Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30000777
Length (bp)780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neur_chan_LBD domain-containing protein (SMED30000777) t-SNE clustered cells

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30000777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30000777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30000777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000777SMESG000041818.1 SmedASXL_005027SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30000777SMESG000041818.1 dd_Smed_v4_36243_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000777SMESG000041818.1 dd_Smed_v6_36243_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A3R7CFX9 (Neuronal acetylcholine receptor subunit alpha-7 OS=Clonorchis sinensis OX=79923 GN=CHRNA7 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.611e-26
Identity = 79/207 (38.16%), Postives = 117/207 (56.52%), Query Frame = 1
Query:   64 EISRTSHDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIG--PRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHA-CTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKD 675
            E+  +  ++S+++     +SQEW ++ HV++ S  I    + G   R    + FT R++R+  YF++N  +IS +  LL+F+ FS+    N   RL L +  LLT+VTFK A SQNLPKI YLTYLDK +L N  M++ L +WH    S+F K+           +   EQ ++  LL  Y +  +V GL +Y DAG RRR M  KD
Sbjct:  188 ELVPSPTEVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVDGN---RLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAKYPG---------LKDKEQYVVYTLLSAYCLGAVVFGLTVYLDAGSRRRLMKSKD 382          

HSP 2 Score: 35.039 bits (79), Expect = 2.611e-26
Identity = 14/24 (58.33%), Postives = 19/24 (79.17%), Query Frame = 2
Query:    2 FPFDCQDLSIPVATEYSINEVKLV 73
            FPFDCQDLS+ V  + ++ EV+LV
Sbjct:  167 FPFDCQDLSVTVTCDRTVEEVELV 190          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A075A8W6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08254 PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 6.215e-26
Identity = 78/200 (39.00%), Postives = 114/200 (57.00%), Query Frame = 1
Query:   85 DLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIG--PRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHA-CTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKD 675
            ++S+++     +SQEW ++ HV++ S  I    + G   R    + FT R++R+  YF++N  +IS +  LL+F+ FS+    N   RL L +  LLT+VTFK A SQNLPKI YLTYLDK +L N  M++ L +WH    S+F K+           +   EQ ++  LL  Y +  +V GL +Y DAG RRR M  KD
Sbjct:  395 EVSQVDRRCAADSQEWKIFHHVDIASMEIQTAYSPGTCKRRHPGLVFTSRSARRAGYFMVNMALISCVLSLLSFSVFSVPVDGN---RLQLSLLLLLTTVTFKFAASQNLPKISYLTYLDKMVLANFFMLVILTVWHTIARSVFAKYPG---------LKDKEQYVVYTLLSAYCLGAVVFGLTVYLDAGSRRRLMKSKD 582          

HSP 2 Score: 35.039 bits (79), Expect = 6.215e-26
Identity = 14/24 (58.33%), Postives = 19/24 (79.17%), Query Frame = 2
Query:    2 FPFDCQDLSIPVATEYSINEVKLV 73
            FPFDCQDLS+ V  + ++ EV+LV
Sbjct:  367 FPFDCQDLSVTVTCDRTVEEVELV 390          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: R7VFY5 (Neur_chan_LBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_215265 PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.042e-24
Identity = 74/209 (35.41%), Postives = 116/209 (55.50%), Query Frame = 1
Query:   64 EISRTSHDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITP--ARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAI---YFDAGKRRREMLLKD 675
            +I    +++S +N    ++ QEW L+EH+EV  K +  E +   R    ++ TCRA+R+  YF  N  ++      L+F +F+++P   +N   RL L  T LLTSV FK  ++Q+LPKI YLTY+DK +L +++++ ++C+WHA  +LF +            + T E  +    + F  I I   G+ I   YFDA KRRR M  KD
Sbjct:  162 DIIPDENEMSGINVQTFVDQQEWRLHEHIEVSKKVMTQEYSSSNRCHPALSVTCRAARRPGYFYWNVFLVMFFISALSFATFAVSPELPQN---RLQLSFTLLLTSVAFKFVINQSLPKISYLTYMDKYVLLSLVILCTVCVWHAIVTLFAR-------NGVMFLITLEHDV---FIAFCVIYIGCHGVFIFWLYFDACKRRRLMKHKD 357          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: R7VF52 (Neur_chan_LBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228357 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.510e-24
Identity = 71/210 (33.81%), Postives = 117/210 (55.71%), Query Frame = 1
Query:   64 EISRTSHDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITP--ARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFXXXXXXXXASVISTAEQKIIPCL----LGFYSIAILVSGLAIYFDAGKRRREMLLKD 675
            +I    +++S +N    ++ QEW L+EH+EV  K +  E +   R    ++ TCRA+R+  YF  N  ++      L+F +F+++P   +N   RL L  T LLTS+TFK  ++Q+LPKI YLTY+DK +L +++++  +C+WHA  ++F            + + T E+ +        +GF+ + I      +YFDA KRRR M  KD
Sbjct:  156 DIIPDENEMSGINVQTFVDQQEWRLHEHIEVSKKVMTQEYSSSNRCHPALSVTCRAARRPGYFYWNVFLVMFFISALSFATFAVSPELPQN---RLQLSFTLLLTSITFKFVINQSLPKISYLTYMDKYVLLSLVILCMVCVWHAVVTVF-------VHHGINFLMTLERDVFIAFSVIYIGFHVVFI----FWLYFDACKRRRLMKHKD 351          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4E0RSR9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_005714 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.435e-24
Identity = 75/200 (37.50%), Postives = 113/200 (56.50%), Query Frame = 1
Query:   85 DLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQI--MTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHA-CTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKD 675
            ++S+++     +SQEW ++ HV+VE   I    + G  +R+   + FT R++R+  YF++N ++IS +  LL+F  FS+    N   RL   +  LLT+VTFK A SQNLPKI YLTYLDK +L N  M++ L +WH    SL   +           +   E+ ++  LL  Y +  ++ GL +Y DAG RRR M  KD
Sbjct:  154 EVSQVDRRGAADSQEWKIFHHVDVERMEIQTAYSPGTSKRRHPGLVFTSRSARRSGYFMVNMVLISCVLCLLSFCIFSVPVDGN---RLQQALLLLLTTVTFKFAASQNLPKISYLTYLDKVVLANFFMLVILTVWHTIARSLSASYPK---------LLDNEKYVVYTLLSSYCLGAVIFGLTVYLDAGSRRRLMQRKD 341          

HSP 2 Score: 31.5722 bits (70), Expect = 8.435e-24
Identity = 14/24 (58.33%), Postives = 18/24 (75.00%), Query Frame = 2
Query:    2 FPFDCQDLSIPVATEYSINEVKLV 73
            FPFD QDLS+ V  + S++EV LV
Sbjct:  126 FPFDVQDLSVTVTCDRSVDEVLLV 149          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO26859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV8])

HSP 1 Score: 53.9138 bits (128), Expect = 5.687e-9
Identity = 42/117 (35.90%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  124 QEWNLYEHVEVESKTIINECNIGPRERQ--IMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMI 468
            ++W LY HV  ++ T   E  +GP +R   +   T    R+  ++  N  ++ S+   L+F SF+I P + T  RL + +  LL SV +K   S +LP+  YLT+LDK  LGN+L I
Sbjct:   16 RDWVLYPHVHTDTATQEGE-GLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAI-PPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFI 130          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 52.373 bits (124), Expect = 1.832e-8
Identity = 42/122 (34.43%), Postives = 67/122 (54.92%), Query Frame = 1
Query:  124 QEWNLYEHVEVESKTIINECNIGPRERQIMTF--TCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCI 483
            ++W LY HV  ++ T   E  +GP +R    +  T    R+  ++  N  ++ S+   L+F SF+I P + T  RL + +  LL SV +K   S +LP+  YLT+LDK  LGN+L I  + +
Sbjct:  158 RDWVLYPHVHTDTATQEGE-GLGPNDRSYPVYIITAHVRRRAVHYFWNTAVVMSVLTALSFASFAI-PPQQTADRLTVTLLLLLISVAYKFVTSLHLPRTSYLTFLDKYQLGNLLFISFIAV 277          

HSP 2 Score: 23.0978 bits (48), Expect = 1.832e-8
Identity = 8/17 (47.06%), Postives = 14/17 (82.35%), Query Frame = 2
Query:    2 FPFDCQDLSIPVATEYS 52
            FP D Q+LSI +++++S
Sbjct:  117 FPVDLQELSIIISSDWS 133          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041818.1 (SMESG000041818.1)

HSP 1 Score: 365.54 bits (937), Expect = 2.855e-127
Identity = 218/218 (100.00%), Postives = 218/218 (100.00%), Query Frame = 1
Query:   82 HDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDXXXXXXXXXXXXXXXXCEVC 735
            HDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMISSMFFLLTFTSFSITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFTTTDDTTTASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDAEFAEALAKIEAEKLFCEVC
Sbjct:  143 HDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMISSMFFLLTFTSFSITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFTTTDDTTTASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDAEFAEALAKIEAEKLFCEVC 360          

HSP 2 Score: 57.7658 bits (138), Expect = 1.926e-9
Identity = 26/26 (100.00%), Postives = 26/26 (100.00%), Query Frame = 2
Query:    2 FPFDCQDLSIPVATEYSINEVKLVEL 79
            FPFDCQDLSIPVATEYSINEVKLVEL
Sbjct:  116 FPFDCQDLSIPVATEYSINEVKLVEL 141          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041829.1 (SMESG000041829.1)

HSP 1 Score: 299.286 bits (765), Expect = 4.980e-101
Identity = 172/220 (78.18%), Postives = 189/220 (85.91%), Query Frame = 1
Query:   82 HDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFF--KFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDXXXXXXXXXXXXXXXXCEVC 735
            HDLSKLNTIDGMESQEWNLYEHVEVESKT+IN+CNIGPRERQ MTFTCRASR+FKYFLINHIMISSMFFLLTFTSFSI P  NT++RLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDK ILGNI+MIM LCIWHA TSLFF  K  + + T T + I   E+ +IP L+ FY +AIL  GL IYFDAGKRRREM+ KD EF+E + KIE EKLFC+VC
Sbjct:  143 HDLSKLNTIDGMESQEWNLYEHVEVESKTVINDCNIGPRERQTMTFTCRASRRFKYFLINHIMISSMFFLLTFTSFSIAPQTNTYYRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKAILGNIVMIMCLCIWHASTSLFFLTKIFSDNSTITTTAIEGIEKYLIPSLVVFYGLAILAVGLTIYFDAGKRRREMIAKDVEFSEMIKKIETEKLFCDVC 362          

HSP 2 Score: 46.9802 bits (110), Expect = 5.824e-6
Identity = 20/25 (80.00%), Postives = 23/25 (92.00%), Query Frame = 2
Query:    2 FPFDCQDLSIPVATEYSINEVKLVE 76
            FPFDCQDLSI V+TEY INEVK++E
Sbjct:  116 FPFDCQDLSITVSTEYPINEVKMLE 140          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000064433.1 (SMESG000064433.1)

HSP 1 Score: 273.092 bits (697), Expect = 6.175e-91
Identity = 161/224 (71.88%), Postives = 180/224 (80.36%), Query Frame = 1
Query:   64 EISRTSHDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDXXXXXXXXXXXXXXXXCEVC 735
            ++  T +D+SKLNT+DG+ESQEWNLYEHVEVE+KT+IN+CNIGP+ERQIMTFTCRASR+FKYFLINH +ISSMFFLLTFTSFSI P+  T+ RL LCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNIL IM LC WHA TS FF  TT    T  + +   E  II C LG Y + IL+ GL IYFDAG RRREM  KD EF   L KIE EKLFC+VC
Sbjct:  136 DLVETPNDVSKLNTLDGIESQEWNLYEHVEVEAKTMINDCNIGPKERQIMTFTCRASRRFKYFLINHFLISSMFFLLTFTSFSIPPSP-TYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILFIMLLCFWHASTSFFFNDTTISSATATANVKQVETYIISCFLGVYGLVILIFGLVIYFDAGSRRREMSDKDREFKRLLEKIENEKLFCDVC 358          

HSP 2 Score: 46.595 bits (109), Expect = 8.174e-6
Identity = 21/25 (84.00%), Postives = 23/25 (92.00%), Query Frame = 2
Query:    2 FPFDCQDLSIPVATEYSINEVKLVE 76
            FPFDCQDLS+ VATEYSI+EV LVE
Sbjct:  115 FPFDCQDLSVSVATEYSIDEVDLVE 139          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041796.1 (SMESG000041796.1)

HSP 1 Score: 268.085 bits (684), Expect = 3.250e-88
Identity = 146/204 (71.57%), Postives = 168/204 (82.35%), Query Frame = 1
Query:   64 EISRTSHDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKD 675
            E++   +D+SKLNT+DG+ESQEWNLYEHVEVE+K +IN+CN GP+ERQIMTFTCRA+R+FKYFLINH MISSMFFLLTF+SFSI  + NT+ RL LCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIM LCIWHA TS +F   +T+ T   S ++  E  +IP LLGFY IAIL     IY+DAG RRREM  KD
Sbjct:  191 EMAENPNDISKLNTLDGIESQEWNLYEHVEVENKIVINDCNFGPKERQIMTFTCRATRRFKYFLINHFMISSMFFLLTFSSFSII-STNTYGRLALCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMLLCIWHAVTSFWFIDPSTNTTVAMSSLTNIENILIPTLLGFYLIAILTFAFIIYYDAGSRRREMTEKD 393          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041914.1 (SMESG000041914.1)

HSP 1 Score: 239.965 bits (611), Expect = 9.651e-78
Identity = 142/218 (65.14%), Postives = 166/218 (76.15%), Query Frame = 1
Query:   82 HDLSKLNTIDGMESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINHIMIXXXXXXXXXXXXXITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFXXXXXXXXASVISTAEQKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDXXXXXXXXXXXXXXXXCEVC 735
            H+ S +NTIDGM+SQEW+L+ HV+VESK I+N+ NIG +ERQI+ FTCRA+R+FKYFLIN+ MISSMF+LLTFTSF I    NTF RL LCMT LLTSVTFKVAVSQNLPKIPYLTYLDKTILGNI+MIM  CIWHA TSL+       +    + +   E  IIP +L FY IA+L+ GL IYFDAGKRRREM  KD EF  AL KI   K  C++C
Sbjct:  162 HNKSTVNTIDGMDSQEWSLFNHVQVESKIILNDYNIGSKERQIIVFTCRAARQFKYFLINNFMISSMFYLLTFTSFGI-QVTNTFGRLSLCMTVLLTSVTFKVAVSQNLPKIPYLTYLDKTILGNIIMIMITCIWHALTSLW--LFHLSNNEATTALKNIESGIIPAILIFYLIALLIFGLIIYFDAGKRRREMKGKDIEFNRALDKILIAKSSCDIC 376          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7CFX92.611e-2638.16Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
A0A075A8W66.215e-2639.00Uncharacterized protein OS=Opisthorchis viverrini ... [more]
R7VFY51.042e-2435.41Neur_chan_LBD domain-containing protein OS=Capitel... [more]
R7VF521.510e-2433.81Neur_chan_LBD domain-containing protein OS=Capitel... [more]
A0A4E0RSR98.435e-2437.50Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO268595.687e-935.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327901.832e-834.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041818.12.855e-127100.00SMESG000041818.1[more]
SMESG000041829.14.980e-10178.18SMESG000041829.1[more]
SMESG000064433.16.175e-9171.88SMESG000064433.1[more]
SMESG000041796.13.250e-8871.57SMESG000041796.1[more]
SMESG000041914.19.651e-7865.14SMESG000041914.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000777 ID=SMED30000777|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=780bp
TTTCCCTTTTGACTGTCAAGATTTATCCATTCCGGTGGCAACTGAATATT
CTATAAATGAAGTGAAATTAGTCGAACTTCTCACGATCTCAGTAAACTGA
ACACAATTGACGGAATGGAATCTCAAGAATGGAATTTGTATGAACATGTT
GAAGTTGAAAGTAAAACTATTATAAATGAGTGCAACATTGGTCCAAGAGA
ACGACAGATAATGACATTCACGTGTCGAGCCAGTCGAAAATTTAAATATT
TTCTTATAAATCACATAATGATAAGTTCCATGTTTTTCCTGCTTACATTC
ACTAGTTTCTCAATAACTCCCGCAAGAAATACCTTTTTCCGATTGGGACT
TTGCATGACAACTCTTCTAACGAGTGTTACTTTTAAAGTGGCTGTCAGTC
AAAATCTACCCAAAATTCCATACCTAACATATTTGGACAAAACTATTTTA
GGAAATATTCTGATGATAATGAGTCTGTGCATTTGGCATGCCTGTACATC
TTTATTTTTTAAATTCACTACTACGGATGATACGACTACAGCTTCTGTCA
TTAGTACTGCAGAACAAAAGATTATTCCGTGTTTACTTGGATTTTATTCA
ATAGCGATTCTTGTGTCTGGATTGGCAATATATTTTGATGCTGGCAAGAG
ACGCAGAGAAATGTTATTAAAAGATGCTGAGTTTGCAGAAGCACTCGCAA
AAATTGAAGCAGAAAAGTTATTTTGTGAAGTCTGCTAATAAAAAACTTAT
AATATTTAATTTGAGACTGATAAACACGAT
back to top

protein sequence of SMED30000777-orf-1

>SMED30000777-orf-1 ID=SMED30000777-orf-1|Name=SMED30000777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MESQEWNLYEHVEVESKTIINECNIGPRERQIMTFTCRASRKFKYFLINH
IMISSMFFLLTFTSFSITPARNTFFRLGLCMTTLLTSVTFKVAVSQNLPK
IPYLTYLDKTILGNILMIMSLCIWHACTSLFFKFTTTDDTTTASVISTAE
QKIIPCLLGFYSIAILVSGLAIYFDAGKRRREMLLKDAEFAEALAKIEAE
KLFCEVC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006029Neurotrans-gated_channel_TM
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 1..29
e-value: 7.90916E-4
score: 31.4942