIIIIFLSSFQLVYISCLNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTIMNDIVNIVIIIVDENDNPPMFANSNIVINVKESTPLGTHLYLKHATDLDSLDNGVGEYRLTSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLTSTTSFFITIIDINDNAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGLENFRIESDGTIKLMKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGKNILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFTLVAVVPIMILICILMLILCLLLVVRRRNARNKNRRTQINSKTIESLSRKQCHMSNPKEKLLQTKIIDNQPNQNIEMQHNIDTLDLTQTKPLPKCGF 920          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000030992.1 (SMESG000030992.1)

HSP 1 Score: 330.487 bits (846), Expect = 1.112e-95
Identity = 299/974 (30.70%), Postives = 497/974 (51.03%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL-TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNK-VIYRLVALSSANCESRKEV-MVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN-LPLSIHDQDCTSDVIVNITDLYARSHFRYL--QATQQLVLFSHLDFE-TKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKI-----NVSNNKRGLENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESI-YTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLASRSYFTLVAVVPXXXXXXXXXXXXXXXXVVRRQNARNKNR-----RTQI-NSKTIESLSRKQC--HMSNPKEKL-LQTKIIDNQPNQNIE-------MQHNIDTLDLTQTKPLPKVSYQCLV---------TNDMDMCSADSGEGASEDDISNYLMLKSND--QYRMGGCSQHCCSLLPENSIAHFICSTINHP 3102
            ++F+++EN P +  +G ++   +V EK        + ++ I  +  K LF ID  +G+I  S  +DRE ICP++S T+  CS++L+V+++  ++NI I IVD NDN P F ++  +I + E+  +   L L+ ATD DSL  G+  Y+L TSE +  PF+L  +     L+++  LDFE  + Y L L VCD G+   CS Q + I I+D+ND  P F +  Y  ++NE   VG +IL+V A D +   +G + Y+   +N    R+ +ID  TG I+LI+PL    +     IEA+D G VP    T + IH+ D+N++ P+++   S  N        N   +  +EN P +  +  + V DKD   NG+V C +          +  N I  +   Y+LV   S + E+   V    ++C+D+G    S+  +I I ILD NE+P  F+   YS +  E   S N +  ++ D D TS     I   +      ++  +   +L+L   +D E T       I I     ++NF TS++S  IT+IDINDN P L+    F + E++   S++G IK  D D+N N+      +     N S++K  ++ F++   G I+ T  LD EK     + ++ATD G P L++T T+ + +LD NDN PQW+FP   DN +N S+  T   + +TR+ AID+D  ++ NITY + S     F L    G+L+ ++  + G  +L + A D G P ++N + L + I   + ++   + F  S     ++ ++P   L+ ++  ++ ++ +V+ Q  R  +R      TQ+ +   +  L+R +    + +PK  L L++K  +   N  +E       M  +I  +    T  + +  YQ  +          ND+D+CSADSG+GAS +D++        D  +Y       H C +LPE+      CS+ + P
Sbjct:   46 VTFSISENLPPSNRVGILT---EVIEKFRYKAGVHFHLQQIEYQSEKPLFVIDQYSGVISTSAEIDREAICPKISGTNLPCSISLVVSVVEYLINIKINIVDVNDNQPKFQHNKRIIQIPENEEINYTLDLEKATDLDSLQFGIDNYKLLTSEDL--PFTLISSPMQPKLKLIKYLDFEKVELYNLVLEVCDTGS--LCSKQKLIIEIIDINDMAPKFIQKNYSVVVNETLKVGSLILKVHAYDNEKGDFGKILYRLGDSNEYGSRFIRIDSKTGEIYLIKPL-LGLEKILVTIEAQDCGSVPKFAWTKLLIHIIDVNDNRPEVRFNPSQ-NVTSKYISDNFYQIDIFENQPLSIILAIVRVEDKDRGANGKVSCQLHSTKPLKSKEILLNPIKGRHKFYKLVTNVSYDKENDNHVSSYFLNCTDNGSPRLSTVVSININILDCNEYPPYFDSQFYSATTTEELKSENVIKFALADADATSTNEFQINGTHGGWFKIHIIDKKNGKLMLMHPIDREKTDRIDLLIIIINIGLDNKNF-TSSSSVLITVIDINDNPPELVGRNNFEVVENSLIESSLGRIKIRDIDQNRNAQFSISSVKSFCFNKSDDKIAID-FQVNKIGEIRSTVVLDYEKFQQCIISVIATDQGIPSLTSTLTVHLQILDENDNYPQWVFPSSKDNYLNLSVSVTGSSSKLTRIRAIDLDKGANENITYKLHS-QLGLFDLDRFTGDLTSISQLKPGNYVLQVSAQDQGLPSKTNYSNLTINIHMPTSDN---SKF--SSHILLILGLIPTCALVILICAVIPIVFIVKWQKRRQHHRIPLSIETQLYHCPDVNHLTRSEFGNEIKSPKNSLTLKSKYKNALHNDELENSKGFASMPPDIQDICDKITSKISQSEYQGTIKPSMSNASPANDIDVCSADSGQGASVEDVAGNYFKGHYDPLKYPYPLPRYHWCPILPEDKQVECHCSSKSDP 1002          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 278.87 bits (712), Expect = 5.039e-78
Identity = 271/960 (28.23%), Postives = 445/960 (46.35%), Query Frame = 1
Query:  238 LYIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKP--FSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPV-PNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQ---FNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVM-VVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN-LPLSIHDQDCTS--DVIVNITDLYARSHFRYLQATQ---QLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINV-----SNNKRGLEN-FRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINES-IYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY--FYLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGTDFLA--------------SRSYFTLVAVVPXXXXXXXXXXXXXXXXVVRRQ-----NARNKNRRTQINSKTIESLSRKQCHMSNPKEKLLQTKIIDNQPNQNIEMQHNIDTLDLTQT-KPLPKVSYQCLVTNDMDMC-SADSGEGASEDDISNY 2988
            L +I+I  SS +++       I F + EN P N+ +GD++      + +   ++  Y      N    + F ++ T+  I     +DRE IC +LS T+  C VTL VT+   ++NI + I+D NDN P F        + ES  +   + L  A D DS  NGV  Y L   + +    F L   LS++ L ++  LD+E    + L L  CDIG P+ CSSQ + I+I+D+ND  P F    Y  ++ ED  VG +IL+V A D +S  +G + Y+     + +  +  ID  +G I L +PL    K     +EA D+       + T + I + D+NNH P+I +      +  +  G     +  +ENNP N ++ FI V DKD  +NG V+C ++      + + +  +     N   Y+L    S + E     +   I+C D+G+    ST  + + +LD NE+PA+F +S YSLS+ EN  +F+ L  ++ DQD  S  +  +N ++ +    F     TQ   ++ + + LD E      FSI ++N+       TS  +  + ++DINDN P  +   +F + E+  P   +G +  +D D   NS +    +       +    G E+ F I     +++ + +D E      + I   D G P      +I +++LD NDN P+WI+P   DN +N S I  + GT +TR+ AID D +S   +TY +    AK+    + P  GE+S       G+  L +   DNGNP+R++   L + I  +++   I +   A              S  +F  + +                  VV++      +     +RT  N     S       + NP     +T +    PN++  + +NI  L L ++ KP            D ++C SADSG+GASE++I  Y
Sbjct:   14 LVLILILDSSKEMI-------IKFRIYENVPINSKVGDLNTTIDALKLNKPQLQVQYCDR---NPFDIEFFYLNVTDASINTHTEIDREAICSELSGTTNDCFVTLGVTLNQYLINIYVYILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTRLTRVRAIDADSVSSNRLTYEL---KAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINSITRAVLTIIFIPSFIIIFSSGFFIFIVLFLKRRHRSNTDFQFSKSSVVKKNRNFSTSPYRSAQRTSPNHYRNVSPELLMTSLQNP--YYFETDLESELPNESEHISNNIAQLFLKKSMKP------------DCEVCSSADSGQGASEEEILLY 945          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000042292.1 (SMESG000042292.1)

HSP 1 Score: 277.33 bits (708), Expect = 4.549e-77
Identity = 236/777 (30.37%), Postives = 396/777 (50.97%), Query Frame = 1
Query:  301 ISFTVTENCPKNTIIGDMS--------AYRKVSEKSSAIMKRIYSI-ESIGNEQVKDLFQIDPTNGIIKASLNVDREVICP-QLSATSGTCSVTLLVTXXXXXXXXXXXXXXE-NDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTS-EKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQ-FNSDWLIMLK-FNYI--NNKVIYRLVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTV-SFNLP-LSIHDQDCTSDVIVNITDLYARSHFRYLQATQQLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVS--NNKRGLENFRIE---SDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKYFYLHPIKGELSF-LTTPRQGENILDIVAID-NGNPVRSNQTRLFLYI 2556
            ISF + ENC   TI+G+++        +  ++  ++S   K  +S+  +     +K+LF+I+ ++G +     +DRE +C   L   +  C++  +V++   +   + I + + NDN P F   ++ I++ ES+ + + + L+   D DS      +YR+    K   PFSL  N   + LE    +D+E    YQ+ L  CD G P  C +Q V INI + ND  P+F +  Y  IINED  +G+++L   A D D  K+G ++Y F+S  +E K++F ID  TG I +I+  + Q   F+F I+A D  P P + RT I +HV D+NNH P I +  +  ++ ++    N +++   ENN     + FI V+D D  EN R  C ++   N D L   K  N I  N + IY+L+A  S + E  K   + I C D GE   S+   I I I D NE+   F+++ Y + +KENT    N+  + ++D+D T   I+++TD    S +  +  +  +     LD+E    ++F++  IN+G  ++F +S       I   ++     L    F + E+ K    IG I A D D  +NS + +  +N +  NN R +     E   + G I     LD E+  LY + +   D G P LS      I V+D+NDN P W +P  +DN +N S+     +V+TR+ A+D +D    N+ ++ + ++   F ++ + GE++F     + G+  L + AID N   + ++Q+ L +YI
Sbjct:   24 ISFKLVENCSIGTIVGNINLSAQLFVFSNVQLQLENSEDFKEHHSLSHNRFGRSLKNLFKINNSSGDLVTISEIDRETVCQLNLIKRNENCTILQIVSVNKLMWIYVNIEIIDINDNAPAFRQISLSISLSESSKVKSQINLEEPVDLDSDQFQPIQYRIQHLHKSNFPFSLSQNPLKLILE--RSVDYENKKHYQVVLIACDNGKPSLCGNQTVIINITNENDESPMFYRSNYTAIINEDTQIGEIVLSPKAFDKDDGKFGELEYSFSSGADEVKKYFSIDKKTGQISIIKRFN-QPTKFKFSIKATDKAPNPLIGRTWIFLHVVDVNNHSPVILV--NPIDSFLISKFQNHTVIEVSENNRIPFQLAFITVSDLDQGENSRCSCHIQSIINKDHLNYFKIINVIETNERSIYKLLADKSFDAEETKYFSLNILCYDHGEPQNSAITKIEIHIKDENEYQPTFDQNLYEIYIKENTSPETNVKTVKVYDRDLTQSRILDLTD--PGSTWFSIDDSGTISTKIVLDYEKIKKLSFNVLAINRGI-KSFTSSARVSVYVIDVNDNFPKFSLASKRFEVEENLKGFYEIGKIHAFDEDSEINSKLNYYLLNTTSENNARSINEKLFELNPTTGIIYSNVTLDYEECDLYSITVKVIDSGRPPLSNIQRFFIHVVDMNDNGPIWKYPNIHDNVMNISLQNIRDSVLTRVRAVD-NDSDKYNVVHYFLHNHNDIFEINHLTGEITFKRLNIKPGQLTLQLQAIDANSKNIHTSQS-LIVYI 790          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000043597.1 (SMESG000043597.1)

HSP 1 Score: 271.552 bits (693), Expect = 3.872e-76
Identity = 238/806 (29.53%), Postives = 391/806 (48.51%), Query Frame = 1
Query:  238 LYIIIIFLSSFQLVYISCVNPISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDLFQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTXXXXXXXXXXXXXXENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRLTSEKVTKP--FSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCSSQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKYGLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNGPV-PNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYENNPPNTDIIFIVVTDKDSDENGRVQCSMEQ---FNSDWLIMLKFNYINNKVIYRLVALSSANCESRKEVM-VVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFNKSTYSLSVKENTVSFN-LPLSIHDQDCTS--DVIVNITDLYARSHFRYLQATQ---QLVLFSHLDFETKSSINFSIEIINKGPHRNFLXXXXXXXXXXXXXXXXAPVLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINV-----SNNKRGLEN-FRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVLDVNDNNPQWIFPIQNDNKINES-IYTRVGTVITRLHAIDVDDLSHTNITYHIISDNAKY--FYLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLFLYISDKSINDGIGT 2589
            L +I+I  SS +++       I F + EN P N+ +GD++      + +   ++  Y      N    + F ++ T+  I     +DRE IC +LS T+  C VTL VT+   ++NI + I+D NDN P F        + ES  +   + L  A D DS  NGV  Y L   + +    F L   LS++ L ++  LD+E    + L L  CDIG P+ CSSQ + I+I+D+ND  P F    Y  ++ ED  VG +IL+V A D +S  +G + Y+     + +  +  ID  +G I L +PL    K     +EA D+       + T + I + D+NNH P+I +      +  +  G     +  +ENNP N ++ FI V DKD  +NG V+C ++      + + +  +     N   Y+L    S + E     +   I+C D+G+    ST  + + +LD NE+PA+F +S YSLS+ EN  +F+ L  ++ DQD  S  +  +N ++ +    F     TQ   ++ + + LD E      FSI ++N+       TS  +  + ++DINDN P  +   +F + E+  P   +G +  +D D   NS +    +       +    G E+ F I     +++ + +D E      + I   D G P      +I +++LD NDN P+WI+P   DN +N S I  + GT +TR+ AID D +S   +TY +    AK+    + P  GE+S       G+  L +   DNGNP+R++   L + I  +++   I +
Sbjct:   14 LVLILILDSSKEMI-------IKFRIYENVPINSKVGDLNTTIDALKLNKPQLQVQYCDR---NPFDIEFFYLNVTDASINTHTEIDREAICSELSGTTNDCFVTLGVTLNQYLINIYVYILDINDNSPKFQKLERHFKILESESVNFQIKLDQAIDLDSAQNGVYHYLLECSQKSHRNYFILNRTLSLLSLVLIKSLDYEFIPKFVLQLIACDIGQPQLCSSQKLVIDIIDINDEAPKFVAKNYTKVVQEDLAVGSVILKVHAVDRESGDFGKIIYKLIKNEDFSTSFVSIDGNSGTIILKKPLFDIDK-LTLTVEAHDSAEHNSKFDWTHVVIFIIDVNNHRPNISVGSDKRTSTQLLNGYPIYFLEIFENNPENFEVSFINVVDKDEGKNGDVKCKIQTTKLLKNLFYLDSRMRLNKNTYQYKLRIRQSIDREKVSNPLNFSINCQDNGQPLLKSTIILQVDVLDQNEYPALFTRSNYSLSIIENKDNFSILSFAVIDQDALSFNEFHLNSSNNFNMESFHLSSLTQSSGEIRIGNPLDREKSPRYQFSIFVVNEAQDNTKFTSFATVSVVVLDINDNVPQYVGRMSFEMKENNIPSYELGQLIFDDKDIGENSRISISSLTTTCYGPTEKLSGNEDLFWISELKILQVKQSMDYEFIHNCKIDIHFHDEGFPKNHNKISIIVNILDENDNEPEWIYPSSLDNVVNISHINIQSGTRLTRVRAIDADSVSSNRLTYEL---KAKHDSISIDPFTGEISLTKDIEAGKYDLFLQVTDNGNPMRNSSANLTIIIYQQNMFQSINS 805          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH94.613e-5629.55protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.768e-5529.50protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.901e-5529.63protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.998e-5529.50protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH16.673e-5225.54protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-13.499e-4025.32FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-17.074e-2825.68FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.442e-2425.58CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-41.145e-2230.39Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-32.709e-2030.25Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.752e-5327.00gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.752e-5327.00gene:FBgn0284247 transcript:FBtr0343249[more]
ft9.697e-4426.90gene:FBgn0001075 transcript:FBtr0077478[more]
stan7.019e-4326.99gene:FBgn0024836 transcript:FBtr0303223[more]
stan7.019e-4326.99gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh93.059e-5927.78protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.633e-5927.78protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.633e-5927.78protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1a7.742e-5927.66protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CR847522.19.497e-5927.78pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh171.302e-5427.23protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.532e-5427.23protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.567e-5427.23protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh172.335e-5427.23protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh172.858e-5427.23protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh94.670e-5728.27protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh92.636e-5628.27protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.470e-5628.39protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.592e-5628.39protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.592e-5628.39protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN9.597e-5529.50Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q24292|DS_DROME2.024e-5227.22Protein dachsous OS=Drosophila melanogaster OX=722... [more]
sp|Q08174|PCDH1_HUMAN3.205e-5125.54Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q71M42|PC11X_PANTR1.646e-5028.68Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA1.719e-5028.68Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EIU92.817e-6626.89Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QU084.204e-6626.89Uncharacterized protein OS=Mesocestoides corti OX=... [more]
K1P7M13.229e-6326.02Protocadherin-11 Y-linked OS=Crassostrea gigas OX=... [more]
A0A401PYL81.603e-6227.13Uncharacterized protein OS=Scyliorhinus torazame O... [more]
A0A401SS953.069e-6228.31Uncharacterized protein (Fragment) OS=Chiloscylliu... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b1.212e-5927.84protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1a1.693e-5827.64protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.693e-5827.39protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh91.991e-5627.00protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh93.066e-5627.00protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh116.902e-5428.25protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.11.018e-4627.27protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.12.415e-4525.58pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.18.605e-4025.63pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000004042.16.806e-3525.23pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461893.792e-4326.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333593.308e-4026.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.258e-3928.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404705.119e-3926.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354131.684e-3725.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a3.207e-5827.69protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a9.937e-5827.69protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
ENSORLT00000005325.21.536e-5427.44protocadherin-16 [Source:NCBI gene;Acc:101171352][more]
pcdh96.727e-5427.69protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh7b1.149e-5326.80protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
back to top
BLAST of Protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026621.10.000e+098.91SMESG000026621.1[more]
SMESG000030992.11.112e-9530.70SMESG000030992.1[more]
SMESG000043597.15.039e-7828.23SMESG000043597.1[more]
SMESG000042292.14.549e-7730.37SMESG000042292.1[more]
SMESG000043597.13.872e-7629.53SMESG000043597.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000785 ID=SMED30000785|Name=Protocadherin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3406bp
TCACTGATATTCCACCAATCGAATCAACTGAAACATTTAAAACAAATTTG
TCTAAAATCGGGAATTATTTCTTAATGAATCTCGTCTCTGTTTGTTCAAA
CTGATCGGTCGTAGATAAATATGATTATGGATTTCAGATCGAGATAGATG
CCAAAATCAAAAGTTATTCTCTCATCGTCTATTACAAGTTGCAGCATACA
AAGTCTGCTTGTCAAAAATTCTTTCTATTCTCATCGTTTATACATTATCA
TAATATTTTTGTCGTCATTTCAGTTGGTGTACATATCATGCGTTAATCCG
ATCAGTTTTACAGTTACAGAAAATTGTCCAAAAAACACGATAATTGGTGA
CATGAGTGCGTATCGAAAGGTTTCCGAGAAGTCTTCTGCAATCATGAAAA
GAATTTATTCTATCGAATCAATTGGCAACGAGCAGGTAAAAGATCTTTTC
CAAATTGACCCGACAAATGGAATTATCAAAGCCAGTCTCAACGTCGACAG
GGAAGTTATTTGTCCCCAATTGAGCGCTACTTCCGGAACCTGTAGTGTGA
CTCTTTTGGTAACTATTATGAACGATATTGTTAACATCATGATCATAATC
GTCGACGAGAATGATAACCCTCCTATGTTTGCAAATTCAAACATCGTTAT
TAATGTAAAAGAATCAACTCCATTAGGAACTCATTTGTATTTAAAGCACG
CTACCGACTTTGATAGCTTAGATAATGGAGTAGGTGAATATCGCTTGACC
TCTGAAAAAGTGACAAAACCATTCTCTTTGAGATACAACCTTTCTGTTAT
CTATTTAGAGGTAGTTCATGTCTTAGACTTCGAAACCTGCGATGCTTACC
AACTGACTCTGTCAGTATGTGACATAGGAACACCAAAACATTGCTCAAGT
CAATTAGTTCGAATTAACATTCTCGATGTCAATGATAACTACCCAATTTT
TAAAAAGCCGAAATATTTCACCATCATCAACGAAGACCACCCAGTGGGTA
AAATGATCCTACAAGTTTCTGCAACGGATTTGGATTCCATCAAATACGGA
TTGGTGAAGTATCAATTTGCGAGCACAAACAATGAAGCAAAAAGATGGTT
CCAAATCGATCCGACAACAGGTCATATCTTTTTAATTCGACCTCTTTCAA
CTCAATATAAAAACTTTCAATTTGTAATTGAAGCCCGTGACAATGGACCT
GTTCCAAACGTCAACCGAACCTTGATCACGATCCACGTCAAGGATATCAA
TAACCATTATCCTGACATAAAGATAACCGAATCCACTTTCAATGCGAAAA
TAGTCAAAACCGGCCCAAATAAAAGTCTGGTTTCTTTTTATGAAAATAAT
CCCCCAAACACGGATATCATTTTTATTGTCGTCACTGATAAAGACAGTGA
TGAAAATGGAAGAGTTCAATGTTCAATGGAACAGTTCAATTCTGATTGGC
TAATAATGCTCAAATTCAATTATATTAATAATAAAGTAATATATCGCCTT
GTTGCGTTGTCGTCGGCCAATTGTGAATCAAGAAAAGAAGTAATGGTCGT
TATAAGCTGCTCAGATTCGGGAGAAAAACCTAAGTCTTCAACTCACACTA
TCGTGATTCAAATCTTGGATTTGAATGAATTTCCAGCAGTATTTAACAAA
TCTACTTATAGTTTGTCAGTAAAAGAGAACACAGTATCATTTAACTTACC
GCTATCAATTCATGATCAAGATTGTACATCAGATGTCATTGTAAATATCA
CTGATTTATATGCAAGATCACATTTTCGCTACCTCCAAGCAACACAGCAG
TTGGTTTTGTTTTCACATTTAGATTTCGAGACCAAATCTTCAATAAACTT
TTCCATTGAAATTATCAACAAAGGACCTCATAGGAACTTTCTCACTTCAA
CTACTTCTTTCTTTATAACGATAATAGATATTAATGACAATGCTCCAGTA
CTTCTTGAACCGACTACATTCCATATCACTGAAGACACAAAACCTGGATC
CAATATTGGAAGTATTAAAGCAAATGATTCCGATGAAAACCTTAACAGCA
TTGTCGTGTTTCAAAAGATTAACGTTTCCAATAACAAAAGAGGACTGGAG
AATTTCCGAATCGAAAGCGATGGAACTATAAAATTAACGAAAGAGCTTGA
TAGAGAAAAAGAAAGTTTATATTACCTCCCTATTTTAGCAACAGATCTTG
GTAATCCAGTTCTATCAACGACCGGAACGATTACAATATCTGTTCTCGAT
GTCAACGACAATAATCCTCAGTGGATATTCCCGATCCAGAATGACAACAA
AATAAATGAATCCATCTACACGAGAGTTGGGACCGTCATAACTCGACTCC
ATGCCATAGATGTCGATGATTTATCCCACACAAACATCACCTATCATATC
ATTAGCGACAACGCTAAATACTTTTATCTTCATCCTATAAAAGGCGAACT
AAGTTTCCTGACGACTCCAAGGCAAGGAGAAAATATTTTAGACATTGTAG
CCATTGACAATGGGAACCCAGTAAGATCTAATCAAACAAGATTATTTTTA
TACATTTCTGACAAATCAATAAATGATGGAATCGGGACAGATTTCCTTGC
ATCACGGAGTTATTTCACTTTGGTTGCCGTCGTCCCAATAATGATTCTTA
TTTGTATTTTAATGCTCATTCTCTGTCTTTTACTCGTTGTTCGTCGACAA
AATGCTCGAAATAAAAATCGTCGAACTCAAATCAACAGTAAAACCATCGA
AAGCCTGTCTCGCAAGCAATGCCATATGTCGAATCCGAAGGAGAAACTTT
TACAAACGAAAATCATCGACAACCAACCGAACCAAAATATCGAAATGCAG
CATAATATTGATACGTTGGATTTGACGCAGACGAAGCCATTGCCGAAGGT
GAGTTACCAATGTCTTGTAACGAATGACATGGATATGTGCAGTGCGGATT
CTGGGGAAGGGGCCAGTGAGGACGATATAAGCAATTATCTCATGTTAAAA
TCGAATGACCAATACCGGATGGGCGGGTGCAGTCAACACTGCTGCTCGTT
GCTTCCAGAGAATTCAATAGCACATTTCATTTGCTCAACGATAAATCATC
CAATGCTCTACTCACAGACTATGGAAACCCTGACCACCGACGATCCGAAT
TCATATCTCATATACAACACCAAATGCAACACAAACATCCAACCAATTCC
TCAAAATACCTACAAGATGTCATGTCTAAATCCTATGTGTAAAAAACTCT
GATACTTACTTTACTGGTTTTATCCTAGAGTTATTGAGATTAACATTTTC
CTTCTCAATCAGTTAAGCTCATTCTGGATGACTGGGAAATATCAGTTTTC
ACTTCTGTTTTGATAAGAATTATTGATAAATAAATCTTATTTTCTGAAAA
AAACAA
back to top

protein sequence of SMED30000785-orf-1

>SMED30000785-orf-1 ID=SMED30000785-orf-1|Name=SMED30000785-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1035bp
MPKSKVILSSSITSCSIQSLLVKNSFYSHRLYIIIIFLSSFQLVYISCVN
PISFTVTENCPKNTIIGDMSAYRKVSEKSSAIMKRIYSIESIGNEQVKDL
FQIDPTNGIIKASLNVDREVICPQLSATSGTCSVTLLVTIMNDIVNIMII
IVDENDNPPMFANSNIVINVKESTPLGTHLYLKHATDFDSLDNGVGEYRL
TSEKVTKPFSLRYNLSVIYLEVVHVLDFETCDAYQLTLSVCDIGTPKHCS
SQLVRINILDVNDNYPIFKKPKYFTIINEDHPVGKMILQVSATDLDSIKY
GLVKYQFASTNNEAKRWFQIDPTTGHIFLIRPLSTQYKNFQFVIEARDNG
PVPNVNRTLITIHVKDINNHYPDIKITESTFNAKIVKTGPNKSLVSFYEN
NPPNTDIIFIVVTDKDSDENGRVQCSMEQFNSDWLIMLKFNYINNKVIYR
LVALSSANCESRKEVMVVISCSDSGEKPKSSTHTIVIQILDLNEFPAVFN
KSTYSLSVKENTVSFNLPLSIHDQDCTSDVIVNITDLYARSHFRYLQATQ
QLVLFSHLDFETKSSINFSIEIINKGPHRNFLTSTTSFFITIIDINDNAP
VLLEPTTFHITEDTKPGSNIGSIKANDSDENLNSIVVFQKINVSNNKRGL
ENFRIESDGTIKLTKELDREKESLYYLPILATDLGNPVLSTTGTITISVL
DVNDNNPQWIFPIQNDNKINESIYTRVGTVITRLHAIDVDDLSHTNITYH
IISDNAKYFYLHPIKGELSFLTTPRQGENILDIVAIDNGNPVRSNQTRLF
LYISDKSINDGIGTDFLASRSYFTLVAVVPIMILICILMLILCLLLVVRR
QNARNKNRRTQINSKTIESLSRKQCHMSNPKEKLLQTKIIDNQPNQNIEM
QHNIDTLDLTQTKPLPKVSYQCLVTNDMDMCSADSGEGASEDDISNYLML
KSNDQYRMGGCSQHCCSLLPENSIAHFICSTINHPMLYSQTMETLTTDDP
NSYLIYNTKCNTNIQPIPQNTYKMSCLNPMCKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030426growth cone
GO:0044291cell-cell contact zone
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0030900forebrain development
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 268..297
score: 33.64
coord: 497..510
score: 34.88
coord: 691..708
score: 44.34
coord: 353..372
score: 26.73
coord: 657..683
score: 27.9
coord: 99..118
score: 30.9
coord: 339..351
score: 32.08
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 410..497
e-value: 4.2E-7
score: 39.6
coord: 183..266
e-value: 9.2E-14
score: 61.7
coord: 734..811
e-value: 0.15
score: 12.3
coord: 519..600
e-value: 1.1E-10
score: 51.5
coord: 290..372
e-value: 3.4E-15
score: 66.5
coord: 73..159
e-value: 0.015
score: 22.4
coord: 623..707
e-value: 2.8E-21
score: 86.7
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 167..259
e-value: 5.8E-9
score: 36.3
coord: 395..490
e-value: 5.9E-7
score: 29.9
coord: 607..700
e-value: 8.2E-16
score: 58.2
coord: 277..364
e-value: 1.5E-14
score: 54.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 607..704
e-value: 1.8E-21
score: 78.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 382..496
e-value: 6.5E-15
score: 57.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 44..159
e-value: 2.4E-11
score: 45.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 264..373
e-value: 1.2E-25
score: 92.1
coord: 160..263
e-value: 9.4E-23
score: 82.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 497..606
e-value: 4.1E-13
score: 51.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 705..805
e-value: 4.4E-11
score: 45.1
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 520..933
coord: 50..605
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 269..374
score: 19.648
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 162..268
score: 18.267
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 728..816
score: 9.87
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 602..709
score: 26.4
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 389..499
score: 12.545
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 48..161
score: 14.496
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 500..602
score: 13.904
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 395..494
e-value: 2.6654E-12
score: 61.9457
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 51..171
e-value: 4.22976E-7
score: 46.923
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 166..264
e-value: 5.847E-20
score: 83.5169
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 607..705
e-value: 4.63395E-26
score: 101.236
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 273..370
e-value: 1.39229E-23
score: 93.9173
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 503..598
e-value: 4.67408E-8
score: 49.6194
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 725..810
e-value: 2.44172E-12
score: 61.9457
NoneNo IPR availableTMHMMTMhelixcoord: 826..848
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 697..707
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 256..266
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 697..805
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 590..712
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 256..380
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 51..151
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 493..602
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 155..260
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 395..491