SMED30000771

Overview
NameSMED30000771
Smed IDSMED30000771
Length (bp)1488
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000771 (SMED30000771) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000771 (SMED30000771) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000771 (SMED30000771) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000771 (SMED30000771) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000771

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_1996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_474_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_474_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_474_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_474_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_1996_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_1996_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_1996_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_474_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000771SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v4_474_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000771 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.028371:2147..3677 -7197
Homology
BLAST of SMED30000771 vs. Ensembl Human
Match: AHNAK (AHNAK nucleoprotein [Source:HGNC Symbol;Acc:HGNC:347])

HSP 1 Score: 60.077 bits (144), Expect = 8.646e-9
Identity = 54/149 (36.24%), Postives = 85/149 (57.05%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKP--KGDFDVNLKKPNVDVDINKPDI 436
            D  +PK EG+LK PK  +D++APD+DV   D H K PK ++          + P VD++  K D    VDI G K    +D   PD  +   EGK+K PK ++ +++++ P++   D+D+H K P  KG++DV +  P V+ +I  PD+
Sbjct:  716 DVTVPKLEGELKGPK--VDIDAPDVDVHGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKAD----VDISGPK----IDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTM--PKVESEIKVPDV 852          

HSP 2 Score: 59.3066 bits (142), Expect = 1.399e-8
Identity = 57/163 (34.97%), Postives = 86/163 (52.76%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK---GEIDID---VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            D  LPK EG LK P+ D+     D+ APD+DV   D H K PK ++          + P+VD++  K D+D+     G K    +D ++PD  +   EGK+K PK    E++I    +  P++D+++ G K KGD DV+L K   D+ +   DI  P  DI +
Sbjct: 3764 DVSLPKMEGDLKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMQVPDLDIKGPKVDINA 3918          

HSP 3 Score: 59.3066 bits (142), Expect = 1.619e-8
Identity = 57/159 (35.85%), Postives = 82/159 (51.57%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPK---------------GEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG LK P+ D+     D++APD+DV   D H K PK                E+D+N+   ++D+   K+DID  ++DI G + K  G  F +PD  L       K PK      +  PEVD+++ G K KGD DV+L  P V+ D+  P++
Sbjct: 4020 DVSLPKMEGDLKAPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADIDVSGPKVDIDTPDIDIHGPEGKLKGPKFKMPDLHL-------KAPK------ISMPEVDLNLKGPKMKGDVDVSL--PKVEGDLKGPEV 4163          

HSP 4 Score: 58.5362 bits (140), Expect = 2.780e-8
Identity = 59/183 (32.24%), Postives = 92/183 (50.27%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDI----------HGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK---GEIDID---VEGPEVDIDIHGKKPKGDFDVNLKK-------PNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D  LPK EG LK P  ++D+  P +D+D+          H K PK ++          + P+VD++  K D+D+     G K    +D ++PD  +   EGK+K PK    E++I    +  P++D+++ G K KGD DV+L K       P+VD+   K DI  P  D+Q  ++    P IK
Sbjct: 2982 DISLPKVEGDLKGP--EVDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKIK 3154          

HSP 5 Score: 57.7658 bits (138), Expect = 5.158e-8
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI++PD  +   EGKLK PK    +++++AP I   D+D++ K PK + D++V  P V+ D    D+DI   +VDI+       +D   PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+   P VDVD+  PD+
Sbjct: 3840 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMQVPDLDIKGPKVDINAPD----VDVRGPDWHLKMP----KIKMPKISMPGFKGEGPEVDVNL----PKADLDVS--GPKVDVDV--PDV 3975          

HSP 6 Score: 57.3806 bits (137), Expect = 5.668e-8
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI++PD  +   EGKLK PK    +++++AP I   D+D++ K PK + D++V  P V+ D    D+DI   +VDI+       +D   PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+   P VDVD+  PD+
Sbjct: 3058 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPD----VDVQGPDWHLKMP----KIKMPKISMPGFKGEGPEVDVNL----PKADLDVS--GPKVDVDV--PDV 3193          

HSP 7 Score: 56.225 bits (134), Expect = 1.291e-7
Identity = 57/183 (31.15%), Postives = 97/183 (53.01%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEI-------DLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            +D+++PD  +   + KLK PK    +++++AP     D D+++ G K KG++       + ++K P VDI   K+DID  +++I+G + K    F  P +K+P     +K PK      +  P++D+++ G K KGD DV       +LK P VD+   K DI  P  D+Q  ++    P +K
Sbjct: 3638 VDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLPKVEGDLKGPEVDIKGPKVDIDTPDINIEGSEGK----FKGPKFKIPEMH--LKAPK------ISMPDIDLNLKGPKVKGDVDVSLPKMEGDLKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKVK 3808          

HSP 8 Score: 56.225 bits (134), Expect = 1.628e-7
Identity = 59/185 (31.89%), Postives = 94/185 (50.81%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV----------DVDINKPDIVYPIFDI 457
            ++I  PD  +   EG LK PK    D++++AP     DID+++ G K KG++D+       ++K P VDI   K+DI+  +VD+      HG D++L       P + +P F+G+     V  PK   DID+ GP VD+D+         DVN++ P+           +++I  P I  P FD+
Sbjct: 3510 MNIEGPDLNVEGPEGGLKGPKFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDINAPDVDV------HGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLPKA--DIDISGPNVDVDVP--------DVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDL 3678          

HSP 9 Score: 55.8398 bits (133), Expect = 1.916e-7
Identity = 58/176 (32.95%), Postives = 92/176 (52.27%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGP-----EVDIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKPVIK 493
            D  LPK EG LK P+ D+     D+  PD+DV   D H K PK ++          + P+VD+   K DID+     G K    +D ++PD  +   + K+K PK ++ +I+++ P     +VD+D+ G K KGDFDV++  P V+  +  P  D+  P  D +  + + S P +K
Sbjct: 4740 DVTLPKVEGDLKGPEADIKGPKVDINTPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKADIDVS----GPK----VDVDIPDVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSV--PKVEGTLKGPEVDLKGPRLDFEGPDAKLSGPSLK 4905          

HSP 10 Score: 55.4546 bits (132), Expect = 2.457e-7
Identity = 85/332 (25.60%), Postives = 140/332 (42.17%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKP--KGEIDLN-------VKNPNVDIDFHKMDIDI-EVDIDG-----KKKKHGL-DFNLPDWKLPTFEGKVKKPKGEIDI------------DVEGPEV----------------------DIDIHGKKPK--GDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSD 835
            +D+  PD  + + EGKLK PK    +++++ P I   DVD+H K P  KGE D+        +K P+V++   KMDID+ +V++ G     K  K  +  F++P +K    E  V  PK ++DI            ++EGPE                       D+D+H K PK  G++D+ + K   D+   K D+  P  ++Q  ++    P IK                      F +P    +  EF  ++      S+AN DIS     T     + P +++E P   +          H +    S+ +  L+ + P +K N D
Sbjct:  785 IDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTMPKVESEIKVPDVELKSAKMDIDVPDVEVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDISGPKVGVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTVPKLEGDLKGPKVDVSAPDVEMQGPDWNLKMPKIKMP-------------------KFSMPSLKGEGPEFDVNL------SKANVDISAPKVDT-----NAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVD 1086          

HSP 11 Score: 55.4546 bits (132), Expect = 2.499e-7
Identity = 61/213 (28.64%), Postives = 102/213 (47.89%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV----------DVDINKPDIVYPIFD-------IQSNFQFSKPVIKSHIEQPVSD 520
            +D+++PD  +   + KLK PK  +         +  PDID+++ G K KG++D+       ++K P  DI   K+DI+  +VD+      HG D++L       P + +P F+G+     V  PK   DIDV GP+VD+DI         DVN++ P+           +++I  P I  P  D       ++ +F  S P ++  ++ P  D
Sbjct: 4688 VDVDVPDVNIEGPDAKLKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTLPKVEGDLKGPEADIKGPKVDINTPDVDV------HGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKA--DIDVSGPKVDVDIP--------DVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSVPKVEGTLKGPEVD 4884          

HSP 12 Score: 55.0694 bits (131), Expect = 2.992e-7
Identity = 60/171 (35.09%), Postives = 90/171 (52.63%), Query Frame = 2
Query:    2 KKKHGLDINLP----DWKLPKF-----EGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            K K  +D++LP    D K P+      EGKLK PK    D+  ++P     DID+++ G K KG++D++V       K P VD+   K+ ID  ++DI G + K  G  F +PD  L       K PK      +  PEVD+++ G K KGD D++L  P V+ D+  P++
Sbjct: 4472 KVKGDVDVSLPKVESDLKGPEVDIEGPEGKLKGPKFKMPDVHFKSPQISMSDIDLNLKGPKIKGDMDISVPKLEGDLKGPKVDVKGPKVGIDTPDIDIHGPEGKLKGPKFKMPDLHL-------KAPK------ISMPEVDLNLKGPKVKGDMDISL--PKVEGDLKGPEV 4627          

HSP 13 Score: 55.0694 bits (131), Expect = 3.150e-7
Identity = 55/166 (33.13%), Postives = 84/166 (50.60%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI----------EVDIDG--------KKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG LK P+ D+     D++APD+DV   D H K PK ++          + P+VD++  K DID+          +V+I+G        K K   + F  P   +P  +  +  PK + D+DV GP+V+ D+ G       +V+LK P VD+D+  PD+
Sbjct: 2726 DVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADIDVSGPKVDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKVEGDLKGP------EVDLKGPKVDIDV--PDV 2883          

HSP 14 Score: 55.0694 bits (131), Expect = 3.204e-7
Identity = 64/200 (32.00%), Postives = 98/200 (49.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDG-----KKKKHGL-DFNLPDWKLPTFEGKVKKPKGEID-----IDVEGPEVDIDIHGKKPKG------------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            +D+  PD  +   EGK K PK  +         +  PDID+++ G K KG++D+       ++K P VD+   K+DID+ +V++ G     K  K  +  F++P +K    E  V  PK ++D     +DVEGP+V+I+    K KG                  DFD++LK P V  DVDI+ P    D+  P  DI+ 
Sbjct: 2802 VDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRG 3001          

HSP 15 Score: 55.0694 bits (131), Expect = 3.232e-7
Identity = 49/152 (32.24%), Postives = 86/152 (56.58%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEA-----PDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI+ PD  +   + KLK PK    +++++A     PDID ++ G K KG++D+++  P V+ D    +IDI        K   LD + PD  +   EGK+K PK ++ +++++ P++   D D+H K PK   DV++  P V+ D+  P++
Sbjct: 4352 VDIDAPDVSIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDFNLKGPKVKGDVDVSL--PKVEGDLKGPEIDI--------KGPSLDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVESDLKGPEV 4493          

HSP 16 Score: 54.6842 bits (130), Expect = 4.712e-7
Identity = 53/178 (29.78%), Postives = 94/178 (52.81%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQSNFQFSK 481
            +D+++PD  +   + KLK PK    +++++AP     D+D+++ G K KGE+D+       ++K P +DI   K+D+D  ++DI      HG D  L   KL   +  V  PK      +  PE+D+++ G K KGD DV       ++K P++D+   + D+  P  +I+   + S+
Sbjct: 3186 VDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPALDIKGPKIDVDAPDIDI------HGPDAKLKGPKLKMPDMHVNMPK------ISMPEIDLNLKGSKLKGDVDVSGPKLEGDIKAPSLDIKGPEVDVSGPKLNIEGKSKKSR 3351          

HSP 17 Score: 54.6842 bits (130), Expect = 4.877e-7
Identity = 64/216 (29.63%), Postives = 100/216 (46.30%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDI------------DVEGPEV----------------------DIDIH--GKKPKGDFDVN-------LKKPNVD-----VDINKPDI 436
            +D+ +PD  L   EGKLK PK  +         +  PD+D+++ G K KG++D++       +K P+VDI   K+DI   +VD+      HG D++L       P + +P F+G+     VK PK ++D+            ++EGP+                       D+ +H  G K KGD+DV        +K P+VD     VDIN PD+
Sbjct: 1290 VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEVEGEMKVPDVDIKGPKVDISAPDVDV------HGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLPKADVDVSGPKMDAEVPDVNIEGPDAKLKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVPKVEGEIKAPDVDIKGPKVDINAPDV 1499          

HSP 18 Score: 54.299 bits (129), Expect = 5.178e-7
Identity = 65/225 (28.89%), Postives = 101/225 (44.89%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKKHGL-DFNLPDWKLPTFEGKVKK-----PKGEIDID------------VEGPE------------------------VDIDIHGKKPKGDFDVNL-------KKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            +DI  PD  L   EGKLK PK  +         +  PD+D+ + G K KG++D++V       K P+V+I   KMDID  +V++ G      +    +P + +P F+G+ ++     PK +ID+             +EGPE                        VD+++ G K KGD DV+L       K P+VD+   K DI  P  D+   ++    P +K
Sbjct: 1162 VDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVSVPKVEGEMKVPDVEIKGPKMDIDAPDVEVQGPDWHLKMPKMKMPKFSMPGFKGEGREVDVNLPKADIDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEVEGEMKVPDVDIKGPKVDISAPDVDVHGPDWHLKMPKVK 1386          

HSP 19 Score: 54.299 bits (129), Expect = 6.093e-7
Identity = 60/165 (36.36%), Postives = 84/165 (50.91%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKK-HGLDFNL--PDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQS 463
            D  LPK EG LK P+ D+     D++APD+DV   D H K PK ++          + P+VD+   K DI+I   +VDID       G D  L  P +K+P     +K PK      +  P++D ++ G K KGD DV+L  P V+ D+  P  DI  P  DI +
Sbjct: 4276 DVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVTLPKADIEISGPKVDIDAPDVSIEGPDAKLKGPKFKMPEMN--IKAPK------ISMPDIDFNLKGPKVKGDVDVSL--PKVEGDLKGPEIDIKGPSLDIDT 4430          

HSP 20 Score: 53.5286 bits (127), Expect = 8.883e-7
Identity = 51/168 (30.36%), Postives = 85/168 (50.60%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVN-------LKKPNVD-----VDINKPDI 436
            +DI++PD  L   EGKLK PK  +         +  PD+ +++   K K ++D+       ++K P +D+   KMD+++ ++DI+G + K       P +K+P    K  K        +  P+VD+ + G K KGD DV+       +K P+VD     VDI+ PD+
Sbjct: 1546 VDIDVPDVNLEAPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLPKVEGDLKGPEIDVKAPKMDVNVGDIDIEGPEGK----LKGPKFKMPEMHFKAPK--------ISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKVDIDAPDV 1701          

HSP 21 Score: 53.5286 bits (127), Expect = 1.036e-6
Identity = 55/182 (30.22%), Postives = 93/182 (51.10%), Query Frame = 2
Query:   23 INLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDV---DIHGKKPKGEI-DLNVKNPNVDIDFHKMDI-DIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDI-----DIHG-----KKPK---------------GDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            + +P + +P F+G+     +K PK D+DV  P +D+   D++ + P+G++     K P ++I   K+ + DI++++ G K K  +D +     LP  EG +K P    ++D++GP+VDI     D+HG     K PK                D DVNL K ++DV   K D+  P  +I+ 
Sbjct: 2641 VKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVS-----LPKVEGDLKGP----EVDIKGPKVDIDAPDVDVHGPDWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADIDVSGPKVDVECPDVNIEG 2813          

HSP 22 Score: 53.5286 bits (127), Expect = 1.082e-6
Identity = 62/185 (33.51%), Postives = 87/185 (47.03%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI-------------DLNVKNPNVDIDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D  LPK EG LK P+ D+     D+ APD+ V   D H K PK ++             D +VK P  DID     +DIE   V+I+G + K       P +K+P     +K PK      +  P++D+++ G K KGD DV       +LK P VD+   K DI  P  D+   ++    P IK
Sbjct: 2598 DVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGK----LKGPKFKMPEMN--IKAPK------ISMPDIDLNLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKIK 2770          

HSP 23 Score: 53.1434 bits (126), Expect = 1.251e-6
Identity = 76/294 (25.85%), Postives = 132/294 (44.90%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDI-EVDIDG--------KKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVE---------GPEV-----DIDIHGKKPKGDF--------DVNLKKPNV---DVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP---VSDSDRNFNS-NLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP----DDPSINIEQPNSAI 727
            +D+ +PD  L   EGKLK PK  +         +  PD+D ++ G K KG++D++       +K P +D+   K+D D+ EV ++G        K K   + F  P   +P  +  +K PK + ++DV+         GP V     DIDI G  P+G          D++ K PN+   DVD+N   +  P   I+ +   S P ++  +E P   +     + N+ ++ +  + L  P  ++ +FS   +P   +     D++   +    S P    + P +NIE P   +
Sbjct: 2279 VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAPKLEGELKGPELDVKGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPKISMPDLDLHLKSPKAKGEVDVDVPKLEGDLKGPHVDVSGPDIDIEG--PEGKLKGPKFKMPDMHFKAPNISMPDVDLN---LKGP--KIKGDVDVSVPEVEGKLEVPDMNIRGPKVDVNAPDVQAPDWHLKMPKMKMPKFS---MPGFKAEGPEVDVNLPKADVDISGPKVDIEGPDVNIEGPEGKL 2562          

HSP 24 Score: 53.1434 bits (126), Expect = 1.284e-6
Identity = 53/160 (33.12%), Postives = 84/160 (52.50%), Query Frame = 2
Query:   47 PKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDI 457
            PK EG LK P+ DL     D++ PD++V   D H K PK ++          + P VD++  K D+D+   +VD++G           PD  +   EGK+K PK ++ +++++ P++   D D+H K PK   DV++  P V+ D+  P  DI  P  DI
Sbjct: 2858 PKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEG-----------PDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRGPQVDI 3006          

HSP 25 Score: 52.7582 bits (125), Expect = 1.498e-6
Identity = 64/197 (32.49%), Postives = 96/197 (48.73%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGD-----LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI------DIDVEGPEVDIDIHGKKPKGDFDVNLKK-------PNVDVDINKPDIVYPIFDIQ-SNFQFSKPVIKSHIEQP-VSDSDRNFN 538
            D  +PK EG++K P  D     +D++APD+DV   D H K PK ++          + P VD++  K D    V + G K    +D  +PD  L   EGK+K PK ++         +  P+VD+ + G K KGD DV+L K       P+VDV++  PD+     D +    +F  P  + H + P +S  D N N
Sbjct: 2008 DVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKAD----VVVSGPK----VDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGPSVDVEV--PDVELECPDAKLKGPKFKMP--EMHFKTPKISMPDVNLN 2192          

HSP 26 Score: 52.7582 bits (125), Expect = 1.674e-6
Identity = 54/157 (34.39%), Postives = 78/157 (49.68%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNL--PDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +D N PD  L   EGKLK PK  +         +  PD+D+D+ G K KG +D++       ++ P+VDI   K+DI    D++G     GLD++L  P  K+P F            +  EGPEVD+++    PK D  V+  K    VDI  PD+
Sbjct: 1034 VDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDISAPKIEGEMQVPDVDIRGPKVDIKAP-DVEG----QGLDWSLKIPKMKMPKFS--------MPSLKGEGPEVDVNL----PKADVVVSGPK----VDIEAPDV 1169          

HSP 27 Score: 52.373 bits (124), Expect = 2.021e-6
Identity = 54/168 (32.14%), Postives = 84/168 (50.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDI-----DVDIHG-----KKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGP-----EVDIDIHGKKPKGDFDV-------NLKKPNVD-----VDINKPDI 436
            D   P  EG  K PK  +D++AP++     DVD+HG     K PK ++       L  + P+V +D  K DI+IE           ++   PD  +   EG +K PK ++ D++++ P     ++D+++ G K KGD D+       +LK P VD     VDIN PD+
Sbjct: 3434 DIAGPNLEGDFKGPK--VDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMPKFSVSGLKAEGPDVAVDLPKGDINIE--------GPSMNIEGPDLNVEGPEGGLKGPKFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDINAPDV 3591          

HSP 28 Score: 52.373 bits (124), Expect = 2.318e-6
Identity = 56/167 (33.53%), Postives = 83/167 (49.70%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKL--PTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVN-------LKKPNVDVDINKPDIVYPIFDIQS 463
            +D+ +PD  L   EGKLK PK    ++  +AP I   DVD+H K PK + D++V  P ++ D     +D+EV          ++   PD KL  P F   E   K PK      +  P+V++++ G K KGD DV+       +K P+VD+   K DI  P  D+  
Sbjct: 2084 VDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGPSVDVEV--------PDVELECPDAKLKGPKFKMPEMHFKTPK------ISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHG 2236          

HSP 29 Score: 51.2174 bits (121), Expect = 5.501e-6
Identity = 59/193 (30.57%), Postives = 90/193 (46.63%), Query Frame = 2
Query:   17 LDINLPDWKL--------PKFEGKLKKPKGDLDVEAPDIDV-----DIHGKKPKG-----------------EIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHG-----LDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDV-----DINKPDIVYPIFDIQS 463
            +D+NL   KL        PK EG +K P   LD++ P++DV     +I GK  K                  E+D+  K P++DI   K+DI+  +V++ GK K        L  + P   +P  E  +K PK + D+D+ GP ++ D  G  PK D    +VNL  P+VDV     ++  P +  P F +  
Sbjct: 3298 IDLNLKGSKLKGDVDVSGPKLEGDIKAP--SLDIKGPEVDVSGPKLNIEGKSKKSRFKLPKFNFSGSKVQTPEVDVKGKKPDIDITGPKVDINAPDVEVQGKVKGSKFKMPFLSISSPKVSMPDVELNLKSPKVKGDLDIAGPNLEGDFKG--PKVDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMPKFSVSG 3486          

HSP 30 Score: 51.2174 bits (121), Expect = 5.548e-6
Identity = 59/181 (32.60%), Postives = 87/181 (48.07%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI------DIDVEGPEVDIDIHGKKPKGDFDVN-------LKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D  +PK EG++K P  D+     D++APD+DV   D H K PK ++          + P VD++  K D    VD+ G K    +D  +PD  L   EGK+K PK ++         +  P+VD ++ G K KGD DV+       LK P +DV   K D   P   ++  N ++  P  K
Sbjct: 2203 DVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNLPKAD----VDVSGPK----VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAPKLEGELKGPELDVKGPKLDADMPEVAVEGPNGKWKTPKFK 2375          

HSP 31 Score: 50.447 bits (119), Expect = 8.583e-6
Identity = 50/158 (31.65%), Postives = 79/158 (50.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI------DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            D  +PK EG LK PK  +DV APD+++   D + K PK ++       L  + P  D++  K ++DI            +D N PD  L   EGK+K PK ++         +  P+VD+D+ G K KG+ D++  K   ++ +   DI  P  DI++
Sbjct:  965 DMTVPKLEGDLKGPK--VDVSAPDVEMQGPDWNLKMPKIKMPKFSMPSLKGEGPEFDVNLSKANVDISA--------PKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDISAPKIEGEMQVPDVDIRGPKVDIKA 1112          
BLAST of SMED30000771 vs. Ensembl Human
Match: AHNAK2 (AHNAK nucleoprotein 2 [Source:HGNC Symbol;Acc:HGNC:20125])

HSP 1 Score: 53.9138 bits (128), Expect = 6.984e-7
Identity = 40/142 (28.17%), Postives = 76/142 (53.52%), Query Frame = 2
Query:   29 LPDWKLPKF--EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDINKP 430
            +P +K+P F      +  +  LDV AP ++ D+     +G++   DL+++ P+ D++   + +D+E+      +  GL  +LP  ++P+ +      KG   IDV+GP++D+    K PK +    DV +  P+V+VD+  P
Sbjct: 3475 MPKFKMPSFGVSAPGRSIEASLDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAVQVDVELLEGPVPEGAGLKGHLPKVEMPSLKTPKVDLKGP-QIDVKGPKLDL----KGPKAEVRVPDVEVSLPSVEVDVQAP 3611          

HSP 2 Score: 51.6026 bits (122), Expect = 4.217e-6
Identity = 42/155 (27.10%), Postives = 79/155 (50.97%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFEGK-----LKKPKGDL-----DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV---DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDI 421
            K H   + +P +K+PK + K     +K PK DL     DV APD++V     +P  E+D  V+ P   +D  +++ D+ +   D+  K  K    F +P +K+P++         +  +DV  P+ + D+     +GD    D++++ P+VD+++
Sbjct: 3223 KGHLPKLQMPSFKMPKVDRKGPQIDIKGPKLDLKGPKMDVTAPDVEV----SQPSMEVD--VEAPGAKLDGARLEGDLSLADKDVTAKDSK----FKMPKFKMPSYRASAPGKSIQASVDVSAPKAEADVSLPSMQGDLKTTDLSIQLPSVDLEV 3367          

HSP 3 Score: 51.2174 bits (121), Expect = 4.554e-6
Identity = 38/142 (26.76%), Postives = 77/142 (54.23%), Query Frame = 2
Query:   29 LPDWKLPKF--EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDINKP 430
            +P +K+P F      K  +  +D+ AP ++ D+     +G++   DL+++ P+ D++     +D+++      +  GL  +LP  ++P+F+      KG  +ID++GP++D+    K PK +    DV +  P+V+VD+  P
Sbjct: 1330 MPKFKMPSFGVSAPGKSIEASVDLSAPKVEADMSLPSMQGDLKTTDLSIQPPSTDLELQAGQLDVKLPEGPVPEGAGLKGHLPKLQMPSFKVPKVDLKGP-EIDIKGPKLDL----KDPKVEVTAPDVEVSLPSVEVDVEAP 1466          

HSP 4 Score: 51.2174 bits (121), Expect = 4.794e-6
Identity = 39/145 (26.90%), Postives = 78/145 (53.79%), Query Frame = 2
Query:   29 LPDWKLPKFEGKL--KKPKGDLDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDINKP 430
            +P +K+P +      K  +  +DV AP  + D+     +G++   DL+++ P+VD++     +D+++      +  GL  +LP  ++P+F    K PK ++    +D++GP++D+    K PK +    DV +  P+V+VD+  P
Sbjct: 3310 MPKFKMPSYRASAPGKSIQASVDVSAPKAEADVSLPSMQGDLKTTDLSIQLPSVDLEVQAGQVDVKLPEGHVPEGAGLKGHLPKVEMPSF----KMPKVDLKSPQVDIKGPKLDL----KVPKAEVTVPDVEVSLPSVEVDVQAP 3446          

HSP 5 Score: 50.447 bits (119), Expect = 8.149e-6
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDV-DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDI 421
            K H   + +P +K+PK + K     +K PK DL V   ++ V D+    P  E+D  V+ P   +D  +++ D+   E D+  K  K    F +P +K+P+F         E  +DV  P+V+ D+     +GD    D++++ P+ D+++
Sbjct: 3388 KGHLPKVEMPSFKMPKVDLKSPQVDIKGPKLDLKVPKAEVTVPDVEVSLPSVEVD--VQAPRAKLDGARLEGDLSLAEKDVTAKDSK----FKMPKFKMPSFGVSAPGRSIEASLDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEV 3532          
BLAST of SMED30000771 vs. Ensembl Zebrafish
Match: ahnak (AHNAK nucleoprotein [Source:ZFIN;Acc:ZDB-GENE-030131-8719])

HSP 1 Score: 60.4622 bits (145), Expect = 4.301e-9
Identity = 57/169 (33.73%), Postives = 86/169 (50.89%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            LDI  P+  +   EGK+K PK  +       +  PD+D ++ G K KG+ D++V  P V+ DF   D+D+   +VD++G + K    F  P +++P+F G           ++  P+VD +I G K KGD DV++  P V  DI  P I     DI+     F  P IK
Sbjct: 3618 LDIKSPEIDIEGPEGKVKGPKLKMPSFPVPKISMPDVDFNLKGPKLKGDFDVSV--PKVEGDFKAPDVDVKTPKVDMEGPEGK----FKGPKFQMPSFSGP----------NISMPDVDFNIKGPKLKGDVDVSV--PKVQGDIKAPKIELEGPDIEGPEGGFKMPNIK 3768          

HSP 2 Score: 56.9954 bits (136), Expect = 5.276e-8
Identity = 51/147 (34.69%), Postives = 75/147 (51.02%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD---IHGKKPK----GEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDI----DVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVY 442
            D  +PK EG +K PK  +D+E PD DVD   +  K PK    G    NV+ P + +   K +ID+        K  G+D   PD  +   +GK+K PK +I       V  P+VD ++ G K KGD DV++  P ++ DIN   + +
Sbjct: 5527 DVSVPKVEGHIKAPK--VDIEGPDFDVDGPEVGFKMPKLPSLGLKGPNVEGPEIGVKIPKTNIDV--------KAPGVDIESPDLNIEGPDGKIKSPKFKIPTVSIPKVPMPDVDFNLKGPKLKGDVDVSV--PKMEGDINGAKVKF 5661          

HSP 3 Score: 56.9954 bits (136), Expect = 5.555e-8
Identity = 49/151 (32.45%), Postives = 76/151 (50.33%), Query Frame = 2
Query:   14 GLDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            GLDI  P   +   EGKLK PK ++      ++  P +D ++ G K +G++D++V  P V  D    D+DI   E+DI+G + K  G  F +P   +P                +  PEVD ++ G K KGD D ++  P V+ D+  PD+
Sbjct: 4761 GLDIKAPKVDIEGPEGKLKGPKINIPSISGPNISLPTVDFNLKGPKLRGDVDVSV--PKVKGDVKAPDLDIKTPEIDIEGAEGKIKGPKFRIPSVSMPK---------------ISMPEVDFNLKGPKLKGDVDFSV--PKVEGDVKAPDV 4892          

HSP 4 Score: 56.225 bits (134), Expect = 1.039e-7
Identity = 55/183 (30.05%), Postives = 86/183 (46.99%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDI-DIEVDIDGKKKK-HGLDFNLPDWK-----LPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK----------PKGDF--------------------DVNLKKPNVDVDINKPDI 436
            +DI  P+  +   EGK+K PK          +  PD+D ++ G+K KG++D++V     DI    MDI   +VDI+G + K  G  F++P        +P  +  +K PK + D+DV  P+V+ D+   K          P+G F                    DVN++ P  D+DIN PD+
Sbjct: 5224 VDIKAPELDIDGPEGKIKGPKLTKPSLSGPTISMPDVDFNLKGRKMKGDVDVSVPKLQGDIKVPGMDIKGPQVDIEGPEGKIKGSKFSMPSISGPKISMPNVDFNLKGPKLKGDVDVTVPKVEGDMKAPKVELEGPDIEGPEGGFKMPKVKMPKIGFKGPKVEGPDVNVQIPKTDIDINAPDV 5406          

HSP 5 Score: 55.8398 bits (133), Expect = 1.151e-7
Identity = 53/165 (32.12%), Postives = 83/165 (50.30%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDI-DIEVDIDGKKKKHGLDFNLPDWKLPTFEG-KVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDI---QSNFQFSK 481
            +DI  P+ ++   EGK     LK P     +  PD+D ++ G K KG++D +      DI    +DI   EVDI+G  +K    F  P +++P+  G  +  P    D+D   P+VD+++ G K KGD DV++ K    +   K DI  P FD+   +  F+  K
Sbjct: 5406 VDIKSPELEIEGPEGKVKGHKLKMPFSGPTISMPDVDFNLKGLKLKGDVDASAPKVKGDIKIPNVDIKGPEVDIEGPGRK----FKGPKFQMPSVSGPNISMP----DVDFTMPDVDVNLKGPKLKGDVDVSVPKVEGHIKAPKVDIEGPDFDVDGPEVGFKMPK 5562          

HSP 6 Score: 55.0694 bits (131), Expect = 2.208e-7
Identity = 72/224 (32.14%), Postives = 95/224 (42.41%), Query Frame = 2
Query:   29 LPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKK----------HGLDFNLPDWKL--------PTFEGKVKKPKGEIDIDVEGPEVDIDIHG----------------KKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS------NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            +P  KLP+F    K PK    VE PD+DV I    PK EID  +K P+VDI   ++DI+  E  + G K K            +DFNL   KL        P  EG +K PKG    D+EGPE+++   G                K  K D DV + K ++D+     DI  P+ DI+         +F  P     I  P  D D N     L    D+  P
Sbjct: 1596 MPKIKLPQF--GFKGPK----VEGPDVDVKI----PKTEID--IKAPDVDIKGPEIDIEAPEGKVKGSKFKIPFSGPTISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKAPKG----DLEGPEIEVPEGGFKMPTIKMPKFGSKGPKVEKPDIDVKIPKTDIDIKAPDVDIKAPVLDIEGPEGKVKGSKFKMPFSGPTISMP--DVDFNLKGPKLKGDVDVSVP 1801          

HSP 7 Score: 53.9138 bits (128), Expect = 4.941e-7
Identity = 61/199 (30.65%), Postives = 94/199 (47.24%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF-----DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            +D+  P   +   EGK K PK  +      ++  PD+D +I G K KG++D++V  P V  D     I++E  DI+G +      F +P+ K+P F    K PK      VEGP++D+ I    PK DF     D+++K P +D++  +  +  P F I S   F+ P I       + D D N     L    D+  P
Sbjct: 3683 VDVKTPKVDMEGPEGKFKGPKFQMPSFSGPNISMPDVDFNIKGPKLKGDVDVSV--PKVQGDIKAPKIELEGPDIEGPEG----GFKMPNIKMPKF--GFKGPK------VEGPDMDVKI----PKSDFEVKSPDLDIKSPEIDIEGPEGKVKGPKFKIPS---FTGPKIS------MPDVDFNLKGPKLKGDVDVSVP 3854          

HSP 8 Score: 53.9138 bits (128), Expect = 5.429e-7
Identity = 61/191 (31.94%), Postives = 92/191 (48.17%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF-------EGK---VKKPKGEIDI-----DVEGPEVDIDIHGKKPKG---------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            +DI  P+  +   EG +K PK  +       +  PD+D ++ G+K KG++D++V     +I   K++++ + DI G +      F +P  KLP F       EG    VK PK EIDI     D++GPE+DI+    K KG               D D NLK P +  DVD++ P    DI  P  D++ 
Sbjct: 1515 VDIKAPELDIEAPEGNIKDPKLKMPSLSRPTISMPDVDFNLKGQKLKGDVDVSVPKMQGEIKAPKVELEGQ-DIAGPEG----GFKMPKIKLPQFGFKGPKVEGPDVDVKIPKTEIDIKAPDVDIKGPEIDIEAPEGKVKGSKFKIPFSGPTISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKAPKGDLEG 1700          

HSP 9 Score: 53.5286 bits (127), Expect = 5.966e-7
Identity = 55/168 (32.74%), Postives = 83/168 (49.40%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHG-------------KKPKGEI-DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQ-SNFQFSKP 484
            D  +PK EG +K PK  +++E PDI+    G             K PK E  D++VK P  D +    D+DI   E+DI+G + K       P +K+P+F G    PK      +  P+VD ++ G K KGD DV++ K   D+ +   D+  P  D++ S  +F  P
Sbjct: 4032 DVSVPKVEGGIKAPK--VEIEGPDIEGREGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKSDFEIKSPDLDIKSPEIDIEGPEGK----VKGPKFKIPSFSG----PK------ISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKLPGLDVKAPKVDMEGSEGKFKGP 4183          

HSP 10 Score: 53.1434 bits (126), Expect = 7.647e-7
Identity = 56/168 (33.33%), Postives = 85/168 (50.60%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKG----------------EIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDI------DVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQS 463
            D K+PK + ++K P  DLD+++P+ID++    K KG                ++D N+K P V     K D+D+ V  ++G  K  GLD   P   +   EGK+K PK  I+I      ++  P VD ++ G K +GD DV++  P V  D+  P  DI  P  DI+ 
Sbjct: 4682 DVKIPKADFEVKSP--DLDIKSPEIDIEGPDGKVKGPTLKMPSLSGPKISMPDVDFNLKGPKV-----KGDVDVSVPKVEGDIKVPGLDIKAPKVDIEGPEGKLKGPK--INIPSISGPNISLPTVDFNLKGPKLRGDVDVSV--PKVKGDVKAPDLDIKTPEIDIEG 4838          

HSP 11 Score: 51.9878 bits (123), Expect = 1.911e-6
Identity = 52/164 (31.71%), Postives = 82/164 (50.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKK------HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            LDI  P+  +   EGK+K PK  +       +  P++D ++ G K KG++D +V  P V+ D    D+ I   EVD++  + K       G  F+ P+  LP  +  +K PK +  +DV  P+V  DI       DF++NL  PN+D DI +  +  P   + S
Sbjct: 4827 LDIKTPEIDIEGAEGKIKGPKFRIPSVSMPKISMPEVDFNLKGPKLKGDVDFSV--PKVEGDVKAPDVHIKGPEVDVETPEGKITGSKFKGPSFSGPNISLPDVDFNLKGPKLKGGVDVSVPKVQGDIKAT----DFNINL--PNIDGDIPEGKVKGPKLKMPS 4982          

HSP 12 Score: 51.6026 bits (122), Expect = 2.513e-6
Identity = 52/151 (34.44%), Postives = 76/151 (50.33%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHG-------------KKPKGEI-DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K PK  +++E PDI+    G             K PK E  D+++K P  D +    D+DI   E+DI+G + K       P  K+P+F      P  +I +    P+VD ++ G K KGDFDV++  P V+ D   PD+
Sbjct: 3551 DVSLPKVEGGVKAPK--VELEGPDIEGPEGGFKMPKFRLPKFGFKGPKVERPDMDMKIPKADFEVKSPDLDIKSPEIDIEGPEGK----VKGPKLKMPSF------PVPKISM----PDVDFNLKGPKLKGDFDVSV--PKVEGDFKAPDV 3683          

HSP 13 Score: 51.2174 bits (121), Expect = 2.957e-6
Identity = 53/160 (33.12%), Postives = 76/160 (47.50%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHG-------------KKPKGEI-DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            D  +PK EG +K PK  +++E PDI+    G             K PK E  D++VK P  D +    D+DI   E+DI+G   K       P  K+P+  G    PK      +  P+VD ++ G K KGD DV++ K   D+ +   DI  P  DI+ 
Sbjct: 4630 DVSVPKVEGGVKAPK--VELEGPDIESPEGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKADFEVKSPDLDIKSPEIDIEGPDGK----VKGPTLKMPSLSG----PK------ISMPDVDFNLKGPKVKGDVDVSVPKVEGDIKVPGLDIKAPKVDIEG 4773          

HSP 14 Score: 51.2174 bits (121), Expect = 3.333e-6
Identity = 53/160 (33.12%), Postives = 79/160 (49.38%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHG-------------KKPKGEI-DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            D  +PK EG +K PK  +++E P+I+    G             K PK E  D++VK P  +ID  + D+DI   E+DI+G + K       P WK+P+F     +P       V  P+VD ++ G K KGD DV+L  P V+  +  P +     DI+ 
Sbjct: 3434 DVSVPKVEGDIKAPK--VELEGPEIEGPESGFKMPKFKMPHIGFKGPKVEGPDVDVKIPKTEIDIKEPDLDIKGPELDIEGPEGK----VKGPKWKMPSFS----RPT------VSVPDVDFNLKGPKLKGDVDVSL--PKVEGGVKAPKVELEGPDIEG 3575          

HSP 15 Score: 50.8322 bits (120), Expect = 4.199e-6
Identity = 60/199 (30.15%), Postives = 94/199 (47.24%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF-----DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            LDI  P+  +   EGK+K P   +       +  PD+D ++ G K K ++D++V  P V+       ++IE  DI+G++      F +P+ K+P F    K PK      VEGP++D+ I    PK DF     D+++K P +D++  +  +  P F I S   FS P I       + D D N     L    D+  P
Sbjct: 3982 LDIKSPEIDMEGPEGKVKGPTLKMPSFSGPKISMPDVDFNLKGPKLKSDVDVSV--PKVEGGIKAPKVEIEGPDIEGREG----GFKMPNIKMPKF--GFKGPK------VEGPDMDVKI----PKSDFEIKSPDLDIKSPEIDIEGPEGKVKGPKFKIPS---FSGPKIS------MPDVDFNLKGPKLKGDVDVSVP 4153          

HSP 16 Score: 50.447 bits (119), Expect = 5.569e-6
Identity = 51/161 (31.68%), Postives = 80/161 (49.69%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHG-------------KKPKGEI-DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSN 466
            D  +PK +G +K PK  +++E PDI+    G             K PK E  D++VK P  D +    D+DI   E+DI+G + K       P +K+P+F G    PK      +  P+VD ++ G K KGD DV++ K   D+ +   D+  P  D++ +
Sbjct: 3733 DVSVPKVQGDIKAPK--IELEGPDIEGPEGGFKMPNIKMPKFGFKGPKVEGPDMDVKIPKSDFEVKSPDLDIKSPEIDIEGPEGK----VKGPKFKIPSFTG----PK------ISMPDVDFNLKGPKLKGDVDVSVPKVEGDIKLPGLDVEAPKVDMEGS 3877          

HSP 17 Score: 50.447 bits (119), Expect = 6.066e-6
Identity = 55/191 (28.80%), Postives = 91/191 (47.64%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-----DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDG-KKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDV---DINKPDIVYPIFDIQ-SNFQFSKPVIKS-HIEQPVSDSD 526
            LD+  P+  +   EGK+K  K  +      +  PD+D ++ G K KGE+D++V  P V  D    ++DI   ++DI+G + K  G  F++P    P               ++  P+ D  + G K KGD DV       ++K PNV++   DI  P+  + +  I+   F F  P ++   +E P +D D
Sbjct: 3029 LDLKTPELDIEGPEGKVKGSKFKMPFSGPKISMPDVDFNLKGPKLKGEVDVSV--PKVKGDIKATEVDIKTPQIDIEGPEGKPKGSKFSIPSISGP---------------NISMPDADFSLKGPKLKGDVDVSVPKVEGDIKAPNVEIEGPDIKGPEGGFKMPKIKMPRFGFKGPKVEGPDVEVPKTDID 3202          

HSP 18 Score: 50.0618 bits (118), Expect = 7.976e-6
Identity = 60/196 (30.61%), Postives = 95/196 (48.47%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-----DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQ 586
            LDI  P+  +   EGK+K  K  +      +  PD+D ++ G K KG++D++V  P V+ D     +++E  +I+G   + GL   +P  K+P F  K  K +G   +DV+ P+ DIDI G       DV++K P +D++  K +I  P   + S    S+P I       + D D N     L    D+  P  Q
Sbjct: 2563 LDIKSPEIDIEGPEGKVKGSKFKIPFSGPKISMPDVDFNLKGPKLKGDVDVSV--PKVEGDITAPKVELEGPEIEG--PEGGL--KMPTIKMPKFGFKGPKVEGP-GMDVKSPKTDIDIKGP------DVDIKAPELDIEAPKGNIKDPKLKMPS---LSRPTIS------MPDVDFNLKGPKLKGDVDVSVPKVQ 2736          

HSP 19 Score: 49.6766 bits (117), Expect = 9.067e-6
Identity = 56/166 (33.73%), Postives = 83/166 (50.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKK---PK-GEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDID---VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS------NFQFSKPVI 490
            D  +PK EG +K PK  ++ E PD++      K   PK G     ++ P++D+ F K DIDI+  D+D K  +  LD   P       EGKVK  K ++      +  P+VD ++ G+K KGD DV++ K   DV +   +I  P  DI+         +FS P I
Sbjct: 1040 DVSVPKVEGDIKAPK--IEHEGPDLEGGFKMPKINIPKFGSKGPKMEGPDMDVKFPKTDIDIKAPDVDVKAAQ--LDIEGP-------EGKVKGSKFKMPFSGPTISMPDVDFNLKGRKMKGDVDVSIPKVEGDVKVPGVEIKGPRVDIEGPEGKIKGSKFSMPSI 1194          

HSP 20 Score: 49.6766 bits (117), Expect = 9.709e-6
Identity = 51/164 (31.10%), Postives = 84/164 (51.22%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-----DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVI 490
            LDI  P+  +   EGK+K  K  +      +  PD+D ++ G K KG++D++V  P V+ D     + +E  +I+G +      F +P  K+P F  K  K +G   IDV+ P+ DIDI G       DV++K P +D++  + +I  P   + S    ++P I
Sbjct: 2796 LDIKSPEIDIEGPEGKVKGSKFKIPFSGPKISMPDVDFNLKGPKLKGDVDVSV--PKVEGDITAPKVQLEGPEIEGPEG----GFKMPTIKMPKFGFKGPKVEGP-GIDVKSPKTDIDIKG------CDVDIKAPELDIEAPEGNIKDPKLKMPS---LTRPTI 2943          
BLAST of SMED30000771 vs. Ensembl Zebrafish
Match: si:ch211-125o16.4 (si:ch211-125o16.4 [Source:ZFIN;Acc:ZDB-GENE-131120-100])

HSP 1 Score: 56.6102 bits (135), Expect = 6.121e-8
Identity = 83/307 (27.04%), Postives = 128/307 (41.69%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVD---------IDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFD----------VNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP---VSDSDRNFNSNLLSKSFDLPQPISQITEFSSSI-IPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSD 835
            +DI  PD  +   +GK     LKKP     V+AP+  +D+   KP    DLN+  PN+D         ++  K D+D++   VDI     K       P  K+P     + KVK P    D+++  PEV++++    PK   D          +NL  PN+D+      +  P  DI++    S  V K H++ P   +S       ++L     D+  P   +T  +  +  PD   S  N DI T   +  Q+    P I+IE P++ I                P V    LN   P +K N+D
Sbjct:  297 VDIKTPDINIGAPKGKAKFKTLKKPTFGHKVKAPEAGLDVSASKP----DLNLSAPNIDGDISIPNTRVNLPKADVDVKAPNVDIHTSSTKP----KFPTLKMPKINLHKSKVKTPDLNADLNMSSPEVEMNL----PKAKLDAPNLDVKAPNLNLSAPNLDIQTPGAHVQAPDIDIEA---PSAKVKKPHVKMPKWSLSGPKMKGKADLDVPDLDVKAPDLNLTTPNLDVKAPDLNLSAPNLDIETP-GAHVQA----PDIDIEAPSAKI--------------KKPHVKMPKLNLSGPKIKGNAD 569          

HSP 2 Score: 55.8398 bits (133), Expect = 1.208e-7
Identity = 73/242 (30.17%), Postives = 105/242 (43.39%), Query Frame = 2
Query:   23 INLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKM-----DIDIEVDIDGKKKKHGLDFNLPDWKL--PTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAI 727
            I  P  KLPKF     K KG+ D++APD+DV    K P    DLN+  PN+D+          DIDIE      KK H   FNLP   L  P  +GK          D++ P +D++          D+NL  PN+D+     D+  P  DI++    S  + K H++ P      N +   +  + DL  P   +        PD   S  N D+ T        +PD   I+IE P++ +
Sbjct:  677 IKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KAP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKMNLSGPKIKGKP---------DLDAPNLDVNAP--------DLNLSAPNLDIKTPGVDVQAPDIDIEA---PSAKIKKPHVKLP----KFNLSGPKIKGNADLDAPDLDVK------TPDLNLSAPNLDVQT--PGAHVEVPD---IDIEAPSAKV 872          

HSP 3 Score: 53.9138 bits (128), Expect = 4.094e-7
Identity = 61/188 (32.45%), Postives = 83/188 (44.15%), Query Frame = 2
Query:    5 KKHGLDINLPD--------------WKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKM-----DIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP 511
            K  G+D+  PD               KLPKF     K KG+ D++APD+DV    K P    DLN+  PN+D+          DIDIE      KK H   FNLP   LP       K KG+ D+D   P +D++          ++NL  PN+D+     D+  P  DI++       V K H+  P
Sbjct:  787 KTPGVDVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KTP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKINLPG-----PKIKGKPDLD--APNLDVNAP--------ELNLSAPNLDIKTPGVDVQAPDIDIETPSAM---VYKPHVNLP 945          
BLAST of SMED30000771 vs. Ensembl Zebrafish
Match: BX005403.1 (si:ch211-125o16.4 [Source:NCBI gene;Acc:566639])

HSP 1 Score: 56.6102 bits (135), Expect = 6.613e-8
Identity = 83/307 (27.04%), Postives = 128/307 (41.69%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVD---------IDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFD----------VNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP---VSDSDRNFNSNLLSKSFDLPQPISQITEFSSSI-IPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSD 835
            +DI  PD  +   +GK     LKKP     V+AP+  +D+   KP    DLN+  PN+D         ++  K D+D++   VDI     K       P  K+P     + KVK P    D+++  PEV++++    PK   D          +NL  PN+D+      +  P  DI++    S  V K H++ P   +S       ++L     D+  P   +T  +  +  PD   S  N DI T   +  Q+    P I+IE P++ I                P V    LN   P +K N+D
Sbjct:  297 VDIKTPDINIGAPKGKAKFKTLKKPTFGHKVKAPEAGLDVSASKP----DLNLSAPNIDGDISIPNTRVNLPKADVDVKAPNVDIHTSSTKP----KFPTLKMPKINLHKSKVKTPDLNADLNMSSPEVEMNL----PKAKLDAPNLDVKAPNLNLSAPNLDIQTPGAHVQAPDIDIEA---PSAKVKKPHVKMPKWSLSGPKMKGKADLDVPDLDVKAPDLNLTTPNLDVKAPDLNLSAPNLDIETP-GAHVQA----PDIDIEAPSAKI--------------KKPHVKMPKLNLSGPKIKGNAD 569          

HSP 2 Score: 54.6842 bits (130), Expect = 2.710e-7
Identity = 72/242 (29.75%), Postives = 105/242 (43.39%), Query Frame = 2
Query:   23 INLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKM-----DIDIEVDIDGKKKKHGLDFNLPDWKL--PTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAI 727
            I  P  KLPKF     K KG+ D++APD+DV    K P    DLN+  PN+D+          DIDIE      KK H   FNLP   +  P  +GK          D++ P +D++          D+NL  PN+D+     D+  P  DI++    S  + K H++ P      N +   +  + DL  P   +        PD   S  N D+ T        +PD   I+IE P++ +
Sbjct:  677 IKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KAP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKMNISGPKIKGKP---------DLDAPNLDVNAP--------DLNLSAPNLDIKTPGVDVQAPDIDIEA---PSAKIKKPHVKLP----KFNLSGPKIKGNADLDAPDLDVK------TPDLNLSAPNLDVQT--PGAHVEVPD---IDIEAPSAKV 872          

HSP 3 Score: 51.9878 bits (123), Expect = 1.618e-6
Identity = 59/190 (31.05%), Postives = 82/190 (43.16%), Query Frame = 2
Query:    5 KKHGLDINLPD--------------WKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKM-----DIDIEVDIDGKKKKHGLDFNLPDWKL--PTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP 511
            K  G+D+  PD               KLPKF     K KG+ D++APD+DV    K P    DLN+  PN+D+          DIDIE      KK H   FNLP   L  P  +GK          D++ P +D++          ++NL  PN+D+     D+  P  DI++       V K H+  P
Sbjct:  787 KTPGVDVQAPDIDIEAPSAKIKKPHVKLPKFNLSGPKIKGNADLDAPDLDV----KTP----DLNLSAPNLDVQTPGAHVEVPDIDIEAPSAKVKKPH---FNLPKINLSGPKIKGKP---------DLDAPNLDVNAP--------ELNLSAPNLDIKTPGVDVQAPDIDIETPSAM---VYKPHVNLP 945          
BLAST of SMED30000771 vs. Ensembl Xenopus
Match: ENSXETT00000017705.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41386344:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000017705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 3.046e-11
Identity = 69/180 (38.33%), Postives = 95/180 (52.78%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEID---IDVEGPEVDIDIHGKKPK-----------GDFDVNLKKPNVDVDINKP--DIVYPIFDIQ 460
            LD NL   K PK EG LK PK D++     +EAPD+D+D   K PK E DL  K P VDI+  +++++  +VDIDGK K             LDFNL   K P  EG +K PK EI    +++E P+VD+D   K PK            D  +N+K P ++ ++  P  D+  P FD+ 
Sbjct:  444 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGPKVEGDL--KGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVA 615          

HSP 2 Score: 58.151 bits (139), Expect = 3.014e-8
Identity = 59/168 (35.12%), Postives = 90/168 (53.57%), Query Frame = 2
Query:   23 INLPDWKL----PKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPKGEIDL-NVKNPNVDIDFHKMDIDIEVDIDGKKKKH----GLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSK 481
            +++PD  L    PK EG+LK PK  +D++ P++DV   D+  + P+G++ +   K P     F    +D+E D  G K        LDFNL   K P  EG +K PK +I   ++++E P+VDID   K PK + D  LK P VD++  + ++  P  DI    + SK
Sbjct:  362 VSMPDLGLNIKGPKMEGELKGPK--IDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPK--FGFSGSKVDVEGDSKGPKMPSLHMPDLDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGPKVEGD--LKGPKVDINAPEVNLEAPDVDIDGKVKGSK 520          

HSP 3 Score: 57.3806 bits (137), Expect = 4.718e-8
Identity = 61/194 (31.44%), Postives = 93/194 (47.94%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKMDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PTFEGKVKKPKGEIDIDVEGPEVDIDI------------------------HGKKPKG-DFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H  ++D+   EV+IDGK K H          + ++PD+ L    P  EG++K PK    ID++GPEVD+ I                         G K KG D D+ L +  +DV + K DI  P  DI+ 
Sbjct: 1025 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIEC 1208          

HSP 4 Score: 56.225 bits (134), Expect = 1.271e-7
Identity = 62/198 (31.31%), Postives = 92/198 (46.46%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-----DVEAPDIDVDIHGKKPK-----------GEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKG------DFDVNLKKPNVD-------VDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSD 520
            LD NL   K PK EG LK PK D+     ++EAPD+D D   K PK            ++ LN+K P ++ +     ID+        K   +D  +PD +L   EGK+K PK ++      G +VD++   K PK       D D NLK P V+       VDIN P++     D+  + +   P ++  ++ P  D
Sbjct:  311 LDFNL---KGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDM--------KGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDVEGDSKGPKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGPKVEGDLKGPKVD 497          

HSP 5 Score: 54.6842 bits (130), Expect = 3.479e-7
Identity = 67/220 (30.45%), Postives = 102/220 (46.36%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------------------------------------------GDL------------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP 511
            +D+ +PD +L   EGK+K PK                                          GDL            ++EAPD+D+D   K PK E DL  K P VDI+  +++++  +VDIDGK K  G  F +P   +P  +  +K PK  ++ D++GP+V+I    K PK    VNL+ P+VDVD     +  P F++ S  + S P +  +I+ P
Sbjct:  392 VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDVEGDSKGPKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGPKVEGDL--KGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDLDFNLKGPK--VEGDLKGPKVEI----KAPK----VNLEAPDVDVDGK---VKGPKFEMPSMPKVSMPDLGLNIKGP 594          

HSP 6 Score: 52.7582 bits (125), Expect = 1.254e-6
Identity = 55/166 (33.13%), Postives = 86/166 (51.81%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEID---IDVEGPEVDIDIHGKKPK-----------GDFDVNLKKPNVDVDINKPDI 436
            +DI+ P   +   EGK+K PK  +  +  PDID+++ G K +G++    K P VDI+  +++++  +VDIDGK K             LDFNL   K P  EG +K PK +I    +++E P+VD D   K PK            D  +N+K P ++ ++  P I
Sbjct:  227 VDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDL----KGPKVDINAPEINLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKI 385          

HSP 7 Score: 51.2174 bits (121), Expect = 3.933e-6
Identity = 67/239 (28.03%), Postives = 109/239 (45.61%), Query Frame = 2
Query:   17 LDINLPDWKLPKFE---------GKLKKPKGDL----DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTF-------EGK---VKKPKGEIDI-----DVEGPEVDIDIHGKKPKG-----------DFDVNLKKPNVDVDINKP--DIVYPIFDIQS----------NFQFSKPVIKSHIEQ-PVSDSDRNFNSNLLSKSFDLPQ 574
            +D NL   K PK E         GK+K PK  +     V  PD+ ++I G K +GE+    K PN+D+   ++D+ I +V+++G + K      +P +K+P F       +GK   +  P+GEIDI     D+  PE+DI+    + KG           D D NLK P ++ D+  P  DI  P  ++++            +F  P I   + +  + ++D N          DLP+
Sbjct:  697 IDFNL---KGPKLEGDLKDVDIDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGEL----KGPNIDMKGPEVDVAIPDVELEGPEGK----LKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIECPEGRVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKAPKVDIKAPEVNLEAPDVDFDGKIKGPKFKMPSIGVSLPKVSIPETDHNVKGPKFKGDIDLPE 924          
BLAST of SMED30000771 vs. Ensembl Xenopus
Match: ENSXETT00000032494.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41392497:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000032494.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.853e-10
Identity = 55/140 (39.29%), Postives = 84/140 (60.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD 418
            LD NL   K PK EG LK PK D++     +EAPDID ++ G K +G++    K P VDI+  +++++  +VDIDGK K  G  F +P   +P  +  +K PK  ++ D++GP+VDI+          +VNL+ P+VD+D
Sbjct:  497 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDIDFNLKGPKVEGDL----KGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDIDFNLKGPK--VEGDLKGPKVDINAP--------EVNLEAPDVDID 617          

HSP 2 Score: 58.9214 bits (141), Expect = 1.881e-8
Identity = 62/203 (30.54%), Postives = 98/203 (48.28%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFHKMDIDIEVDIDGKK---KKHGLDFNLPDWKLPTFEGKVKKPKGEI-------------DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS------NFQFSKPVIKSHIEQPVSD 520
            LD NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       ++D N+K P V+ D     ++I+ ++ G K   K    D  +PD +L   EGK+K PK ++             D+D+  PE +IDI G K      V++  P +D++  +  +  P F + S      +F    P ++  ++ P  D
Sbjct:  960 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVEIKGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK------VDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKVD 1153          

HSP 3 Score: 58.151 bits (139), Expect = 2.969e-8
Identity = 57/172 (33.14%), Postives = 88/172 (51.16%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            +D NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       +ID N+K P V+ D     +DI          +VDIDGK K  G  F +P   +P           +ID +++GP+V+ D+ G K +G+    LK PN+D+   + ++  P  +++ 
Sbjct:  529 IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMP-----------DIDFNLKGPKVEGDLKGPKMEGE----LKGPNIDMKGPEAEVAIPDVELEG 680          

HSP 4 Score: 57.7658 bits (138), Expect = 3.619e-8
Identity = 61/194 (31.44%), Postives = 93/194 (47.94%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKMDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PTFEGKVKKPKGEIDIDVEGPEVDIDI------------------------HGKKPKG-DFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H  ++D+   EV+IDGK K H          + ++PD+ L    P  EG++K PK    ID++GPEVD+ I                         G K KG D D+ L +  +DV + K DI  P  DI+ 
Sbjct: 1507 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIEC 1690          

HSP 5 Score: 55.4546 bits (132), Expect = 2.241e-7
Identity = 67/204 (32.84%), Postives = 99/204 (48.53%), Query Frame = 2
Query:   23 INLPDWKLPKF-------EGK---LKKPKGDLDVE-------APDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDID--IHGKKPKG------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            + +P +K+PKF       EGK   +  P+G++DV        APD+D++    K KG           ++D N+K P V+ D     +DI   EV+++       +DFNL   K P  EG +K PK +I   ++++E P+VDID  + G K K       D D NLK P V+       VDIN P++    P  DI    + SK
Sbjct:  428 LKMPKFKMPKFGFSGSKVEGKDVDITLPEGEMDVSGPKVDISAPDLDIECPEGKVKGPKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPD----IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSK 624          

HSP 6 Score: 50.0618 bits (118), Expect = 9.222e-6
Identity = 64/200 (32.00%), Postives = 99/200 (49.50%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---------------GDLDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKMDI------DIEVDIDGKK-KKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDID--IHGKKPKG------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            +D+ +PD +L   EGK+K PK                ++D++ P+ ++D+ G  PK +I   DLN++ P   +   K  +      DI++++ G K +    DFNL   K P  EG +K PK +I   ++++E P+VDID  + G K K       D D NLK P V+       VDIN P++    P  DI    + SK
Sbjct:  808 VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSG--PKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSK 1002          
BLAST of SMED30000771 vs. Ensembl Xenopus
Match: ENSXETT00000018110.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41376684:41386344:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000018110.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.862e-10
Identity = 69/197 (35.03%), Postives = 95/197 (48.22%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEID---IDVEGPEVDIDIHGKKPK-----------GDFDVNLKKPNVDVDINKP--DIVYPIFDIQ 460
            LD NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       ++D N+K P V+ D     +DI          +VDIDGK K             LDFNL   K P  EG +K PK EI    +++E P+VD+D   K PK            D  +N+K P ++ ++  P  D+  P FD+ 
Sbjct:  507 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVA 697          

HSP 2 Score: 59.3066 bits (142), Expect = 1.252e-8
Identity = 56/159 (35.22%), Postives = 88/159 (55.35%), Query Frame = 2
Query:   23 INLPDWKL----PKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPKGEIDL-NVKNPNVDIDFHKMD---IDI-----EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK--------GEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVD 418
            +++PD  L    PK EG+LK PK  +D++ P++DV   D+  + P+G++ +   K P       K+D   IDI     E+D+ G K    +D + PD  +   EGKVK PK         +ID++++GP+V+ D  G  PK D    +VNL+ P+VD+D
Sbjct:  339 VSMPDLGLNIKGPKMEGELKGPK--IDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPK----VDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKG--PKVDIKAPEVNLEAPDVDID 489          

HSP 3 Score: 58.5362 bits (140), Expect = 2.495e-8
Identity = 74/237 (31.22%), Postives = 104/237 (43.88%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------------------------GDLDVEAPDIDV---DIHGKKPKG---------------EIDLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDID--IHGKKPKG------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            +D+ +PD +L   EGK+K PK                        G++DV  P +D+   D++ + P+G               +IDLN+K P V+ D     +DI          +VDIDGK K             LDFNL   K P  EG +K PK +I   ++++E P+VDID  + G K K       D D NLK P V+       VDIN P++    P  DI    + SK
Sbjct:  369 VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSK 602          

HSP 4 Score: 56.6102 bits (135), Expect = 8.050e-8
Identity = 70/218 (32.11%), Postives = 103/218 (47.25%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-----DVEAPDIDVDIHGKKPK-----------GEIDLNVKNPNVD-------IDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTF-------EGK---VKKPKGEIDIDVEGPEVDI---DIHGKKPKG---------------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            LD NL   K PK EG LK PK D+     ++EAPD+D D   K PK            ++ LN+K P ++       ID    ++D+   +V+++G + K      +P +K+P F       +GK   +K P+GE  IDV GP+VDI   D++ + P+G               D D+NLK P V+       VDI  P++    P  DI    + SK
Sbjct:  288 LDFNL---KGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEVDVAIPDVELEGPEGK----MKMPKFKMPKFGFSGSKVDGKEIDIKLPEGE--IDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKGSK 496          

HSP 5 Score: 56.225 bits (134), Expect = 1.060e-7
Identity = 61/196 (31.12%), Postives = 91/196 (46.43%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-DVEAPDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKMDIDIE----------VDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDI---DIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS 463
             D+ +PD +L   EGKLK PK  +    AP++D++    K KG           +ID N+K P ++ D     +DI+          VDIDGK K  GL+      K P  EG++K P    +ID++GPEVD+   D+  + P+G                      DV++  P  ++DI+ P  DI  P  DI+ 
Sbjct:  694 FDVAIPDVELEGPEGKLKMPKFKMPKFGAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKVDIQAPDVNLEAPDVDIDGKVK--GLNI-----KGPKMEGELKGP----NIDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPELDIEC 878          

HSP 6 Score: 55.8398 bits (133), Expect = 1.645e-7
Identity = 55/166 (33.13%), Postives = 86/166 (51.81%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEID---IDVEGPEVDIDIHGKKPK-----------GDFDVNLKKPNVDVDINKPDI 436
            +DI+ P   +   EGK+K PK  +  +  PDID+++ G K +G++    K P VDI+  +++++  +VDIDGK K             LDFNL   K P  EG +K PK +I    +++E P+VD D   K PK            D  +N+K P ++ ++  P I
Sbjct:  204 VDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDL----KGPKVDINAPEINLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKI 362          

HSP 7 Score: 55.4546 bits (132), Expect = 1.762e-7
Identity = 63/192 (32.81%), Postives = 95/192 (49.48%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKH------GLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSH--IEQPVSDSDRNFNS 541
            +D+ +PD +L   EGKLK PK          L  +  D+D+ +    P+GEID++   P VDI   ++DI+  E  + G K K        +DFNL   K P  EG +K PK    +D++ PEV+++     P  DFD  +K   V V++    I  P F + S + FSKP  K    +  P  DS+ +  +
Sbjct:  813 VDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISL----PEGEIDIS--GPKVDISAPELDIECPEGRVKGPKFKMPSLHMPDIDFNL---KGPKLEGDLKAPK----VDIKAPEVNLEA----PDVDFDGKIK--GVSVEVPDSKIKGPKFKLPS-WGFSKPSKKGGFDVNTPELDSEVSMKT 984          

HSP 8 Score: 50.447 bits (119), Expect = 7.412e-6
Identity = 54/166 (32.53%), Postives = 86/166 (51.81%), Query Frame = 2
Query:   17 LDINLP---------DWKLPKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPKGEIDL-NVKNPNVDIDFHKM---DIDI-----EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK--------GEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVD 418
            LDI +P         + K PK EG+LK P  ++D++ P+ +V   D+  + P+G + +   K P       K    D+DI     E+DI G K    +D + P   +   EGKVK PK         +ID++++GP+V+ D+ G  PK D    ++NL+ P+VD+D
Sbjct:  113 LDIEVPKVSMPDLGFNIKGPKMEGELKGP--NIDMKGPEAEVAIPDVELEGPEGRLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK----VDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDLKG--PKVDINAPEINLEAPDVDID 270          
BLAST of SMED30000771 vs. Ensembl Xenopus
Match: ENSXETT00000017926.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41392497:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000017926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.989e-10
Identity = 55/140 (39.29%), Postives = 84/140 (60.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD 418
            LD NL   K PK EG LK PK D++     +EAPDID ++ G K +G++    K P VDI+  +++++  +VDIDGK K  G  F +P   +P  +  +K PK  ++ D++GP+VDI+          +VNL+ P+VD+D
Sbjct:  497 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDIDFNLKGPKVEGDL----KGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDIDFNLKGPK--VEGDLKGPKVDINAP--------EVNLEAPDVDID 617          

HSP 2 Score: 58.9214 bits (141), Expect = 1.833e-8
Identity = 62/203 (30.54%), Postives = 98/203 (48.28%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFHKMDIDIEVDIDGKK---KKHGLDFNLPDWKLPTFEGKVKKPKGEI-------------DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS------NFQFSKPVIKSHIEQPVSD 520
            LD NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       ++D N+K P V+ D     ++I+ ++ G K   K    D  +PD +L   EGK+K PK ++             D+D+  PE +IDI G K      V++  P +D++  +  +  P F + S      +F    P ++  ++ P  D
Sbjct:  960 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVEIKGELKGPKIDMKGPEFDVAIPDVELEGPEGKLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPK------VDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNLKGPKLEGDLKGPKVD 1153          

HSP 3 Score: 58.151 bits (139), Expect = 2.969e-8
Identity = 57/172 (33.14%), Postives = 88/172 (51.16%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            +D NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       +ID N+K P V+ D     +DI          +VDIDGK K  G  F +P   +P           +ID +++GP+V+ D+ G K +G+    LK PN+D+   + ++  P  +++ 
Sbjct:  529 IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMP-----------DIDFNLKGPKVEGDLKGPKMEGE----LKGPNIDMKGPEAEVAIPDVELEG 680          

HSP 4 Score: 57.7658 bits (138), Expect = 3.910e-8
Identity = 61/194 (31.44%), Postives = 93/194 (47.94%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKMDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PTFEGKVKKPKGEIDIDVEGPEVDIDI------------------------HGKKPKG-DFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H  ++D+   EV+IDGK K H          + ++PD+ L    P  EG++K PK    ID++GPEVD+ I                         G K KG D D+ L +  +DV + K DI  P  DI+ 
Sbjct: 1507 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIEC 1690          

HSP 5 Score: 55.4546 bits (132), Expect = 2.319e-7
Identity = 67/204 (32.84%), Postives = 99/204 (48.53%), Query Frame = 2
Query:   23 INLPDWKLPKF-------EGK---LKKPKGDLDVE-------APDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDID--IHGKKPKG------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            + +P +K+PKF       EGK   +  P+G++DV        APD+D++    K KG           ++D N+K P V+ D     +DI   EV+++       +DFNL   K P  EG +K PK +I   ++++E P+VDID  + G K K       D D NLK P V+       VDIN P++    P  DI    + SK
Sbjct:  428 LKMPKFKMPKFGFSGSKVEGKDVDITLPEGEMDVSGPKVDISAPDLDIECPEGKVKGPKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPD----IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSK 624          

HSP 6 Score: 50.0618 bits (118), Expect = 9.626e-6
Identity = 64/200 (32.00%), Postives = 99/200 (49.50%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---------------GDLDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKMDI------DIEVDIDGKK-KKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDID--IHGKKPKG------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            +D+ +PD +L   EGK+K PK                ++D++ P+ ++D+ G  PK +I   DLN++ P   +   K  +      DI++++ G K +    DFNL   K P  EG +K PK +I   ++++E P+VDID  + G K K       D D NLK P V+       VDIN P++    P  DI    + SK
Sbjct:  808 VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSG--PKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSK 1002          
BLAST of SMED30000771 vs. Ensembl Xenopus
Match: ENSXETT00000032614.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:41381047:41392497:-1 gene:ENSXETG00000008286.1 transcript:ENSXETT00000032614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 4.679e-10
Identity = 55/140 (39.29%), Postives = 84/140 (60.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD 418
            LD NL   K PK EG LK PK D++     +EAPDID ++ G K +G++    K P VDI+  +++++  +VDIDGK K  G  F +P   +P  +  +K PK  ++ D++GP+VDI+          +VNL+ P+VD+D
Sbjct:  615 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDIDFNLKGPKVEGDL----KGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMPDIDFNLKGPK--VEGDLKGPKVDINAP--------EVNLEAPDVDID 735          

HSP 2 Score: 60.8474 bits (146), Expect = 4.038e-9
Identity = 69/197 (35.03%), Postives = 95/197 (48.22%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEID---IDVEGPEVDIDIHGKKPK-----------GDFDVNLKKPNVDVDINKP--DIVYPIFDIQ 460
            LD NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       ++D N+K P V+ D     +DI          +VDIDGK K             LDFNL   K P  EG +K PK EI    +++E P+VD+D   K PK            D  +N+K P ++ ++  P  D+  P FD+ 
Sbjct: 1144 LDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVEIKAPKVNLEAPDVDVDGKVKGPKFEMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEFDVA 1334          

HSP 3 Score: 57.7658 bits (138), Expect = 3.985e-8
Identity = 57/172 (33.14%), Postives = 88/172 (51.16%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            +D NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       +ID N+K P V+ D     +DI          +VDIDGK K  G  F +P   +P           +ID +++GP+V+ D+ G K +G+    LK PN+D+   + ++  P  +++ 
Sbjct:  647 IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVK--GSKFKMPSLHMP-----------DIDFNLKGPKVEGDLKGPKMEGE----LKGPNIDMKGPEAEVAIPDVELEG 798          

HSP 4 Score: 57.3806 bits (137), Expect = 5.070e-8
Identity = 61/194 (31.44%), Postives = 93/194 (47.94%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-----DFHKMDIDI---EVDIDGKKKKHGL--------DFNLPDWKL----PTFEGKVKKPKGEIDIDVEGPEVDIDI------------------------HGKKPKG-DFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            L+++ P +K+P     +K PK    V  PD+++++ G K KG++D+ V     DI     D H  ++D+   EV+IDGK K H          + ++PD+ L    P  EG++K PK    ID++GPEVD+ I                         G K KG D D+ L +  +DV + K DI  P  DI+ 
Sbjct: 1789 LEVSSPKFKMPSLN--IKSPK----VSMPDVELNLKGPKIKGDMDVMVPKVEGDIKDLKADIHCPEVDLNAPEVNIDGKVKGHKFKMPSVHVPEVSMPDFGLNVKGPKVEGELKGPK----IDMKGPEVDVAIPDVELEGPEGKLKMPKFKMPTFGFSGSKVKGKDIDIALPEGEIDVSVPKLDISAPELDIEC 1972          

HSP 5 Score: 56.6102 bits (135), Expect = 1.035e-7
Identity = 56/159 (35.22%), Postives = 88/159 (55.35%), Query Frame = 2
Query:   23 INLPDWKL----PKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPKGEIDL-NVKNPNVDIDFHKMD---IDI-----EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK--------GEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVD 418
            +++PD  L    PK EG+LK PK  +D++ P++DV   D+  + P+G++ +   K P       K+D   IDI     E+D+ G K    +D + PD  +   EGKVK PK         +ID++++GP+V+ D  G  PK D    +VNL+ P+VD+D
Sbjct:  976 VSMPDLGLNIKGPKMEGELKGPK--IDMKGPEVDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPK----VDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKG--PKVDIKAPEVNLEAPDVDID 1126          

HSP 6 Score: 55.0694 bits (131), Expect = 2.423e-7
Identity = 74/237 (31.22%), Postives = 104/237 (43.88%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------------------------GDLDVEAPDIDV---DIHGKKPKG---------------EIDLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDID--IHGKKPK------GDFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            +D+ +PD +L   EGK+K PK                        G++DV  P +D+   D++ + P+G               +IDLN+K P V+ D     +DI          +VDIDGK K             LDFNL   K P  EG +K PK +I   ++++E P+VDID  + G K K       D D NLK P V+       VDIN P++    P  DI    + SK
Sbjct: 1006 VDVAIPDVELEGPEGKMKMPKFKMPKFGFSGSKVDGKEIDIKLPEGEIDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSK 1239          

HSP 7 Score: 55.0694 bits (131), Expect = 2.901e-7
Identity = 67/204 (32.84%), Postives = 99/204 (48.53%), Query Frame = 2
Query:   23 INLPDWKLPKF-------EGK---LKKPKGDLDVE-------APDIDVDIHGKKPKG-----------EIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDID--IHGKKPK------GDFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            + +P +K+PKF       EGK   +  P+G++DV        APD+D++    K KG           ++D N+K P V+ D     +DI   EV+++       +DFNL   K P  EG +K PK +I   ++++E P+VDID  + G K K       D D NLK P V+       VDIN P++    P  DI    + SK
Sbjct:  546 LKMPKFKMPKFGFSGSKVEGKDVDITLPEGEMDVSGPKVDISAPDLDIECPEGKVKGPKFKMPSLHMPDLDFNLKGPKVEGDLKGPKVDINAPEVNLEAPD----IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSK 742          

HSP 8 Score: 53.9138 bits (128), Expect = 6.448e-7
Identity = 70/218 (32.11%), Postives = 103/218 (47.25%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-----DVEAPDIDVDIHGKKPK-----------GEIDLNVKNPNVD-------IDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTF-------EGK---VKKPKGEIDIDVEGPEVDI---DIHGKKPKG---------------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            LD NL   K PK EG LK PK D+     ++EAPD+D D   K PK            ++ LN+K P ++       ID    ++D+   +V+++G + K      +P +K+P F       +GK   +K P+GE  IDV GP+VDI   D++ + P+G               D D+NLK P V+       VDI  P++    P  DI    + SK
Sbjct:  925 LDFNL---KGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKIDMKGPEVDVAIPDVELEGPEGK----MKMPKFKMPKFGFSGSKVDGKEIDIKLPEGE--IDVSGPKVDISAPDLNMECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDSKGPKVDIKAPEVNLEAPDVDIDGKVKGSK 1133          

HSP 9 Score: 53.1434 bits (126), Expect = 1.008e-6
Identity = 59/167 (35.33%), Postives = 87/167 (52.10%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKH------GLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDIDIHGKK------PK---GDFDVNLKKPNVDVDINKPDI 436
            +D+ +PD +L   EGKLK PK  +         V+  DID+    K P+GEIDL+   P VDI   ++DI+  E  + G K K        +DFNL   K P  EG +K PK +I   ++++E P+VD  + G K      PK    D  +N+K P V+ ++  P+I
Sbjct:  167 VDVAIPDVELEGPEGKLKMPKFKMPKFGFSGSKVDGKDIDI----KLPEGEIDLSA--PKVDISAPELDIECPEGKVKGPKFKMPSLHMPDIDFNL---KGPKLEGDLKGPKVDIKAPEVNLEAPDVDGKVKGPKFKMPSVPKVSMPDLGLNVKGPKVEGELKGPNI 324          

HSP 10 Score: 53.1434 bits (126), Expect = 1.166e-6
Identity = 60/190 (31.58%), Postives = 94/190 (49.47%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-----DVEAPDIDVDIHGKK------PK---GEIDLNVKNPNVD-------IDFHKMDIDI---EVDIDG--------KKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYP---IFDIQSNFQFSK 481
            +D NL   K PK EG LK PK D+     ++EAPD+D  + G K      PK    ++ LNVK P V+       ID    ++D+   +V+++G        K K   ++ NLP  K+P  +  +K PK +   D+ GP+++ D+ G       DV +K P +D+D+   DI  P   + + +S F   K
Sbjct:  252 IDFNL---KGPKLEGDLKGPKVDIKAPEVNLEAPDVDGKVKGPKFKMPSVPKVSMPDLGLNVKGPKVEGELKGPNIDMKGPEVDVAVPDVELEGPEGKLKMPKFKMPSVNVNLP--KVPDVDFNIKSPKWKGGADISGPKLEGDVRG------LDVEIKSPEIDIDVPDLDIGGPEAKVKNKKSRFHMPK 430          

HSP 11 Score: 52.7582 bits (125), Expect = 1.420e-6
Identity = 55/166 (33.13%), Postives = 86/166 (51.81%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL-DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHG----------LDFNLPDWKLPTFEGKVKKPKGEID---IDVEGPEVDIDIHGKKPK-----------GDFDVNLKKPNVDVDINKPDI 436
            +DI+ P   +   EGK+K PK  +  +  PDID+++ G K +G++    K P VDI+  +++++  +VDIDGK K             LDFNL   K P  EG +K PK +I    +++E P+VD D   K PK            D  +N+K P ++ ++  P I
Sbjct:  841 VDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDL----KGPKVDINAPEINLEAPDVDIDGKVKGSKFKMPSLHMPDLDFNL---KGPKMEGDLKGPKVDIKAPKVNLEAPDVDFDGKVKGPKFKMPSMPKVSMPDLGLNIKGPKMEGELKGPKI 999          

HSP 12 Score: 50.447 bits (119), Expect = 7.562e-6
Identity = 70/222 (31.53%), Postives = 102/222 (45.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLD-----VEAPDIDVD--IHGKKPKG------EIDLNVKNPNVDIDFH--KMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-------------DIDVEGPEVDIDIHGKK------------PKG---------------DFDVNLKKPNVD-------VDINKPDI--VYPIFDIQSNFQFSK 481
            +D NL   K PK EG LK PK D++     +EAPD+D+D  + G K K       +ID N+K P V+ D    KM+ +++   +D+ G +     +  +PD +L   EG++K PK ++             D+D+  PE +IDI G K            P+G               D D+NLK P V+       VDIN P+I    P  DI    + SK
Sbjct:  700 IDFNL---KGPKVEGDLKGPKVDINAPEVNLEAPDVDIDGKVKGSKFKMPSLHMPDIDFNLKGPKVEGDLKGPKMEGELKGPNIDMKGPE----AEVAIPDVELEGPEGRLKMPKFKMPKFGFSGLKADGKDVDISLPEGEIDISGPKVDISAPKLDIECPEGKVKGPKFKMPSLHMPDIDLNLKGPKVEGDLKGPKVDINAPEINLEAPDVDIDGKVKGSK 914          
BLAST of SMED30000771 vs. Ensembl Mouse
Match: Ahnak (AHNAK nucleoprotein (desmoyokin) [Source:MGI Symbol;Acc:MGI:1316648])

HSP 1 Score: 60.077 bits (144), Expect = 6.800e-9
Identity = 63/183 (34.43%), Postives = 91/183 (49.73%), Query Frame = 2
Query:   20 DINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D+  P+  +   EGKLK PK    D+  + P     DID+++ G K KG++D+++       K P VDI   K+DID  ++DI G + K  G  F +PD  L       K PK      +  PEVD+++ G K KGD DV       +LK P VD+   K DI  P  D+   ++    P +K
Sbjct: 4265 DLKGPEIDIEGPEGKLKGPKFKVPDVQFKTPQISMSDIDLNVKGPKIKGDLDISIPKPEGDLKGPKVDIKGPKLDIDTPDIDIHGPEGKLKGPKFKMPDLHL-------KAPK------ISMPEVDLNLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDISAPDVDVHGPDWHLKMPKVK 4434          

HSP 2 Score: 59.6918 bits (143), Expect = 8.429e-9
Identity = 59/166 (35.54%), Postives = 89/166 (53.61%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEI----DLNVKNPNV---DIDFH------KMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPK--GDFDVN-------LKKPNVD-----VDINKPDI 436
            D  +PK EG+LK P   +DVE PD+D++    K KG      D++ K P +   D+D H      K D+D+ V  ++G+ K   +D  +PD  L   + K+K PK ++ D+  + P++   D+D+H K PK  GD DV        +K P+VD     VDIN PD+
Sbjct: 2053 DVTVPKLEGELKGP--SVDVEVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVTVPKLEGELKGPSVDVEVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKIEGEMKVPDVDIKGPKVDINAPDV 2216          

HSP 3 Score: 59.3066 bits (142), Expect = 1.054e-8
Identity = 66/214 (30.84%), Postives = 94/214 (43.93%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDI-EVDIDGKKKKHGL-DFNLPDWKLPTFEGK-----VKKPKGEIDID------------VEGPE------------------------VDIDIHGKKPKGDFDVN-------LKKPNVDVDINKPDIVYPIFDIQS 463
            LDI+ PD  L   EGKLK PK  +         V  PD+D+D+ G K KG +D++       +K P+VDI    +DI   EVD+ G +    +    +P + +PT +G+     V  PK  ID+             +EGPE                        VD+++ G K KGD DV        +K P+VD+   K DI  P  D+Q 
Sbjct: 1033 LDISAPDLNLEGPEGKLKGPKFKMPEMHFKAPKVSLPDVDLDLKGPKMKGNLDMSAPKIEGEMKAPDVDIKGPNVDIKAPEVDVQGPEWSLKMPKMKMPKFSMPTLKGEGPDVDVSLPKATIDVSGPKLDIETSDVSLEGPEGKLKGPKFKMPDMHFKAPKISMPDVDLNMKGPKVKGDMDVTVPKIEGEMKVPDVDIKGPKVDISAPDVDVQG 1246          

HSP 4 Score: 58.9214 bits (141), Expect = 1.605e-8
Identity = 60/175 (34.29%), Postives = 83/175 (47.43%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGD-----LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI---EVDIDG--------KKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQS 463
            D  LPK EG LK P+ D     +D+ APD+DV   D H K PK ++          + P VD++  K D+D+   +VDI+G        + K  G  F +PD  L       K PK      +  PE+D+++ G K KGD DV       +LK P VD+   K DI  P  D+  
Sbjct: 3926 DVSLPKVEGDLKGPEVDIKGPKMDISAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIEGPNVNIEGPEGKLKGPKFKMPDLHL-------KAPK------ISMPEIDLNLKGPKLKGDVDVSLPKVEGDLKGPEVDIKGPKVDISAPDMDVHG 4087          

HSP 5 Score: 58.151 bits (139), Expect = 2.224e-8
Identity = 86/318 (27.04%), Postives = 139/318 (43.71%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK-KKHGLDFNL-------PDWKLPTFEG---KVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV---------------DINKPDIVYPIFD--IQSNFQFSKPVIKSHIEQPVSDSD----RNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP----DDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSD 835
            +DI  PD  +   EGKLK PK    D+  +AP I   DVD++ K PKG+ D++   P V+      D+DI   +V ID    + HG D++L       P + +P F+G   +V  PK   +IDV GP+VDID+         DVN++ P+  +                I+ PD+   +    ++++   S P +   I+ P  D         +  +    + L  P  ++ +FS   +P      A  D++   ++   S P    D P +NIE P   +        + + Q    S+ +  LN + P LK   D
Sbjct: 1413 VDIEAPDVSIEGPEGKLKGPKFKMPDMHFKAPKISMPDVDLNIKGPKGKADVDASLPEVEGGVKVPDVDIKGPKVGIDAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDIPKA--NIDVSGPKVDIDVP--------DVNIEGPDTKLKGPKFKMPEMNIKPQKISMPDVSLNLKGPKVKADCDVSVPKVGGEIKAPAVDIKGPKVEAPDVEVHGPDWHLKMPKVKMPKFS---MPGFKGEGAEVDVNLQKANIDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKGPKLKSGVD 1717          

HSP 6 Score: 58.151 bits (139), Expect = 2.530e-8
Identity = 56/157 (35.67%), Postives = 86/157 (54.78%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            +DI+ PD  +   EGKLK PK    D+ ++AP     D D+++ G K KG++DL +  PNV+ D    +IDIE   +GK K  G  F +PD +  T +  +     +ID++V+GP++         KGD D+++ KP  D+   K DI  P  DI +
Sbjct: 4204 VDIDTPDVNIEVPEGKLKGPKFKMPDMHIKAPKISMPDFDLNLKGPKVKGDVDLAL--PNVEGDLKGPEIDIE-GPEGKLK--GPKFKVPDVQFKTPQISMS----DIDLNVKGPKI---------KGDLDISIPKPEGDLKGPKVDIKGPKLDIDT 4342          

HSP 7 Score: 58.151 bits (139), Expect = 2.780e-8
Identity = 61/178 (34.27%), Postives = 89/178 (50.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGD-----LDVEAPDIDVDIHGKKPKGEI-DLNVKNPNVDIDFHKMDI-DIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDI-----DIHGKKPKGDF-----------------DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSK 481
            D  +P  EG LK P  D     LDV APDIDV  HG  P+G++    +K P++ +   K+ + +I++++ G K K  +D + P       EG +K P+    +D++GPEVDI     +I GK  K  F                 DV LKKP+VD+   K DI  P  ++Q   + SK
Sbjct: 2966 DVSIPNIEGDLKGPSLDIKSPKLDVNAPDIDV--HG--PEGKLKGPKLKMPDMHVSMPKISMPEIDLNLKGSKVKGDVDISGP-----KLEGDIKVPR----VDLKGPEVDISAPKVNIDGKAKKSRFKLPKFNFSGSKVQTPEVDVKLKKPDVDITAPKVDINAPEVEVQGKVKGSK 3130          

HSP 8 Score: 57.7658 bits (138), Expect = 3.358e-8
Identity = 57/164 (34.76%), Postives = 88/164 (53.66%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEI----DLNVKNPNV---DIDFH------KMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPK--GDFDVN-------LKKPNVDVDINKPDIVYP 445
            D  +PK EG+LK P   +DVE PD+D++    K KG      D++ K P +   D+D H      K D+D+ V  ++G+ K   +D  +PD  L   + K+K PK ++ D+  + P++   D+D+H K PK  GD DV        LK P+VDV++   D+  P
Sbjct: 1986 DVTVPKLEGELKGP--SVDVEVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKLEGELKGPSVDVEVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVTVPKLEGELKGPSVDVEVPDVDLECP 2147          

HSP 9 Score: 56.225 bits (134), Expect = 1.051e-7
Identity = 61/181 (33.70%), Postives = 89/181 (49.17%), Query Frame = 2
Query:   23 INLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDV----------------------DIHGKKPK---GEIDLNVKNP----NVDIDFHKMDIDI---EVDIDGKK---KKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            + +P + +P F+G+     +  PK DLDV  P +D+                      D+H K PK    EIDLN+K P    +VD+   K++ D+   EVDI G K       +D + PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+   P VD+D+  PD+
Sbjct: 3969 VKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIEGPNVNIEGPEGKLKGPKFKMPDLHLKAPKISMPEIDLNLKGPKLKGDVDVSLPKVEGDLKGPEVDIKGPKVDISAPDMDVHGPDWHLKMP----KMKMPKFSMPGFKAEGPEVDVNL----PKADIDVS--GPKVDIDV--PDV 4137          

HSP 10 Score: 55.8398 bits (133), Expect = 1.371e-7
Identity = 75/230 (32.61%), Postives = 101/230 (43.91%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPK-----GDLDVEAPDI----------------------DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIE---VDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQ--------SNFQFSKPVIK-SHIEQPVSDSDRNFNSNLLSKSFD 565
            K K G+D++LP     K EG+LK P+     GD+D+E P+                       DVD+H K PK + D++V  P ++ +    D+DI+   VDI+       +D   PDW  K+P    KVK PK  +     EGPEVD             VNL K ++DV   K DI  P  DI+        S F+  K  IK + I  P  D D NF    L    D
Sbjct: 1711 KLKSGVDVSLP-----KVEGELKGPEVDVDVGDIDIECPEGKLKGPKFKMPDMHFKTPKISMPDVDLHLKGPKVKGDMDVTMPKIEGEMKVPDVDIKGPKVDINAPD----VDVRGPDWHLKMP----KVKMPKFSMPGFKAEGPEVD-------------VNLPKADIDVSGPKVDIDVPDLDIEGPEGKLKGSKFKMPKLNIKAAKISMP--DVDLNFKGPKLKGEID 1912          

HSP 11 Score: 55.0694 bits (131), Expect = 2.477e-7
Identity = 54/158 (34.18%), Postives = 83/158 (52.53%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPK---------------GEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG LK P+ D+     D+ APD+DV   D H K PK                E+D+++   N+D+   K+DID+ +V+I+G   K       P +K+P  E  +K PK      +  P++D+++ G K KGD DV+L  P V+ +I  P++
Sbjct: 4390 DVSLPKVEGDLKGPEVDIKGPKVDISAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVSLPKANIDVSGPKVDIDVPDVNIEGPDAK----LKGPKFKMP--EMNIKAPK------ISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEV 4533          

HSP 12 Score: 54.299 bits (129), Expect = 3.489e-7
Identity = 57/161 (35.40%), Postives = 89/161 (55.28%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPK--GDFDV-------NLKKPNVDVDINKPDI 436
            +DI++PD  +   EGKLK PK  +         +  PD+D ++ G K KG+ID++V  P ++ +        E+D+ G K    LD N+P+  +   EGK K PK ++ D+  + P++   DID+H K PK  G+ DV       +LK PN  VD+++PDI
Sbjct: 2263 VDIDVPDVNIEGPEGKLKGPKFKMPDMHFKAPKISMPDVDFNLKGPKIKGDIDVSV--PKIEGELK----GPELDLKGPK----LDANIPEVAVEGPEGKWKSPKFKMPDMHFKTPKISMPDIDLHLKSPKIKGEVDVDVPKLEGDLKGPN--VDMSRPDI 2411          

HSP 13 Score: 54.299 bits (129), Expect = 3.519e-7
Identity = 58/186 (31.18%), Postives = 89/186 (47.85%), Query Frame = 2
Query:   23 INLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDVD-----IHG-----------------KKPK---GEIDLNVKNPNVDIDFHKMDIDIEVDIDGKK---KKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGP-----EVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            + +P + +P F+G+     +  PK DLDV  P +D+D     I G                 K PK    +++LN+K PNV  D      +IE D+ G     K   LD N PD  +   EGK+K PK ++ D+ V  P     E+D+++ G K KGD D++  K   D+ + + D+  P  DI +
Sbjct: 2881 VKMPKFSMPGFKGEGPEVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEVNIKAPKISMPDLNLNLKGPNVKGDVDVSIPNIEGDLKGPSLDIKSPKLDVNAPDIDVHGPEGKLKGPKLKMPDMHVSMPKISMPEIDLNLKGSKVKGDVDISGPKLEGDIKVPRVDLKGPEVDISA 3066          

HSP 14 Score: 54.299 bits (129), Expect = 4.286e-7
Identity = 54/150 (36.00%), Postives = 85/150 (56.67%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDIDV-DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI++PD  +   + KLK PK    +++++AP I + D+H K PK + D++V  P V+ D    D+DI   ++DI+       +D   PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+   P VD+D+  PD+
Sbjct: 2660 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLPKVEGDLKGPDVDIKGPKMDINAPD----MDVQGPDWHLKMP----KMKMPKFSMPGFKAEGPEVDVNL----PKADLDVS--GPKVDIDV--PDV 2793          

HSP 15 Score: 53.9138 bits (128), Expect = 4.474e-7
Identity = 57/173 (32.95%), Postives = 83/173 (47.98%), Query Frame = 2
Query:   47 PKFEGKLKKPKGDL-----DVEAPDIDVDIHGKK-----PK----------GEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHG-----LDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDV-----DINKPDIVYPIFDIQS 463
            PK EG +K P+ DL     D+ AP +++D   KK     PK           E+D+ +K P+VDI   K+DI+  EV++ GK K        L  + P   +P  E  +K PK + D+D  GP ++ D  G  PK D    DV L  P+VDV     ++  P +  P F +  
Sbjct: 3044 PKLEGDIKVPRVDLKGPEVDISAPKVNIDGKAKKSRFKLPKFNFSGSKVQTPEVDVKLKKPDVDITAPKVDINAPEVEVQGKVKGSKFKMPFLSISSPKVSMPDVELNLKGPKVKGDLDAAGPNLEGDFKG--PKVDIKAPDVQLNAPDVDVHGPEWNLKMPKMKMPKFGVSG 3214          

HSP 16 Score: 53.9138 bits (128), Expect = 4.874e-7
Identity = 56/164 (34.15%), Postives = 86/164 (52.44%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEA-----PDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKP--KGDFDVN-------LKKPNVDVDINKPDIVYP 445
            +DI++PD  +   EGKLK  K     L+++A     PD+D++  G K KGEID +V  P ++ D     +DI        K   +D  +PD  L   + K+K PK ++ D+  + P++   D+D+H K P  KGD DV        LK P+VDV++   D+  P
Sbjct: 1860 VDIDVPDLDIEGPEGKLKGSKFKMPKLNIKAAKISMPDVDLNFKGPKLKGEIDASV--PEMEADLRGPQVDI--------KGTNVDVKVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKLEGELKGPSVDVEVPDVDLECP 2013          

HSP 17 Score: 53.9138 bits (128), Expect = 4.874e-7
Identity = 59/162 (36.42%), Postives = 87/162 (53.70%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPK--GEIDLNV-------KNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDW-------KLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            LD N+P+  +   EGK K PK    D+  + P I   D+D+H K PK  GE+D++V       K PNVD+   + DI+IE   +GK K  G  F +P+         +P F+  +K PK + D+D+  P+V+ DI G       +V++K P   VDIN PD+
Sbjct: 2337 LDANIPEVAVEGPEGKWKSPKFKMPDMHFKTPKISMPDIDLHLKSPKIKGEVDVDVPKLEGDLKGPNVDM--SRPDIEIE-GPEGKLK--GPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDISLPKVEGDIKGP------EVDIKGPK--VDINAPDV 2485          

HSP 18 Score: 53.9138 bits (128), Expect = 5.310e-7
Identity = 55/150 (36.67%), Postives = 83/150 (55.33%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDIDV-DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI++PD  +   + KLK PK    +++++AP I + D+H K PK + D++V  P V+ D    DIDI   ++DI+       +D   PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+  K    VDI  PD+
Sbjct: 1287 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLPKVEGDLKGPDIDIKGPKMDINAPD----MDVQGPDWHLKMP----KMKMPKFSMPGFKAEGPEVDVNL----PKADIDVSGPK----VDIEAPDV 1420          

HSP 19 Score: 53.5286 bits (127), Expect = 5.986e-7
Identity = 53/158 (33.54%), Postives = 83/158 (52.53%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKG---------------EIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P+ D+     D+ APD+DV   D H K PK                E+D+N+   ++D+   K+DID+ +V+I+G   K       P +K+P  E  +K PK      +  P++D+++ G K KGD DV+L  P V+ +I  P++
Sbjct: 2456 DISLPKVEGDIKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIDVPDVNIEGPDAK----LKGPKFKMP--EMNIKAPK------ISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEV 2599          

HSP 20 Score: 53.5286 bits (127), Expect = 6.577e-7
Identity = 56/152 (36.84%), Postives = 83/152 (54.61%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +D+ +PD  L   + KLK PK    D+  +AP I   DVD+H K PK + D++V  P ++ +    D+DI   +VDI+       +D   PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+   P VD+D+  PD+
Sbjct: 2135 VDVEVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKIEGEMKVPDVDIKGPKVDINAPD----VDVRGPDWHLKMP----KMKMPKFSMPGFKAEGPEVDVNL----PKADIDVS--GPKVDIDV--PDV 2270          

HSP 21 Score: 53.1434 bits (126), Expect = 7.806e-7
Identity = 62/206 (30.10%), Postives = 107/206 (51.94%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDIDV-DIHGKKP--KGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDG-----KKKKHGL-DFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQ 574
            +DI++PD  +   + KLK PK    +++++AP I + D+H K P  KG++D+       ++K P+VDI   KMDI+  ++D+ G     K  K  +  F++P +K    E  V  PK  +D+DV GP+VDID+         DVN++ P  D  +  P    P  +I++  + S P I  +++ P    D + +   +     +P+
Sbjct: 3622 VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLPKVEGDLKGPDVDIKGPKMDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPK--VDLDVSGPKVDIDVP--------DVNIEGP--DAKLKGPKFKMPEMNIKAP-KISMPDIDLNLKGPKVKGDVDMSLPKVEGEIKVPE 3814          

HSP 22 Score: 53.1434 bits (126), Expect = 9.506e-7
Identity = 59/189 (31.22%), Postives = 94/189 (49.74%), Query Frame = 2
Query:   17 LDINLPDW-------KLPKF----------EGKLKKPKGDLDVEAPDIDVD-----IHG-----KKPKGEI-DLNVKNPNV---DIDFH------KMDIDIEV-DIDGKKKKHGLDFNL-------PDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +D++ PDW       K+PKF          E  +  PK D+DV  P +D+D     I G     K PK ++ ++N+K P +   D D H      K D+D  +  ++G+ K  G+D          PD  +   EGK+K PK ++ D+ ++ P++   D D++ K PK   DV+L  PNV+ D+  P+I
Sbjct: 4083 MDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDASLPKMEGELKGPGIDIKCPTVDIDTPDVNIEVPEGKLKGPKFKMPDMHIKAPKISMPDFDLNLKGPKVKGDVDLALPNVEGDLKGPEI 4271          

HSP 23 Score: 53.1434 bits (126), Expect = 9.837e-7
Identity = 66/223 (29.60%), Postives = 96/223 (43.05%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLD---VEAPDIDV---DIHGKKPK---------------GEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKK-HGLDFNLP---------------------------DWKLPTFEGKVKKPKGEID---IDVEGPE------------------------VDIDIHGKKPKGDFDVNLKK-------PNVD-----VDINKPDI 436
            D  +PK  G++K P  D+    VEAPD++V   D H K PK                E+D+N++  N+D+   K+DID+ +V+I+G + K  G  F +P                           D  LP  EG++K P+ ++D   ID+E PE                        VD+ + G K KGD DV + K       P+VD     VDIN PD+
Sbjct: 1591 DVSVPKVGGEIKAPAVDIKGPKVEAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGAEVDVNLQKANIDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKGPKLKSGVDVSLPKVEGELKGPEVDVDVGDIDIECPEGKLKGPKFKMPDMHFKTPKISMPDVDLHLKGPKVKGDMDVTMPKIEGEMKVPDVDIKGPKVDINAPDV 1813          

HSP 24 Score: 52.373 bits (124), Expect = 1.409e-6
Identity = 58/170 (34.12%), Postives = 83/170 (48.82%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKP----KG-DLDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI----------EVDIDGKKKK-HGLDFNLPDW-------KLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV-----DVDINKPD 433
            D  LPK EG LK P    KG  +D+ APD+DV   D H K PK ++          + P VD++  K DID+          +V I+G + K  G  F +PD         +P  +  +K PKG+ D+D   PEV+  +  K P    DV++K P V     DV+++ PD
Sbjct: 1337 DVSLPKVEGDLKGPDIDIKGPKMDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDIEAPDVSIEGPEGKLKGPKFKMPDMHFKAPKISMPDVDLNIKGPKGKADVDASLPEVEGGV--KVP----DVDIKGPKVGIDAPDVEVHGPD 1500          

HSP 25 Score: 51.9878 bits (123), Expect = 1.935e-6
Identity = 87/356 (24.44%), Postives = 145/356 (40.73%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKF----------EGKLKKPKGDLD-------VEAPDI-----------------------------DVDIHGKKP--KGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEG---KVKKPKGEI-----DIDVEGPEVDI---DIHGKKPKGDFDVNLKKPNV---DVDINKPDIVYPIFD-------IQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP----DDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSD 835
            HG D+ +P  K+PKF          E  +  PK DLD       V APD+                             DVD+H K P  KGE D+ V       K P+V++   K+DID+  VD+ G +    L   +P  K+P F     K + P+ E+     DIDV GP VD+   D++ + P+G     LK P +   +++I  P I  P  D       ++  +  + P ++  ++ P        + ++    ++L  P  ++ +FS   +P         D++   +    S+P      P +N+E P   +          H +    S+ +  L+ + P +K N D
Sbjct:  742 HGPDLKIPKMKMPKFSVPGFKAEGPEVDVNLPKADLDISGTKVEVSAPDVSIEGSEGKLKGHKFKMPEMNIRAPKISMPDVDLHLKGPNVKGEYDVTVPRAEGEIKVPDVELKSAKLDIDVPNVDVQGPE----LHMKMPKIKMPKFGMPGFKAESPEMEVNLPKSDIDVSGPNVDVKVPDVNIEGPEG----KLKGPKLKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDVTMPKLEGDLKGP-KVDVSVPDVDVHGPDWNLKMPKIKMPKFS---MPSLKGEGPELDVNMPKADVDISVPKLDISAPDLNLEGPEGKLKGPKFKMPEMHFKAPKVSLPDVDLDLKGPKMKGNLD 1085          

HSP 26 Score: 51.9878 bits (123), Expect = 2.072e-6
Identity = 53/158 (33.54%), Postives = 82/158 (51.90%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGD-----LDVEAPDIDV---DIHGKKPKG---------------EIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG LK P  D     +D+ APD+DV   D H K PK                E+D+N+   ++D+   K+DID+ +V+I+G   K       P +K+P  E  +K PK      +  P++D+++ G K KGD D++L  P V+ +I  P++
Sbjct: 2710 DVSLPKVEGDLKGPDVDIKGPKMDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAK----LKGPKFKMP--EMNIKAPK------ISMPDIDLNLKGPKVKGDVDMSL--PKVEGEIKVPEV 2853          

HSP 27 Score: 51.6026 bits (122), Expect = 2.522e-6
Identity = 51/154 (33.12%), Postives = 82/154 (53.25%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGD-----LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK---GEIDID---VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG LK P  D     +D+ APD+DV   D H K PK ++          + P VD++  K+D+D+     G K    +D ++PD  +   + K+K PK    E++I    +  P++D+++ G K KGD D++L  P V+ +I  P++
Sbjct: 3672 DVSLPKVEGDLKGPDVDIKGPKMDINAPDMDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKVDLDVS----GPK----VDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSL--PKVEGEIKVPEV 3815          

HSP 28 Score: 51.2174 bits (121), Expect = 3.098e-6
Identity = 50/154 (32.47%), Postives = 82/154 (53.25%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DI-----DVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  +PK EG++K P  D+     D+ APD+DV   D H K PK ++          + P VD++  K DID+     G K    +D ++PD  +   EGK+K PK ++ D+      +  P+VD ++ G K KGD DV++  P ++ ++  P++
Sbjct: 2187 DVTVPKIEGEMKVPDVDIKGPKVDINAPDVDVRGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPDMHFKAPKISMPDVDFNLKGPKIKGDIDVSV--PKIEGELKGPEL 2330          

HSP 29 Score: 51.2174 bits (121), Expect = 3.124e-6
Identity = 54/160 (33.75%), Postives = 80/160 (50.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGK---KKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVN-------LKKPNVDVDINKPDIVYP 445
            +D+ +PD  L   + KLK PK    D+  +AP I   DVD+H K PK + D++V  P ++ +     +D+EV D+D +    K  G  F +PD          K PK      +  P+VD+ + G K KGD DV        LK P+VDV++   D+  P
Sbjct: 1934 VDVKVPDVDLECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDMDVTVPKLEGELKGPSVDVEVPDVDLECPDAKLKGPKFKMPDMHF-------KAPK------ISMPDVDLHLKGPKVKGDMDVTVPKLEGELKGPSVDVEVPDVDLECP 2080          

HSP 30 Score: 51.2174 bits (121), Expect = 3.707e-6
Identity = 76/264 (28.79%), Postives = 109/264 (41.29%), Query Frame = 2
Query:   17 LDINLPDW-------KLPKF----------EGKLKKPKGDLDVEAPDIDVD-----IHG-----------------KKPK---GEIDLNVKNP----NVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS--------NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            +D+  PDW       K+PKF          E  +  PK DLDV  P +D+D     I G                 K PK    +IDLN+K P    +VD+   K++ +I   EVDI G K          HG D++L       P + +P F+G+     V  PK   D+DV GP+VDID+         DVN++ P  D  +  P    P  +I++        N     P +K  ++     S  N   +L   S D+  P
Sbjct: 2739 MDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSLPKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKA--DLDVSGPKVDIDVP--------DVNIEGP--DAKLKGPKFKMPEVNIKAPKISMPDLNLNLKGPNVKGDVDV----SIPNIEGDLKGPSLDIKSP 2986          

HSP 31 Score: 50.8322 bits (120), Expect = 4.399e-6
Identity = 61/198 (30.81%), Postives = 84/198 (42.42%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG------EIDIDVEGPEVDIDI------------------------------------HGKKPKGDFDVNLKKPNVDVDINKPDI 436
            LDI   D  L   EGKLK PK  +         +  PD+D+++ G K KG++D+ V       K P+VDI   K+DI   +VD+ G          +P  K+P F     K +G      + D+DV GP+VDID+                                     G K KGD DV+L  P V+ D+  PDI
Sbjct: 1161 LDIETSDVSLEGPEGKLKGPKFKMPDMHFKAPKISMPDVDLNMKGPKVKGDMDVTVPKIEGEMKVPDVDIKGPKVDISAPDVDVQGPD----WHLKMPKMKMPKFSMPGFKAEGPEVSLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSL--PKVEGDLKGPDI 1352          

HSP 32 Score: 50.447 bits (119), Expect = 6.465e-6
Identity = 53/158 (33.54%), Postives = 81/158 (51.27%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDI-----DVDIHG----------KKPK-GEIDLNVKNPNVDIDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKL--PTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D   P  EG  K PK  +D++APD+     DVD+HG          K PK G   +  + P+V +D  K DI+IE   ++I+G +    L+   P+  L  P F   E  +K PK      +  P++D+++ G K KGD DV+L  P V+ +I  P++
Sbjct: 3162 DAAGPNLEGDFKGPK--VDIKAPDVQLNAPDVDVHGPEWNLKMPKMKMPKFGVSGIKAEGPDVAVDLPKGDINIEGPSMNIEGPE----LNVECPEGSLKGPKFKMPEMNIKAPK------ISMPDIDLNLKGPKVKGDVDVSL--PKVEGEIKVPEV 3305          

HSP 33 Score: 50.0618 bits (118), Expect = 8.721e-6
Identity = 60/215 (27.91%), Postives = 91/215 (42.33%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPK--GEIDLNV---------------------------------------------KNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI------DIDVEGPEVDIDIHGKKPKGDFDVN-------LKKPNVDVDINKPDIVYPIFDIQS 463
            +D+ +PD  +   EGKLK PK    +++++AP I   DVD+H K PK  GE D+ +                                             + P +D++  K D+DI V          LD + PD  L   EGK+K PK ++         V  P+VD+D+ G K KG+ D++       +K P+VD+     DI  P  D+Q 
Sbjct:  912 VDVKVPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDVTMPKLEGDLKGPKVDVSVPDVDVHGPDWNLKMPKIKMPKFSMPSLKGEGPELDVNMPKADVDISV--------PKLDISAPDLNLEGPEGKLKGPKFKMPEMHFKAPKVSLPDVDLDLKGPKMKGNLDMSAPKIEGEMKAPDVDIKGPNVDIKAPEVDVQG 1118          

HSP 34 Score: 49.6766 bits (117), Expect = 9.915e-6
Identity = 94/368 (25.54%), Postives = 148/368 (40.22%), Query Frame = 2
Query:   17 LDINLPDW-------KLPKF----------EGKLKKPKGDLDVEAPDIDVD-----IHG-----------------KKPK---GEIDLNVKNP----NVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV----------DVDINKPDIVYPIF-----DIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFD-------LPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP----DDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSD 835
            +D+  PDW       K+PKF          E  +  PK DLDV  P +D+D     I G                 K PK    +IDLN+K P    +VD+   K++ +I   EVDI G K          HG D++L       P + +P F+G+     V  PK   D+DV GP+VDID+         DVN++ P+           +++I  P I  P        ++ +   S P ++  ++ P  D  +    ++ +   D       L  P  ++ +FS   +P         D++   +    S P    + P++NIE P   +          H +    S+ E  LN + P LK + D
Sbjct: 3701 MDVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKVDLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDMSLPKVEGEIKVPEVDIKGPKVDIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKA--DLDVSGPKVDIDVP--------DVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDI-KGPKMDISAPDVDVHGPDWHLKMPKVKMPKFS---MPGFKGEGPEVDVNLPKADLDVSGPKVDIEGPNVNIEGPEGKLKGPKFKMPDLHLKAPKISMPEIDLNLKGPKLKGDVD 4054          
BLAST of SMED30000771 vs. UniProt/SwissProt
Match: sp|Q09666|AHNK_HUMAN (Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 4.152e-8
Identity = 54/149 (36.24%), Postives = 85/149 (57.05%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKP--KGDFDVNLKKPNVDVDINKPDI 436
            D  +PK EG+LK PK  +D++APD+DV   D H K PK ++          + P VD++  K D    VDI G K    +D   PD  +   EGK+K PK ++ +++++ P++   D+D+H K P  KG++DV +  P V+ +I  PD+
Sbjct:  716 DVTVPKLEGELKGPK--VDIDAPDVDVHGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKAD----VDISGPK----IDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTM--PKVESEIKVPDV 852          

HSP 2 Score: 59.3066 bits (142), Expect = 6.718e-8
Identity = 57/163 (34.97%), Postives = 86/163 (52.76%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK---GEIDID---VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            D  LPK EG LK P+ D+     D+ APD+DV   D H K PK ++          + P+VD++  K D+D+     G K    +D ++PD  +   EGK+K PK    E++I    +  P++D+++ G K KGD DV+L K   D+ +   DI  P  DI +
Sbjct: 3764 DVSLPKMEGDLKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMQVPDLDIKGPKVDINA 3918          

HSP 3 Score: 59.3066 bits (142), Expect = 7.774e-8
Identity = 57/159 (35.85%), Postives = 82/159 (51.57%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPK---------------GEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG LK P+ D+     D++APD+DV   D H K PK                E+D+N+   ++D+   K+DID  ++DI G + K  G  F +PD  L       K PK      +  PEVD+++ G K KGD DV+L  P V+ D+  P++
Sbjct: 4020 DVSLPKMEGDLKAPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADIDVSGPKVDIDTPDIDIHGPEGKLKGPKFKMPDLHL-------KAPK------ISMPEVDLNLKGPKMKGDVDVSL--PKVEGDLKGPEV 4163          

HSP 4 Score: 58.5362 bits (140), Expect = 1.335e-7
Identity = 59/183 (32.24%), Postives = 92/183 (50.27%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDI----------HGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK---GEIDID---VEGPEVDIDIHGKKPKGDFDVNLKK-------PNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D  LPK EG LK P  ++D+  P +D+D+          H K PK ++          + P+VD++  K D+D+     G K    +D ++PD  +   EGK+K PK    E++I    +  P++D+++ G K KGD DV+L K       P+VD+   K DI  P  D+Q  ++    P IK
Sbjct: 2982 DISLPKVEGDLKGP--EVDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVS----GPK----VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKIK 3154          

HSP 5 Score: 57.7658 bits (138), Expect = 2.477e-7
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI++PD  +   EGKLK PK    +++++AP I   D+D++ K PK + D++V  P V+ D    D+DI   +VDI+       +D   PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+   P VDVD+  PD+
Sbjct: 3840 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMQVPDLDIKGPKVDINAPD----VDVRGPDWHLKMP----KIKMPKISMPGFKGEGPEVDVNL----PKADLDVS--GPKVDVDV--PDV 3975          

HSP 6 Score: 57.3806 bits (137), Expect = 2.722e-7
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDW--KLPTFEGKVKKPKGEI-DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI++PD  +   EGKLK PK    +++++AP I   D+D++ K PK + D++V  P V+ D    D+DI   +VDI+       +D   PDW  K+P    K+K PK  +     EGPEVD+++    PK D DV+   P VDVD+  PD+
Sbjct: 3058 VDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPD----VDVQGPDWHLKMP----KIKMPKISMPGFKGEGPEVDVNL----PKADLDVS--GPKVDVDV--PDV 3193          

HSP 7 Score: 56.225 bits (134), Expect = 6.202e-7
Identity = 57/183 (31.15%), Postives = 97/183 (53.01%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEI-------DLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            +D+++PD  +   + KLK PK    +++++AP     D D+++ G K KG++       + ++K P VDI   K+DID  +++I+G + K    F  P +K+P     +K PK      +  P++D+++ G K KGD DV       +LK P VD+   K DI  P  D+Q  ++    P +K
Sbjct: 3638 VDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLPKVEGDLKGPEVDIKGPKVDIDTPDINIEGSEGK----FKGPKFKIPEMH--LKAPK------ISMPDIDLNLKGPKVKGDVDVSLPKMEGDLKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKVK 3808          

HSP 8 Score: 56.225 bits (134), Expect = 7.818e-7
Identity = 59/185 (31.89%), Postives = 94/185 (50.81%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV----------DVDINKPDIVYPIFDI 457
            ++I  PD  +   EG LK PK    D++++AP     DID+++ G K KG++D+       ++K P VDI   K+DI+  +VD+      HG D++L       P + +P F+G+     V  PK   DID+ GP VD+D+         DVN++ P+           +++I  P I  P FD+
Sbjct: 3510 MNIEGPDLNVEGPEGGLKGPKFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDINAPDVDV------HGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLPKA--DIDISGPNVDVDVP--------DVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDL 3678          

HSP 9 Score: 55.8398 bits (133), Expect = 9.201e-7
Identity = 58/176 (32.95%), Postives = 92/176 (52.27%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGP-----EVDIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKPVIK 493
            D  LPK EG LK P+ D+     D+  PD+DV   D H K PK ++          + P+VD+   K DID+     G K    +D ++PD  +   + K+K PK ++ +I+++ P     +VD+D+ G K KGDFDV++  P V+  +  P  D+  P  D +  + + S P +K
Sbjct: 4740 DVTLPKVEGDLKGPEADIKGPKVDINTPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKADIDVS----GPK----VDVDIPDVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSV--PKVEGTLKGPEVDLKGPRLDFEGPDAKLSGPSLK 4905          

HSP 10 Score: 55.4546 bits (132), Expect = 1.180e-6
Identity = 85/332 (25.60%), Postives = 140/332 (42.17%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAPDI---DVDIHGKKP--KGEIDLN-------VKNPNVDIDFHKMDIDI-EVDIDG-----KKKKHGL-DFNLPDWKLPTFEGKVKKPKGEIDI------------DVEGPEV----------------------DIDIHGKKPK--GDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSD 835
            +D+  PD  + + EGKLK PK    +++++ P I   DVD+H K P  KGE D+        +K P+V++   KMDID+ +V++ G     K  K  +  F++P +K    E  V  PK ++DI            ++EGPE                       D+D+H K PK  G++D+ + K   D+   K D+  P  ++Q  ++    P IK                      F +P    +  EF  ++      S+AN DIS     T     + P +++E P   +          H +    S+ +  L+ + P +K N D
Sbjct:  785 IDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTMPKVESEIKVPDVELKSAKMDIDVPDVEVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDISGPKVGVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTVPKLEGDLKGPKVDVSAPDVEMQGPDWNLKMPKIKMP-------------------KFSMPSLKGEGPEFDVNL------SKANVDISAPKVDT-----NAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVD 1086          

HSP 11 Score: 55.4546 bits (132), Expect = 1.200e-6
Identity = 61/213 (28.64%), Postives = 102/213 (47.89%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV----------DVDINKPDIVYPIFD-------IQSNFQFSKPVIKSHIEQPVSD 520
            +D+++PD  +   + KLK PK  +         +  PDID+++ G K KG++D+       ++K P  DI   K+DI+  +VD+      HG D++L       P + +P F+G+     V  PK   DIDV GP+VD+DI         DVN++ P+           +++I  P I  P  D       ++ +F  S P ++  ++ P  D
Sbjct: 4688 VDVDVPDVNIEGPDAKLKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTLPKVEGDLKGPEADIKGPKVDINTPDVDV------HGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKA--DIDVSGPKVDVDIP--------DVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSVPKVEGTLKGPEVD 4884          

HSP 12 Score: 55.0694 bits (131), Expect = 1.437e-6
Identity = 60/171 (35.09%), Postives = 90/171 (52.63%), Query Frame = 2
Query:    2 KKKHGLDINLP----DWKLPKF-----EGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            K K  +D++LP    D K P+      EGKLK PK    D+  ++P     DID+++ G K KG++D++V       K P VD+   K+ ID  ++DI G + K  G  F +PD  L       K PK      +  PEVD+++ G K KGD D++L  P V+ D+  P++
Sbjct: 4472 KVKGDVDVSLPKVESDLKGPEVDIEGPEGKLKGPKFKMPDVHFKSPQISMSDIDLNLKGPKIKGDMDISVPKLEGDLKGPKVDVKGPKVGIDTPDIDIHGPEGKLKGPKFKMPDLHL-------KAPK------ISMPEVDLNLKGPKVKGDMDISL--PKVEGDLKGPEV 4627          

HSP 13 Score: 55.0694 bits (131), Expect = 1.513e-6
Identity = 55/166 (33.13%), Postives = 84/166 (50.60%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI----------EVDIDG--------KKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG LK P+ D+     D++APD+DV   D H K PK ++          + P+VD++  K DID+          +V+I+G        K K   + F  P   +P  +  +  PK + D+DV GP+V+ D+ G       +V+LK P VD+D+  PD+
Sbjct: 2726 DVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADIDVSGPKVDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKVEGDLKGP------EVDLKGPKVDIDV--PDV 2883          

HSP 14 Score: 55.0694 bits (131), Expect = 1.539e-6
Identity = 64/200 (32.00%), Postives = 98/200 (49.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDG-----KKKKHGL-DFNLPDWKLPTFEGKVKKPKGEID-----IDVEGPEVDIDIHGKKPKG------------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            +D+  PD  +   EGK K PK  +         +  PDID+++ G K KG++D+       ++K P VD+   K+DID+ +V++ G     K  K  +  F++P +K    E  V  PK ++D     +DVEGP+V+I+    K KG                  DFD++LK P V  DVDI+ P    D+  P  DI+ 
Sbjct: 2802 VDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRG 3001          

HSP 15 Score: 55.0694 bits (131), Expect = 1.552e-6
Identity = 49/152 (32.24%), Postives = 86/152 (56.58%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEA-----PDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI+ PD  +   + KLK PK    +++++A     PDID ++ G K KG++D+++  P V+ D    +IDI        K   LD + PD  +   EGK+K PK ++ +++++ P++   D D+H K PK   DV++  P V+ D+  P++
Sbjct: 4352 VDIDAPDVSIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDFNLKGPKVKGDVDVSL--PKVEGDLKGPEIDI--------KGPSLDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVESDLKGPEV 4493          

HSP 16 Score: 54.6842 bits (130), Expect = 2.263e-6
Identity = 53/178 (29.78%), Postives = 94/178 (52.81%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK---GDLDVEAP-----DIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQSNFQFSK 481
            +D+++PD  +   + KLK PK    +++++AP     D+D+++ G K KGE+D+       ++K P +DI   K+D+D  ++DI      HG D  L   KL   +  V  PK      +  PE+D+++ G K KGD DV       ++K P++D+   + D+  P  +I+   + S+
Sbjct: 3186 VDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPALDIKGPKIDVDAPDIDI------HGPDAKLKGPKLKMPDMHVNMPK------ISMPEIDLNLKGSKLKGDVDVSGPKLEGDIKAPSLDIKGPEVDVSGPKLNIEGKSKKSR 3351          

HSP 17 Score: 54.6842 bits (130), Expect = 2.342e-6
Identity = 64/216 (29.63%), Postives = 100/216 (46.30%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNL-------PDWKLPTFEGK-----VKKPKGEIDI------------DVEGPEV----------------------DIDIH--GKKPKGDFDVN-------LKKPNVD-----VDINKPDI 436
            +D+ +PD  L   EGKLK PK  +         +  PD+D+++ G K KG++D++       +K P+VDI   K+DI   +VD+      HG D++L       P + +P F+G+     VK PK ++D+            ++EGP+                       D+ +H  G K KGD+DV        +K P+VD     VDIN PD+
Sbjct: 1290 VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEVEGEMKVPDVDIKGPKVDISAPDVDV------HGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLPKADVDVSGPKMDAEVPDVNIEGPDAKLKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVPKVEGEIKAPDVDIKGPKVDINAPDV 1499          

HSP 18 Score: 54.299 bits (129), Expect = 2.487e-6
Identity = 65/225 (28.89%), Postives = 101/225 (44.89%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKKHGL-DFNLPDWKLPTFEGKVKK-----PKGEIDID------------VEGPE------------------------VDIDIHGKKPKGDFDVNL-------KKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            +DI  PD  L   EGKLK PK  +         +  PD+D+ + G K KG++D++V       K P+V+I   KMDID  +V++ G      +    +P + +P F+G+ ++     PK +ID+             +EGPE                        VD+++ G K KGD DV+L       K P+VD+   K DI  P  D+   ++    P +K
Sbjct: 1162 VDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVSVPKVEGEMKVPDVEIKGPKMDIDAPDVEVQGPDWHLKMPKMKMPKFSMPGFKGEGREVDVNLPKADIDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEVEGEMKVPDVDIKGPKVDISAPDVDVHGPDWHLKMPKVK 1386          

HSP 19 Score: 54.299 bits (129), Expect = 2.926e-6
Identity = 60/165 (36.36%), Postives = 84/165 (50.91%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKK-HGLDFNL--PDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQS 463
            D  LPK EG LK P+ D+     D++APD+DV   D H K PK ++          + P+VD+   K DI+I   +VDID       G D  L  P +K+P     +K PK      +  P++D ++ G K KGD DV+L  P V+ D+  P  DI  P  DI +
Sbjct: 4276 DVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVTLPKADIEISGPKVDIDAPDVSIEGPDAKLKGPKFKMPEMN--IKAPK------ISMPDIDFNLKGPKVKGDVDVSL--PKVEGDLKGPEIDIKGPSLDIDT 4430          

HSP 20 Score: 53.5286 bits (127), Expect = 4.266e-6
Identity = 51/168 (30.36%), Postives = 85/168 (50.60%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVN-------LKKPNVD-----VDINKPDI 436
            +DI++PD  L   EGKLK PK  +         +  PD+ +++   K K ++D+       ++K P +D+   KMD+++ ++DI+G + K       P +K+P    K  K        +  P+VD+ + G K KGD DV+       +K P+VD     VDI+ PD+
Sbjct: 1546 VDIDVPDVNLEAPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLPKVEGDLKGPEIDVKAPKMDVNVGDIDIEGPEGK----LKGPKFKMPEMHFKAPK--------ISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKVDIDAPDV 1701          

HSP 21 Score: 53.5286 bits (127), Expect = 4.977e-6
Identity = 55/182 (30.22%), Postives = 93/182 (51.10%), Query Frame = 2
Query:   23 INLPDWKLPKFEGK-----LKKPKGDLDVEAPDIDV---DIHGKKPKGEI-DLNVKNPNVDIDFHKMDI-DIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDI-----DIHG-----KKPK---------------GDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            + +P + +P F+G+     +K PK D+DV  P +D+   D++ + P+G++     K P ++I   K+ + DI++++ G K K  +D +     LP  EG +K P    ++D++GP+VDI     D+HG     K PK                D DVNL K ++DV   K D+  P  +I+ 
Sbjct: 2641 VKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVS-----LPKVEGDLKGP----EVDIKGPKVDIDAPDVDVHGPDWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADIDVSGPKVDVECPDVNIEG 2813          

HSP 22 Score: 53.5286 bits (127), Expect = 5.194e-6
Identity = 62/185 (33.51%), Postives = 87/185 (47.03%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI-------------DLNVKNPNVDIDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDV-------NLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D  LPK EG LK P+ D+     D+ APD+ V   D H K PK ++             D +VK P  DID     +DIE   V+I+G + K       P +K+P     +K PK      +  P++D+++ G K KGD DV       +LK P VD+   K DI  P  D+   ++    P IK
Sbjct: 2598 DVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGK----LKGPKFKMPEMN--IKAPK------ISMPDIDLNLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKIK 2770          

HSP 23 Score: 53.1434 bits (126), Expect = 6.008e-6
Identity = 76/294 (25.85%), Postives = 132/294 (44.90%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDI-EVDIDG--------KKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVE---------GPEV-----DIDIHGKKPKGDF--------DVNLKKPNV---DVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP---VSDSDRNFNS-NLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP----DDPSINIEQPNSAI 727
            +D+ +PD  L   EGKLK PK  +         +  PD+D ++ G K KG++D++       +K P +D+   K+D D+ EV ++G        K K   + F  P   +P  +  +K PK + ++DV+         GP V     DIDI G  P+G          D++ K PN+   DVD+N   +  P   I+ +   S P ++  +E P   +     + N+ ++ +  + L  P  ++ +FS   +P   +     D++   +    S P    + P +NIE P   +
Sbjct: 2279 VDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAPKLEGELKGPELDVKGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPKISMPDLDLHLKSPKAKGEVDVDVPKLEGDLKGPHVDVSGPDIDIEG--PEGKLKGPKFKMPDMHFKAPNISMPDVDLN---LKGP--KIKGDVDVSVPEVEGKLEVPDMNIRGPKVDVNAPDVQAPDWHLKMPKMKMPKFS---MPGFKAEGPEVDVNLPKADVDISGPKVDIEGPDVNIEGPEGKL 2562          

HSP 24 Score: 53.1434 bits (126), Expect = 6.165e-6
Identity = 53/160 (33.12%), Postives = 84/160 (52.50%), Query Frame = 2
Query:   47 PKFEGKLKKPKGDL-----DVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGPEV---DIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDI 457
            PK EG LK P+ DL     D++ PD++V   D H K PK ++          + P VD++  K D+D+   +VD++G           PD  +   EGK+K PK ++ +++++ P++   D D+H K PK   DV++  P V+ D+  P  DI  P  DI
Sbjct: 2858 PKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEG-----------PDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRGPQVDI 3006          

HSP 25 Score: 52.7582 bits (125), Expect = 7.192e-6
Identity = 64/197 (32.49%), Postives = 96/197 (48.73%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGD-----LDVEAPDIDV---DIHGKKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI------DIDVEGPEVDIDIHGKKPKGDFDVNLKK-------PNVDVDINKPDIVYPIFDIQ-SNFQFSKPVIKSHIEQP-VSDSDRNFN 538
            D  +PK EG++K P  D     +D++APD+DV   D H K PK ++          + P VD++  K D    V + G K    +D  +PD  L   EGK+K PK ++         +  P+VD+ + G K KGD DV+L K       P+VDV++  PD+     D +    +F  P  + H + P +S  D N N
Sbjct: 2008 DVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKAD----VVVSGPK----VDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGPSVDVEV--PDVELECPDAKLKGPKFKMP--EMHFKTPKISMPDVNLN 2192          

HSP 26 Score: 52.7582 bits (125), Expect = 8.039e-6
Identity = 54/157 (34.39%), Postives = 78/157 (49.68%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNL--PDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +D N PD  L   EGKLK PK  +         +  PD+D+D+ G K KG +D++       ++ P+VDI   K+DI    D++G     GLD++L  P  K+P F            +  EGPEVD+++    PK D  V+  K    VDI  PD+
Sbjct: 1034 VDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDISAPKIEGEMQVPDVDIRGPKVDIKAP-DVEG----QGLDWSLKIPKMKMPKFS--------MPSLKGEGPEVDVNL----PKADVVVSGPK----VDIEAPDV 1169          

HSP 27 Score: 52.373 bits (124), Expect = 9.705e-6
Identity = 54/168 (32.14%), Postives = 84/168 (50.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDI-----DVDIHG-----KKPKGEI------DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI-DIDVEGP-----EVDIDIHGKKPKGDFDV-------NLKKPNVD-----VDINKPDI 436
            D   P  EG  K PK  +D++AP++     DVD+HG     K PK ++       L  + P+V +D  K DI+IE           ++   PD  +   EG +K PK ++ D++++ P     ++D+++ G K KGD D+       +LK P VD     VDIN PD+
Sbjct: 3434 DIAGPNLEGDFKGPK--VDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMPKFSVSGLKAEGPDVAVDLPKGDINIE--------GPSMNIEGPDLNVEGPEGGLKGPKFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDINAPDV 3591          
BLAST of SMED30000771 vs. UniProt/SwissProt
Match: sp|Q8IVF2|AHNK2_HUMAN (Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 3.354e-6
Identity = 40/142 (28.17%), Postives = 76/142 (53.52%), Query Frame = 2
Query:   29 LPDWKLPKF--EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEI---DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDINKP 430
            +P +K+P F      +  +  LDV AP ++ D+     +G++   DL+++ P+ D++   + +D+E+      +  GL  +LP  ++P+ +      KG   IDV+GP++D+    K PK +    DV +  P+V+VD+  P
Sbjct: 3475 MPKFKMPSFGVSAPGRSIEASLDVSAPKVEADVSLSSMQGDLKATDLSIQPPSADLEVQAVQVDVELLEGPVPEGAGLKGHLPKVEMPSLKTPKVDLKGP-QIDVKGPKLDL----KGPKAEVRVPDVEVSLPSVEVDVQAP 3611          
BLAST of SMED30000771 vs. TrEMBL
Match: A0A0K2VA86 (Neuroblast differentiationassociated protein AHNAKlike [Danio rerio] (Fragment) OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.961e-13
Identity = 66/172 (38.37%), Postives = 96/172 (55.81%), Query Frame = 2
Query:   14 GLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIH------GKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNL--PD----WKLPTFEGKVKKP-------KGEIDIDVEGPEVDI-------------DIHGKKPKGDFDVNLKKPNVDVDINKPD 433
            G D +L   K P F+  LKKP  D++++ PD D+ +       G K KG++D++V  P VD+   K ++DI+ D D K KK G D N   PD     K P F+ K+  P       KG++DIDV+GP+VD+             D+  KKP   FD+NLKKP++D+++ KPD
Sbjct: 1825 GADTDLK-MKKPDFDINLKKPNFDINMKKPDFDMKMSMPIFGFGNK-KGDLDVDVDTPEVDLKMKKPELDIDADADFKGKKPGFDINFKKPDIDLNMKKPDFDMKMSMPKFGYGKKKGDVDIDVDGPDVDLNMKKPGLDIDADADLKLKKP--GFDINLKKPDIDLNLKKPD 1992          

HSP 2 Score: 80.8777 bits (198), Expect = 4.319e-12
Identity = 73/188 (38.83%), Postives = 104/188 (55.32%), Query Frame = 2
Query:    5 KKHGLDINL-PDWK--LPKFEGKLKKPKGDLDVEAPDIDVDI------HGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNL--PD----WKLPTFEGKVKKPK----------------GEIDIDVEGPE----VDIDIHGKKPKGDFDVNLKKPNVDVDINKPD----IVYPIF 451
            KK  LDI+   D+K   P F+  LKKP  DL+++ PD D+ +      +G+K KG++D++V  P+VD++  K  +DI+ D D K KK G D NL  PD     K P F+ K+  PK                 ++DI+VE P+     D D+  KKP  DFD+NLKKPN D+++ KPD    +  PIF
Sbjct: 1680 KKLQLDIDADADFKGKKPGFDINLKKPDIDLNMKKPDFDMKMSMPKFGYGRK-KGDVDIDVDGPDVDLNMKKPGLDIDADTDLKMKKPGFDINLKKPDIDLNLKKPDFDMKMSMPKFGFGKKKGDLDVDVEVPDVDINVEKPDFSVGADTDLKMKKP--DFDINLKKPNFDINMKKPDFDMKMSMPIF 1864          

HSP 3 Score: 75.0998 bits (183), Expect = 2.535e-10
Identity = 74/191 (38.74%), Postives = 98/191 (51.31%), Query Frame = 2
Query:    5 KKHGLDINL--PDW----KLPKFEGKLKKPK-------GDLD--VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDID-------IEVDIDGKKKKHGLDFNL--PD----WKLPTFEGKVKKPK----------------GEIDIDVEGP----EVDIDIHGKKPKGDFDVNLKKPNVDVDINKPD 433
            KK G DI L  PD+    K P F+ K+ KPK       GD+D  V+APD+++D          DL +KNP  D +F K DID       +++D D K KK G D NL  PD     K P F+ K+  PK                 ++DI+VE P    + D D+  KKP  DFD+NLKKPN D+++ KPD
Sbjct: 1468 KKTGFDIGLKKPDFDIKMKKPDFDMKMSKPKFGFGQKKGDIDGEVDAPDLNLD---------ADLQIKNPGFDSNFEKPDIDLNMKKPGLDIDADLKMKKPGFDINLKKPDIDLNLKKPDFDMKMSMPKFGFGKKKGDLDVDVKVPDVDINVEKPNFSVDADADLKMKKP--DFDINLKKPNFDINMKKPD 1647          

HSP 4 Score: 65.0846 bits (157), Expect = 3.488e-7
Identity = 76/230 (33.04%), Postives = 115/230 (50.00%), Query Frame = 2
Query:    5 KKHGLDINL-PDWKL--PKFEGKLKKPKGDLDVEAPDIDVDIH------GKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLP------DWKLPTFEGKVKKP-------KGEIDIDVEGPEVDI-------------DIHGKKP-------KGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDL 568
            KK GLDI+   D K+  P F+  LKKP  DL+++ PD D+ +       GKK KG++D++V+ P+VDI+  K D  +  D D K KK   D NL       + K P F+ K+  P       KG++D+DV+ PEVD+             D  GKKP       K D D+N+KKP+ D+ ++ P   Y       +     P +  ++++P  D D + +  L    FD+
Sbjct: 1749 KKPGLDIDADTDLKMKKPGFDINLKKPDIDLNLKKPDFDMKMSMPKFGFGKK-KGDLDVDVEVPDVDINVEKPDFSVGADTDLKMKKPDFDINLKKPNFDINMKKPDFDMKMSMPIFGFGNKKGDLDVDVDTPEVDLKMKKPELDIDADADFKGKKPGFDINFKKPDIDLNMKKPDFDMKMSMPKFGYGKKKGDVDIDVDGPDVDLNMKKPGLDIDADADLKLKKPGFDI 1977          
BLAST of SMED30000771 vs. TrEMBL
Match: C3YDK3 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_84409 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.372e-12
Identity = 80/271 (29.52%), Postives = 133/271 (49.08%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFEGK--LKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLDFNLPDWKLPTFEGK--VKKPKGEI----------DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV-DVDINKPDIVYPIFDIQSNFQFSKPVIKS----------HIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFS-SSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSE 736
            K  G DI++P  K+PKF GK  +  P+G  ++E PD+D+D          D+ +K P+VD+D  ++D+D+E  D+ G + K    F  PD+ +P F GK  V  P+G++          D+++EGPEVD+D+ G   KG      K P +   DI+ P +  P F ++SN    +  ++           ++E P  D D     ++    F +P+   +  +FS  SI   KF  +A+ D+            + P +N+E P+  +D E
Sbjct: 2661 KFKGPDIHMPSVKMPKFGGKADIDLPEG--NIEGPDVDIDGP--------DVKLKGPDVDLDGPEVDLDLEGPDVKGGRFKM-PKFKGPDFSMPKFGGKAGVDLPEGKLEGPNVDIEGPDVNLEGPEVDVDLEGPDMKGG---KFKMPKIKGPDISMPSMKMPKFGMKSNIDLPEGEVRGPSVDIEGPDVNVEGPDVDVDLE-GPDVKGGKFKMPK--FKGPDFSMPSIGMPKFGGKADIDLPEGEVRGPSVDLEGPDVNVEGPDVDVDLE 2914          

HSP 2 Score: 68.5514 bits (166), Expect = 2.646e-8
Identity = 87/304 (28.62%), Postives = 129/304 (42.43%), Query Frame = 2
Query:   20 DINLPDWKL----PKFEG---------KLKKPKGDLDVEAPDIDVDIHGKK-----------------PKGEIDL---NVKNPNVDIDFHKMDIDIEV-DIDGKKKKH----GLDFNLPDWKLPTFEGKVKKPKGEIDI---DVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDI----QSNFQFSKPVIKSHIEQP----------VSDSDRNFNS----------NLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSE 736
            D  +PDW +    P+ EG         KLK P  D DV+ PDID  + G K                  K  ID+    V+ P+V+ID    D+DIE  D+ GKK K     G D ++P  K+P F GK      +ID+   ++EGP+VDID    K KG  DV+L  P VD+D+  PD+    F +      +F   K   K+ ++ P          +   D N             ++    F +P+         S  +P KF  ++N D+            + P +N+E P+  +D E
Sbjct: 2554 DAEIPDWDVNVEGPEVEGGLSGKFKSPKLKGP--DFDVDGPDIDGKVKGPKFHMPHLKMPKFKSPKFGGKANIDVPEGEVEGPDVNIDVDAPDVDIEGPDVKGKKWKRPKFKGPDIHMPSVKMPKFGGKA-----DIDLPEGNIEGPDVDIDGPDVKLKGP-DVDLDGPEVDLDLEGPDVKGGRFKMPKFKGPDFSMPKFGGKAGVDLPEGKLEGPNVDIEGPDVNLEGPEVDVDLEGPDMKGGKFKMPKIKGPDISMPSMKMP-KFGMKSNIDLPEGEVRGPSVDIEGPDVNVEGPDVDVDLE 2848          

HSP 3 Score: 68.5514 bits (166), Expect = 2.693e-8
Identity = 86/314 (27.39%), Postives = 143/314 (45.54%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFEGK--LKKPKGDLDVEAPDI-----DVDIHG---------------------------KKPK---------GEI---DLNVKNPNV-----DIDFHKMDIDIEV-DIDGKKKK---HGLDFNLPDWKLPTFEGKVKKPKGEIDI-DVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSP 778
            K  G D ++P  K+PKF GK  +  P+G+L  + PDI     DVD+ G                           +KPK          E+   D+N++ P+V     D++ H  D+D+E  D+ GK K     G  F+LP  K+P++       KG+ID+ DVEGP+VD ++ G       DV+++KP++DV++  PD+     D++       P +K   + P          N+   +F +P    ++ +F S     KF  +A+ D+        Q   + P IN++ P+  +D E  SP     +++ P
Sbjct: 3130 KIKGPDFHMPSMKMPKFGGKGEVDLPEGEL--KGPDIGVSGPDVDVQGPEMKGKIKGPKIKGPGFHLPHMKMPSFRKPKFGADVDLPEAEVEVPDVNLEGPDVDVTGPDVNLHGPDVDLEGPDVSGKIKGPKIKGPGFHLPHMKMPSWRKPKLGGKGKIDVPDVEGPDVDWELQGP------DVDVEKPDIDVNVGAPDV-----DVEG------PEMKGKFKGP----------NIKGPNFHMPH--WKMPKFKSP----KFGGKADIDLP-------QGEVEGPDINVKGPDVDVDME--SPEMKGGKFNLP 3399          

HSP 4 Score: 65.4698 bits (158), Expect = 2.413e-7
Identity = 75/287 (26.13%), Postives = 135/287 (47.04%), Query Frame = 2
Query:   23 INLPDWKLPKFEGKLKKPKGDL-DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKK---HGLDFNLPDWKLPTFE-----GK--VKKPKGEI---DIDVEGPEVDIDIHGKKPKGD-FDV-NLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKS----------HIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKF---SSRANFDISTSLSSTFQSIPDDPSINIEQPN---SAIDSEWISPVTCHNQYSSPSV 784
            + +P W+ PK  GK K    D+ DVE PD+D ++ G       D++V+ P++D++    D+D+E  ++ GK K     G +F++P WK+P F+     GK  +  P+GE+   DI+V+GP+VD+D+   + KG  F++   K P    D++ P +  P F  +++    +  +K           ++E P  D D     ++    F +P          S  +P KF     +A+ D+              PS+++E P+   +A D +   P     ++  P +
Sbjct: 3270 MKMPSWRKPKLGGKGKI---DVPDVEGPDVDWELQGP------DVDVEKPDIDVNVGAPDVDVEGPEMKGKFKGPNIKGPNFHMPHWKMPKFKSPKFGGKADIDLPQGEVEGPDINVKGPDVDVDMESPEMKGGKFNLPKFKGP----DVSMPSMKLPKFGGKADIDLPEGEVKGPNVDLEGPDVNVEGPDVDLDLE-GPDVKGGRFKMPSMKGPDISLPSMKMP-KFGMKGGKADLDLPEGEVQG-------PSVDLEGPDIDVNAPDMDIEGPEVKGGRFKMPKI 3534          

HSP 5 Score: 65.0846 bits (157), Expect = 4.014e-7
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKF---------EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKK---HGLDFNLPDWKLPTFEGK--VKKPKGEI----------DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNV-DVDINKPDIVYPIFDIQSNFQFSKPVIKS----------HIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFS-SSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSE 736
            K  G DI++P  K+PKF         EG+++ P   +D+E PD+               NV+ P+VD+D    D+       GK K     G DF++P   +P F GK  +  P+GE+          D++VEGP+VD+D+ G   KG      K P     D + P I  P F  +++    +  ++           ++E P  D D     ++    F +P+   +  +FS  SI   KF  +A+ D+            + P +N+E P+  +D E
Sbjct: 2795 KIKGPDISMPSMKMPKFGMKSNIDLPEGEVRGPS--VDIEGPDV---------------NVEGPDVDVDLEGPDVK-----GGKFKMPKFKGPDFSMPSIGMPKFGGKADIDLPEGEVRGPSVDLEGPDVNVEGPDVDVDLEGPDVKGG---KFKMPKFKGPDFSMPSIGMPKFGGKADIDLPEGEVRGPSVDLEGPDVNVEGPDVDVDLE-GPDVKGGKFKMPK--FKGPDFSMPSIGMPKFGGKADIDLPEGEVRGPSVDVEGPDVNVEGPDLDVDLE 3046          

HSP 6 Score: 61.6178 bits (148), Expect = 4.178e-6
Identity = 63/195 (32.31%), Postives = 85/195 (43.59%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLDVEAPDI-----DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGK--VKKPKGEI----------DIDVEGPEVDI---DIHG----KKPK------------GDFDVNLKKPNV---DVDINKPDIVYPIFDIQSNFQFSKP 484
             DI  P+WK+P F GK      D D+E PD+     DVD+ G  P  E  L +K P     F K D DI+             F  P WK+P+F GK  V  P  E+          D+D+EGP+VD+   D  G    K PK            G  DV+L    +   DV++  PD+  P  D++  F+   P
Sbjct: 2007 FDIKGPNWKMPSFGGKADVDLADADIEGPDVKLEGPDVDVEG--PDVEGGLKLKGPK----FGKPDFDIKAP----------KFKGPGWKMPSFGGKADVDLPDAEVEGPDVELEGPDVDLEGPDVDLESPDAKGGFKFKGPKFGKPKFKMPKFGGKADVDLPDAEIEGPDVNLETPDVEGP--DVKGGFKLKGP 2183          

HSP 7 Score: 60.8474 bits (146), Expect = 7.183e-6
Identity = 59/185 (31.89%), Postives = 93/185 (50.27%), Query Frame = 2
Query:   14 GLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNL--PDWKLPTFEGKVKKP--KGEIDID-----VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS----NFQFSKPVIKSHIEQPVSDSDR 529
            G DI++P  K+PKF GK      +  VE PD+DV           DLN K P+VDID    D+          K  G DF++  P+ K+P+F    +KP   G+ D+D     ++GPEVD+D   + P    DV++  P++   ++ P    P FD+ S    +F + +   K++I+ P ++  R
Sbjct: 3609 GPDIHMPSIKMPKFGGKADVDLPEGHVEGPDVDV-----------DLNAKGPDVDIDVEGPDVK-------GGKFKGPDFHIGKPNIKMPSF----RKPHFGGKADVDLPEGELKGPEVDVDASLEGP----DVDIDSPDLKGKMSSPKFKGPSFDMPSMKLPSFGWKQKGPKANIDLPEAEVQR 3767          
BLAST of SMED30000771 vs. TrEMBL
Match: A0A0K2TTI4 (Uncharacterized protein (Fragment) OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.371e-10
Identity = 64/167 (38.32%), Postives = 99/167 (59.28%), Query Frame = 2
Query:   38 WKLPKFEGKLKKPKGDLDVEAPDIDVDI------HGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEG--KVKKPKGEIDIDVEGPEV----DIDIHGKKPKGDFDVNLKKPNVDVDINKPD----IVYPIFDIQSN---FQFSK 481
             K P F+  LKKP  DL+++ PD+D+ +       GKK KG++D++V  P+VD++  K D+ I+VD D K KK G DF++P +     +G   V     ++DI+VE P++    D D+  KKP   FD+NLKKP+ D+++ KPD    +  P FD++ +   F F K
Sbjct:    7 MKKPGFDINLKKPDIDLNLKKPDLDMHMSMPKFGFGKK-KGDLDIDVDAPDVDVNLSKPDMSIDVDSDFKMKKPGFDFHMPKFGFGKKKGDLDVDVDVPDVDINVEKPDLSVDADADLKMKKPG--FDINLKKPDFDINMKKPDFDINMKKPDFDMKMSMPKFGFGK 170          
BLAST of SMED30000771 vs. TrEMBL
Match: V9K8N6 (Neuroblast differentiation-associated protein AHNAK-like protein (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.075e-10
Identity = 91/301 (30.23%), Postives = 122/301 (40.53%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFEGKLKKPK--GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGL-----DFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDIN----KPDIVYPIFDIQ-----------------SNFQFSKPVIKSHIEQPVSDSD--------RNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDD---PSINIEQPNSAIDSEWISPVTCHNQYSSPSVN 787
            K  G +INLP  K P  E   K PK  GD+DV  P+++  I G       DL        +D    D++IE  D  GK K  GL      F +P+  +P F+  +K P  +  +DV GP  DIDI G K      V++  P +DVD +    KP    P F  Q                 +N   S P IK  IE P  D D        + FN NL    F  P+      EFSS         + + DI  SL      I  D   P ++IE P+  ID E          ++ P ++
Sbjct:  182 KGKGFNINLPHIKAPNIEFSRKGPKLDGDVDVSLPEMEGGIAG-------DLK----GAKLDIEGPDVNIEGPDASGKVKGKGLKMPSLGFQMPNINVPGFDLNLKGPNMKGGVDVSGPGGDIDIKGPK------VDIDAPELDVDGSGKSWKPKFKLPSFGFQGPKVEGPDVDMDVNLPDANLDISGPKIKGGIEGPDVDMDLEGPHGKGKGFNINL--PHFKTPK-----IEFSSK------GQKLDGDIDVSLPEMEGGIKGDLKGPKLDIEAPD--IDGEGFDVKGKGKTFTMPGMD 450          
BLAST of SMED30000771 vs. TrEMBL
Match: A0A3P8STC0 (Uncharacterized protein OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.185e-10
Identity = 67/177 (37.85%), Postives = 98/177 (55.37%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGK---VKKPKGEI-----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQ-SNFQFSKPVIK 493
            +DI  PD  +    GK+K PK ++       +  PD+D ++ G K KG++D++V     DI   K+DI+  ++DI+G K      F +P +K+P+F G+   V+ P  ++     DIDV+ PE+DIDI G K KGD DV++  P V  DI  P  DI  P  DI+ S   F  P IK
Sbjct:  952 VDIKGPDIDIKSPSGKIKGPKFNMPTISGPKISMPDVDFNLKGPKLKGDVDMSVPTVEGDIKAPKLDIEGPDIDIEGAKG----GFKMPKFKMPSFGGEGPTVEGPDVDVSLPTADIDVKAPEMDIDIEGPKLKGDVDVSV--PAVQGDIKAPKLDIEGPDVDIEGSKGGFKMPKIK 1122          

HSP 2 Score: 67.0106 bits (162), Expect = 7.769e-8
Identity = 90/334 (26.95%), Postives = 148/334 (44.31%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD-----------------INKPDIVYPIFD-------IQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSI--PD----DPSINIEQPNSAIDS-EWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLE 904
            LDI  PD  +    GK+K PK ++       +  P++D ++ G K KG++D++V    VDI   K+DI+  ++DI+G K      F +P +K+P+F G  ++PK      VEGP+VD+++    P GD D+  K P+VD+D                 I+ P I  P  D       ++ +   S P ++  I+ P  D +   ++NL         P  ++  F       K       D+  SL +    I  P+     P I+I+ P+  I   ++  P     + S P V+    N + P LK + D       +S P ++  I    LE
Sbjct: 1154 LDIKGPDIDIKSPSGKIKGPKFNMPTISGPKISMPNVDFNLKGPKLKGDVDVSVPAVEVDIKAPKLDIERPDIDIEGAKG----GFKMPKFKMPSFGG--ERPK------VEGPDVDVNL----PTGDIDI--KAPDVDIDIESPRGKIKGPKFNMPTISGPKISMPGMDFNLKGPKLKGDVDMSVPTVEGDIKAPKLDIE-GPDANLEGGKGGFKMPKIKVPSFGV-----KGPKVEGPDVDVSLPTGDIDIKAPELDIKGPDIDIKSPSGKIKGPKFNMPTISGPKISMPDVD---FNLKGPKLKGDVD-------MSVPTVEGDIKAPKLE 1453          

HSP 3 Score: 64.6994 bits (156), Expect = 3.750e-7
Identity = 67/211 (31.75%), Postives = 100/211 (47.39%), Query Frame = 2
Query:   29 LPDWKLPKFEGK----------LKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGK----------VKKPKGEIDI-----DVEGPEVDI-----------------------------DIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQ---SNFQFSK 481
            +P +K+P F G+          +  P  D+DV+AP++D+DI G K KG++D++V     DI   K+DI+  +VDI+G K      F +P  K+P+F  K          V  P G+IDI     D++GP++DI                             ++ G K KGD DV++  P V+VDI  P  DI  P  DI+     F+  K
Sbjct: 1035 MPKFKMPSFGGEGPTVEGPDVDVSLPTADIDVKAPEMDIDIEGPKLKGDVDVSVPAVQGDIKAPKLDIEGPDVDIEGSKG----GFKMPKIKVPSFGVKGPKVEGPDVDVSLPTGDIDINAPELDIKGPDIDIKSPSGKIKGPKFNMPTISGPKISMPNVDFNLKGPKLKGDVDVSV--PAVEVDIKAPKLDIERPDIDIEGAKGGFKMPK 1239          
BLAST of SMED30000771 vs. Ensembl Cavefish
Match: ENSAMXT00000039323.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:37004879:37011933:-1 gene:ENSAMXG00000030707.1 transcript:ENSAMXT00000039323.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.563e-10
Identity = 65/210 (30.95%), Postives = 99/210 (47.14%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI--------EVDIDGKKKK-HGLDFNLPDWKLPTF-------EGK---VKKPKGEID-----IDVEGPEVDID------------------------IHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V       K P VDI+  ++DI+         E+DI+G + K  G  F +P  K+P+F       EG    V  PKG+ID     ID+EGPE+D++                        I G K KGD DV++ K   D+   K DI  P  D++ 
Sbjct:  234 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVPKIEGDIKAPKVDIEGPEIDIEGPEIDIEGPEIDIEGPEGKIKGPKFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGPEIDIEGPEIDVEGPEGGFKMPTISGPKISMPDVDFNIGGPKVKGDVDVSVPKIECDIKPPKVDIAGPEIDVEG 443          

HSP 2 Score: 63.1586 bits (152), Expect = 4.559e-10
Identity = 64/201 (31.84%), Postives = 101/201 (50.25%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNV-------KNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V       K P VDI+  ++DI+  E+D++G +      F +P  K+P+F    K PK      VEGP+VD+++    PKGD D  LK P +DV   + DI  P   I+   +F  P I S  +  + D D N     +    D+  P
Sbjct:  853 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVPKIEGDIKAPKVDIEGPEIDIEGPEIDVEGPEG----GFKMPKIKMPSF--GFKGPK------VEGPDVDVNL----PKGDLD--LKGPRIDVKSPEIDIEGPEGKIKGP-KFKMPTI-SGPKMSMPDVDLNLKGPKVKGGVDVSVP 1033          

HSP 3 Score: 62.3882 bits (150), Expect = 9.090e-10
Identity = 64/195 (32.82%), Postives = 96/195 (49.23%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKS-HIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V     DI   K+DI+  E+D++G +      F +P  K+P+F    K PK      VEGP+VDI++    PKGD D  LK P +DV   + DI  P   I+   +F  P I    I  P  D D N     +    D+  P
Sbjct:  734 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVPKIEGDIKAPKVDIEGPEIDVEGPEG----GFKMPKIKMPSF--GFKGPK------VEGPDVDINL----PKGDLD--LKGPRIDVKSPEIDIEGPEGKIKGP-KFKMPTISGPKISMP--DVDLNLKGPKVKGGVDMSVP 907          

HSP 4 Score: 60.4622 bits (145), Expect = 3.834e-9
Identity = 63/195 (32.31%), Postives = 96/195 (49.23%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKS-HIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V     DI   K+DI+  E+D++G +      F +P  K+P+F    K PK      VEGP+VD+++    PKGD D  LK P +DV   + DI  P   I+   +F  P I    I  P  D D N     +    D+  P
Sbjct:  979 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKMSMPDVDLNLKGPKVKGGVDVSVPKIEGDIKAPKVDIEGPEIDVEGPEG----GFKMPKIKMPSF--GFKGPK------VEGPDVDVNL----PKGDID--LKGPRIDVKSPEIDIEGPEGKIKGP-KFKMPTISGPKISMP--DVDLNLKGPKVKGGVDMSVP 1152          

HSP 5 Score: 56.9954 bits (136), Expect = 3.917e-8
Identity = 50/168 (29.76%), Postives = 89/168 (52.98%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGL-DFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFD-----VNLKKPNVDVDINK-----PDIVYPIFDIQSN 466
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V     DI   K+DI+  E+D++G +    +    +P  K+P+F    K PK      VEGP+VD+++    PKGD D     +++K P +D++  K     P+   P++ +Q +
Sbjct:  501 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVPKIEGDIKAPKVDIEGPEIDVEGPEGGFKMPKIKMPKIKMPSF--GFKGPK------VEGPDVDVNL----PKGDLDLKGPRIDVKSPEIDIEGQKEKSRVPNSKCPLYQVQRS 656          

HSP 6 Score: 56.6102 bits (135), Expect = 5.525e-8
Identity = 69/228 (30.26%), Postives = 102/228 (44.74%), Query Frame = 2
Query:   26 NLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL-----NVKNPNVDIDFHKMDI------------------DIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVDIDI----------HGKKPKG-DFDVNLKKPNVDVDINKPDIVYPIFDIQS------NFQFSKPVIKS-HIEQPVSDSDRNFNSNLLSKSFDLPQP 577
             +P  K+P F    K PK    VE PD+DV++    PKG+IDL     +VK+P +DI+  +  I                  D+++++ G K K G+D +     +P  EG +K PK E+   +IDVEGPE    +           G K +G D DVNL K ++D+   + D+  P  DI+         +F  P I    I  P  D D N     +    D+  P
Sbjct: 1061 KMPKIKMPSF--GFKGPK----VEGPDVDVNL----PKGDIDLKGPRIDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMS-----VPKVEGDIKAPKVEVEGPEIDVEGPEGGFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGPRIDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMP--DVDLNLKGPKVKGGVDMSVP 1271          

HSP 7 Score: 55.4546 bits (132), Expect = 1.147e-7
Identity = 58/187 (31.02%), Postives = 87/187 (46.52%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGD-----LDVEAPDID-----VDIHGKKPKGEIDL-------------NVKNPNVDIDFHKMDIDI----------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D  +PK EG +K PK D     +D+E P+ID     +D+ G  P+G   +              V+ P+VD++  K DID+          E+DI+G + K       P +K+PT  G    PK      +  P+VD+++ G K KG  DV++ K   D+   K DI  P  D++     F  P IK
Sbjct:   30 DMSIPKIEGDIKAPKVDIEGPEIDIEGPEIDIEGPEIDVEG--PEGGFKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDIDLKGPKIDVKTPEIDIEGPEGK----IKGPKFKMPTISG----PK------ISMPDVDLNLKGPKVKGGVDVSVPKIEGDIKAPKVDIEGPEIDVEGPEGGFKMPKIK 200          

HSP 8 Score: 55.0694 bits (131), Expect = 1.459e-7
Identity = 68/214 (31.78%), Postives = 98/214 (45.79%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKG----------------EIDLNVKNP----NVDIDFHKMDIDI----------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP--DIVYPIFDIQSNFQFSKPVIKS-HIEQPVSDSDRNFNSNLLSKSFDLPQP 577
            D  LPK +  LK PK  +DV+ P+ID++    K KG                ++DLN+K P     VD+   K++ DI          E+D++G +      F +P  K+P+F    K PK      VEGP+VD+++    PKGD D  LK P +D+D+  P  DI  P   I+   +F  P I    I  P  D D N     +    D+  P
Sbjct:   98 DVNLPKGDIDLKGPK--IDVKTPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDVSVPKIEGDIKAPKVDIEGPEIDVEGPEG----GFKMPKIKMPSF--GFKGPK------VEGPDVDVNL----PKGDID--LKGPKIDIDVKSPEIDIEGPEGKIKGP-KFKMPTISGPKISMP--DVDLNLKGPKVKGGVDMSVP 288          

HSP 9 Score: 53.9138 bits (128), Expect = 3.329e-7
Identity = 58/198 (29.29%), Postives = 92/198 (46.46%), Query Frame = 2
Query:   26 NLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL-----NVKNPNVDIDFHKMDI------------------DIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDID----------------------IHGKKPKG-DFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSK 481
             +P  K+P F    K PK    VE PD+DV++    PKG+IDL     +VK+P +DI+  +  I                  D+++++ G K K G+D ++P       EG +K PK    +D+EGPE+D++                        G K +G D DVNL K ++D+   + D+  P  DI+   + S+
Sbjct:  464 KMPKIKMPSF--GFKGPK----VEGPDVDVNL----PKGDIDLKGPRIDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVP-----KIEGDIKAPK----VDIEGPEIDVEGPEGGFKMPKIKMPKIKMPSFGFKGPKVEGPDVDVNLPKGDLDLKGPRIDVKSPEIDIEGQKEKSR 642          

HSP 10 Score: 53.5286 bits (127), Expect = 4.345e-7
Identity = 52/168 (30.95%), Postives = 87/168 (51.79%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDIN------KPDIVYPIFDIQS---NFQ 472
            +D+  P+  +   EGK+K PK  +       +  PD+D+++ G K KG +D++V     DI   K+DI+  E++++G +        +P  K+P+F   +K PK      VEGP+VDI++    PKGD D+ +    +  DI+      + DI  P  DI+    NF+
Sbjct: 1217 IDVKSPEIDIEGPEGKIKGPKFKMPTISGPKISMPDVDLNLKGPKVKGGVDMSVPKIEGDIKAPKVDIEGPEINVEGPEG----GLKMPKIKMPSF--GLKGPK------VEGPDVDINL----PKGDIDIKVPGSKLKGDIDLSASNIEGDIKTPKVDIEGPGVNFE 1368          
BLAST of SMED30000771 vs. Ensembl Cavefish
Match: ENSAMXT00000011221.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:12572741:12578865:1 gene:ENSAMXG00000010932.2 transcript:ENSAMXT00000011221.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 7.241e-7
Identity = 61/210 (29.05%), Postives = 91/210 (43.33%), Query Frame = 2
Query:   23 INLPDWKLPKFEGKLKKP-----------KG-DLDVEAPDIDV---DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVD---------------IDIHG---KKPKGDFDVNLKKPNVDV-----DINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSD 526
            ++ P  K PK  G L+ P           KG DLD++APD++V   D+ G         ++  P VD+D  K D+        K     L+ N PD KL   +  +  PKG I   D+D+  P+VD               I++ G   K PK D   +L  P+VDV     DI  P++     +I++     S P I+ ++  P  D D
Sbjct:  754 LSAPRVKGPKVSGNLQTPDANVNLPSAELKGPDLDLKAPDLNVSTPDMKG---------SISAPAVDVDLAKADL--------KAPGLNLEANTPDLKLSAPDVDLSLPKGSIEVPDVDLNVPDVDVPSAKLKTPNLKFPKINLAGPKVKGPKVDVGADLNAPDVDVNLPSADIRGPNLTSKHLNIKAPEMDLSVPKIEGYVAAPAVDLD 946          
BLAST of SMED30000771 vs. Ensembl Cavefish
Match: ENSAMXT00000036931.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:37013574:37019944:-1 gene:ENSAMXG00000030906.1 transcript:ENSAMXT00000036931.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 9.346e-7
Identity = 55/160 (34.38%), Postives = 79/160 (49.38%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGE----IDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            D  LPK E  +K P   +D++AP++D++    K KG     +D+ +    VDI    +DI   EVDI+G   K  G  F +P  K+P+  G    PK      +  P+VD ++ G K KG  DV++ K   D+   K DI  P  DI+     F  P IK
Sbjct:  200 DVNLPKAEVDIKGPA--IDIKAPEVDIEGPDGKVKGPKFKIVDVRISKAEVDIKGPAIDIKAPEVDIEGPDGKVKGPKFKMPKIKMPSISG----PK------ISMPDVDFNLKGPKVKGGVDVSVPKIEGDIKAPKVDIEGPEVDIEGPEGGFKMPKIK 347          

HSP 2 Score: 51.2174 bits (121), Expect = 2.099e-6
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            K K G+D+++P     K EG +K PK  +D+E P++D++     P+G   +              V+ P+VD++  K ++DI        K   +D   P+  +   +GKVK PK ++       +  P+VD ++ G K KG  DV++ K   D+   K DI  P  DI+     F  P IK
Sbjct:  304 KVKGGVDVSVP-----KIEGDIKAPK--VDIEGPEVDIE----GPEGGFKMPKIKMPSFGFKGPKVEGPDVDVNLPKAEVDI--------KGPAIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVPKIEGDLKAPKVDIEGPEVDIEGPEGGFKMPKIK 466          

HSP 3 Score: 51.2174 bits (121), Expect = 2.409e-6
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            K K G+D+++P     K EG LK PK  +D+E P++D++     P+G   +              V+ P++D++  K ++DI        K   +D   P+  +   +GKVK PK ++       +  P+VD ++ G K KG  DV++ K   D+   K DI  P  DI+     F  P IK
Sbjct:  423 KVKGGVDVSVP-----KIEGDLKAPK--VDIEGPEVDIE----GPEGGFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDI--------KGPAIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVPKIEGDLKAPKVDIEGPEVDIEGPEGGFKMPKIK 585          

HSP 4 Score: 51.2174 bits (121), Expect = 2.409e-6
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK 493
            K K G+D+++P     K EG LK PK  +D+E P++D++     P+G   +              V+ P++D++  K ++DI        K   +D   P+  +   +GKVK PK ++       +  P+VD ++ G K KG  DV++ K   D+   K DI  P  DI+     F  P IK
Sbjct:  542 KVKGGVDVSVP-----KIEGDLKAPK--VDIEGPEVDIE----GPEGGFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDI--------KGPAIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVPKIEGDLKAPKVDIEGPEVDIEGPEGGFKMPKIK 704          

HSP 5 Score: 50.0618 bits (118), Expect = 5.224e-6
Identity = 51/180 (28.33%), Postives = 86/180 (47.78%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDI---QSNFQFSK 481
            K K G+D+++P     K EG +K PK  +D+E P++D++     P+G   +              V+ P++D++  K ++DI        K   +D   P+  +   +GKVK PK ++       +  P+VD ++ G K KG  DV++ K   D+   K DI  P  DI   +  F+  K
Sbjct:  919 KVKGGVDVSVP-----KIEGDIKAPK--VDIEGPEVDIE----GPEGGFKMPKIKMPSFGFKGPKVEGPDMDVNLPKAEVDI--------KGPAIDIKAPEVDIEGPDGKVKGPKFKMPSISGPKISMPDVDFNLKGPKVKGGVDVSVPKIEGDIKAPKVDIEGPEVDIEGPEGGFKMPK 1079          
BLAST of SMED30000771 vs. Ensembl Cavefish
Match: ENSAMXT00000011223.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:12573889:12578865:1 gene:ENSAMXG00000010932.2 transcript:ENSAMXT00000011223.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 9.782e-7
Identity = 61/210 (29.05%), Postives = 91/210 (43.33%), Query Frame = 2
Query:   23 INLPDWKLPKFEGKLKKP-----------KG-DLDVEAPDIDV---DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI---DIDVEGPEVD---------------IDIHG---KKPKGDFDVNLKKPNVDV-----DINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSD 526
            ++ P  K PK  G L+ P           KG DLD++APD++V   D+ G         ++  P VD+D  K D+        K     L+ N PD KL   +  +  PKG I   D+D+  P+VD               I++ G   K PK D   +L  P+VDV     DI  P++     +I++     S P I+ ++  P  D D
Sbjct:  753 LSAPRVKGPKVSGNLQTPDANVNLPSAELKGPDLDLKAPDLNVSTPDMKG---------SISAPAVDVDLAKADL--------KAPGLNLEANTPDLKLSAPDVDLSLPKGSIEVPDVDLNVPDVDVPSAKLKTPNLKFPKINLAGPKVKGPKVDVGADLNAPDVDVNLPSADIRGPNLTSKHLNIKAPEMDLSVPKIEGYVAAPAVDLD 945          
BLAST of SMED30000771 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002063.1 (pep scaffold:Pmarinus_7.0:GL491826:26:5749:-1 gene:ENSPMAG00000001868.1 transcript:ENSPMAT00000002063.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 3.023e-12
Identity = 98/385 (25.45%), Postives = 167/385 (43.38%), Query Frame = 2
Query:   26 NLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKS---HIEQP-VSDSDRNFNSNLLSKSFDLPQPISQITEFSSSI---IPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYD-----NSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLP-------------RTPLSSSHTPDINHYMFGNRSPNLFHSD 1084
            N+PD K+P F   + K+  P GD DV  PD D++I G K  G I    K P ++ D    DID++    G K K    FN+PD K+P+F   + K+  P G+ D+++  P+ D++I G K  G     +K P  + D++ PDI     D++    +F+ P +K     + +P +S  D +F+ NL     ++  P  ++   +  I    PD    +  F +   +S    + PD   ++++ P    D   IS      ++S+P+++ +  + + P L  + D  D          + P LK      +  K    D + D+N   A  ++   K    I  P             + P    + PD+    FG   P +   D
Sbjct:  124 NMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KAPKLNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGG----GIKAPKFNADLDAPDI-----DLKGPKGKFNMPDLKMPSFGMSKPNISGPDGDFDVNLPDADLNISGP--KLGGDAPDIDLHGPDLKLKKPTFSM-PKMSGPKLNAPDL-DVDLKAPKGDFD---ISAPNIGGKFSAPNIDLDGPDLKAPKLNADLDVPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKAPKFNADLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPD 478          

HSP 2 Score: 67.3958 bits (163), Expect = 4.129e-12
Identity = 99/401 (24.69%), Postives = 164/401 (40.90%), Query Frame = 2
Query:   26 NLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGD-----FDVNLKKPNVDV-----DINKPDIVYPIFDIQ-----------------SNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPIS-------QITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP----DDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLP----RTPLSSSHTPDINHYMFGNRSPNLFHSD 1084
            N+PD K+P F   + K+  P GD DV  PD D++I G K  G I    K P  + D    DID++    G K K    FN+PD K+P+F   + K+  P G+ D+++  P+ D++I G K  G       + +L  P++D+       N PD+  P F +                  ++   S P +   I+ P       FN++L +   DL  P         ++  F  S  P+      +FD++   +    S P    D P I++  P    D +   P     + S P +N   L+ +   LK     +D    +S P +    S  N++    +D            D+ + K + ++ +P    + P    + PD+    FG   P +   D
Sbjct:   57 NMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KAPKFNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKAPKLNADLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKAP------KFNADLDAPDIDLKGPKGKFNMPDLKMPSFGMS-KPNISGPDGDFDVNLPDADLNISGPKLGGDAPDIDLHGP----DLKLKKPTFSMPKMSGPKLNAPDLDVD---LKAPKGDFD----ISAPNIGGKFSAPNID----LDGP----------DLKAPKLNADLDVPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPD 411          

HSP 3 Score: 66.6254 bits (161), Expect = 7.766e-12
Identity = 100/394 (25.38%), Postives = 170/394 (43.15%), Query Frame = 2
Query:   11 HGLDINL--PDWKLPKFEGK----------LKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDI-------DVEGPEVDI---DIHGKKPKGDFDV-NLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSD-SDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYD-----NSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLP----RTPLSSSHTPDINHYMFGNRSPNLFHSD 1084
             G DINL  P + +PK  G           LK PKGD+D+ AP+I   I G             PN+D+D   +D   ++D+ G K K    FN+PD K+P+F   + K+  P G+ D+       ++ GP++D+   DI  K PKG F++ +LK P+    ++KP+I  P     ++   S P +   I++P  D    N   N+ +   DL  P  ++ + + S+                +S    + PD   ++++ P    D   IS      ++S+P+++ +  + + P L  + D+ D          + P LK      +  K    D + D+N   A  D+  S    ++  P    + P    + PD+    FG   P +   D
Sbjct:  851 EGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDIDISAPNIGGKISG-------------PNIDLDAPDLDA-PDIDLKGPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLDLDAPDIDLKGPKGKFNMPDLKMPS--FGMSKPNISGP---DDADLNISGPKLGGGIKKPKVDLKAPNIGLNVDAPDIDLHGPDLKLKKPTFSM--------------PKMSGPKLNAPDL-DVDLKAPKGDFD---ISAPNIGGKFSAPNIDLDGPDLKAPKLNADLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDA--DLNISGPKLDLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPD 1201          

HSP 4 Score: 66.2402 bits (160), Expect = 1.156e-11
Identity = 64/202 (31.68%), Postives = 97/202 (48.02%), Query Frame = 2
Query:   26 NLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGD-----FDVNLKKPNVDV-----DINKPDIVYPIFDIQSNFQFSKPVIK---SHIEQPVSDSDRNFNSNLLSKSFDLPQ 574
            N+PD K+P F   + K+  P GD DV  PD D++I G K  G I    K P  + D    DID++    G K K    FN+PD K+P+F   + K+  P G+ D+++  P+ D++I G K  G      F+ +L  P++D+       N PD+  P      +F  SKP I       +  + D+D N +   L      P+
Sbjct:  458 NMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KAPKFNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKAPKFNADLDAPDIDLKGPKGKFNMPDLKMP------SFGMSKPKISGPDGDFDVNLPDADLNIDGPKLGGGIKAPK 639          

HSP 5 Score: 65.4698 bits (158), Expect = 1.663e-11
Identity = 77/256 (30.08%), Postives = 121/256 (47.27%), Query Frame = 2
Query:   26 NLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI-------VYPIFDIQ-SNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANF-DISTSLSSTFQSIPD--DPSINIEQPN-SAIDSEW 739
            N+PD K+P F   + K+  P GD DV  PD D++I G K  G I    K P  + D    DID++    G K K    FN+PD K+P+F   + K+  P G+ D+++  P+ D++I G K  G     +K P  + D++ PDI        + + D++  +F  SKP I        S  D +F+ NL     ++  P     +    I   KF++  +  DI         ++PD   PS  + +PN S  D ++
Sbjct:  592 NMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNIDGPKLGGGI----KAPKFNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGG----GIKGPKFNADVDAPDIDLKGPKGKFNVPDLKMPSFGMSKPKI--------SGPDGDFDVNLPDADLNISGP-----KLGGGIKAPKFNADLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPNISGPDGDF 816          

HSP 6 Score: 63.929 bits (154), Expect = 5.821e-11
Identity = 71/230 (30.87%), Postives = 103/230 (44.78%), Query Frame = 2
Query:   26 NLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEI-----------------DLNVKN---------------PNVDIDFH--KMDIDI----------EVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGD-----FDVNLKKPNVDV-----DINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNF 535
            N+PD K+P F   + K+  P GD DV  PD D++I G K  G I                 D+N+K                PN+D+D    K DIDI          ++D+ G K K    FN+PD K+P+F   + K+  P G+ D+++  P+ D++I G K  G      F+ NL  P++D+       N PD+  P      +F  SKP    +I  P  D D N 
Sbjct: 1181 NMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKTPKVDLKAPNIDLEGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDIDISAPNIDLDAPDIDLKGPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKAPKFNANLDAPDIDLKGPKGKFNMPDLKMP------SFGMSKP----NISGPDGDFDVNL 1394          

HSP 7 Score: 60.8474 bits (146), Expect = 5.301e-10
Identity = 72/259 (27.80%), Postives = 115/259 (44.40%), Query Frame = 2
Query:   17 LDINLPDWKL----PKFEG------------KLKKPKGDL------DVEAPDIDVDIHGKKPKGEIDLNVKN-------PNVDIDFHKM-------DIDI-EVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGD-----FDVNLKKPNVDV-----DINKPDIVYPIFDIQ-----------------SNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQIT 592
             D+NLPD  L    PK  G            KLKKP   +       + APD+DVD+  K PKG+ D++  N       PN+D+D   +       D+D+ ++D+ G K K    FN+PD K+P+F   + K+  P G+ D+++  P+ D++I G K  G      F+ +L  P++D+       N PD+  P F +                  ++   S P +   I+ P       FN++L +   DL  P  +  
Sbjct:  281 FDVNLPDADLNISGPKLGGDAPDIDLHGPDLKLKKPTFSMPKMSGPKLNAPDLDVDL--KAPKGDFDISAPNIGGKFSAPNIDLDGPDLKAPKLNADLDVPDIDLKGPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNL--PDADLNISGPKLGGGIKAPKFNADLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKAP------KFNADLDAPDIDLKGPKGKFN 525          

HSP 8 Score: 58.9214 bits (141), Expect = 2.255e-9
Identity = 65/222 (29.28%), Postives = 96/222 (43.24%), Query Frame = 2
Query:   26 NLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGL-DFNLPDWKLPTFEGKVKKPKGEIDI-----DVEGPEVDIDIHGKKPKG-------------------DFDVNLKKPNVDVDINKPDIVYPIFDIQS--------NFQFSKPVIK---SHIEQPVSDSDRNFNSNLLSKSFDLPQ 574
            N+PD K+P F   +  +  P GD DV  PD D++I G K  G I    K P VD+    +D+D   DI+ KK K  +   + P    P  +  +K PKG+I        + GP +D+D  G   KG                   D D NLK P ++ D+  PDI     D++         +F  SKP I       +  + D+D N +   +    D+P+
Sbjct: 1367 NMPDLKMPSFGMSKPNISGPDGDFDVNLPDADLNISGPKLGGGI----KTPKVDLKAPNIDLD-GPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDISAPNIGGKISGPNIDLDAPGGDIKGPHLKMPKFNMSGPKLSGPDDIDANLKAPKLNADLEAPDI-----DVKGPKGKFHMPSFGISKPKISGPDGDFDVNLPDADLNLSGPKIGGRVDMPK 1578          

HSP 9 Score: 58.9214 bits (141), Expect = 2.314e-9
Identity = 70/253 (27.67%), Postives = 110/253 (43.48%), Query Frame = 2
Query:   11 HGLDINL--PDWKLPKFEGK----------LKKPKGDLDVEAPDIDV---DIHGKKPKGEIDL-------------NVKNPNVDIDFHKMDIDI-----------------------EVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDINKPDIVYPIFDIQ--SNFQFSKPVIKSHIEQPVSD-SDRNFNSNLLSKSFDLPQPISQI 589
             G DINL  P + +PK  G           LK PKGD+D+ AP+ID+   DI  K PKG+ ++              +  P+ D D +  D D+                       ++D+ G K K    FN+PD K+P+F   +  +  P G+ D+++  P+ D++I G K  G      V+LK PN+D+D    ++  P F +   S  +   P +   ++ P  D S  N    +   + DL  P   I
Sbjct: 1239 EGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDIDISAPNIDLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKAPKFNANLDAPDIDLKGPKGK----FNMPDLKMPSFGMSKPNISGPDGDFDVNL--PDADLNISGPKLGGGIKTPKVDLKAPNIDLDGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDISAPNIGGKISGPNIDLDAPGGDI 1485          

HSP 10 Score: 56.6102 bits (135), Expect = 9.997e-9
Identity = 59/188 (31.38%), Postives = 85/188 (45.21%), Query Frame = 2
Query:   26 NLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDID-------VEGPEV----------------DIDIHGKK----------------------PKGDFDVNLKKPNVDVDINKPDI 436
            N+PD K+P F   + K+  P GD DV  PD D++I G K  G I    K P  + D    DID++    G K K    FN+PD K+P+F   + K+  P G+ D++       + GP++                DID+ G K                      P GDFDVNL  P+ D++I+ P +
Sbjct:  659 NMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGI----KGPKFNADVDAPDIDLK----GPKGK----FNVPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKAPKFNADLDAPDIDLKGPKGKFNMPDLKMPSFGMSKPNISGPDGDFDVNL--PDADLNISGPKL 832          
BLAST of SMED30000771 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004925.1 (pep scaffold:Pmarinus_7.0:GL480373:16762:23670:1 gene:ENSPMAG00000004465.1 transcript:ENSPMAT00000004925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.853e-11
Identity = 79/271 (29.15%), Postives = 119/271 (43.91%), Query Frame = 2
Query:   14 GLDINLPDWKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVD---------------INKPDIVYPIFDI---QSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSR-ANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWI 742
            G +I  P  K+PKF   + KL  P GD DV  PD D++I G K  G I     N N+D          ++D+ G K K    FN+PD K+P+F   +  +  P G+ D+++  P+ D++I G K  G      V+LK PN+D+D               I+ P +  P  D+         S P I   I  P  D D     +L +   D+  P  +    S  I   K S    +FD++   +    S P    +NI+ PN +++   I
Sbjct:  838 GGNIKGPHLKMPKFNISKPKLSGPDGDFDVNLPDADLNISGPKLGGGIKAPKFNANLDAP--------DIDLKGPKGK----FNMPDLKMPSFGMSKPNISGPDGDFDVNL--PDADLNISGPKLGGGIKTPKVDLKAPNIDLDGPDINLKKPKFSMPKISGPKLHAPNLDVDLKAPKGDISAPNIGGKISGPNIDLDA---PDLEAPDIDVKGPKGKFHMPSFGISKPKISGPDGDFDVNLPDADLNLSGPK--KVNIDSPNLSLEGPDI 1089          

HSP 2 Score: 63.929 bits (154), Expect = 5.943e-11
Identity = 66/204 (32.35%), Postives = 99/204 (48.53%), Query Frame = 2
Query:   11 HGLDINL--PDWKLPKFEGK----------LKKPKGDLDVEAPDIDVDIHGKKPKGEIDL---NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---EGKVKKPKGEIDI-------DVEGPEVDI---DIHGKKPKGDFDV-NLKKPNVDVDINKPDIVYPIFDIQSN-----FQFSKPVIKSHIEQPVSD 520
            HG D+ L  P + +PK  G           LK PKGD D+ AP+I  ++ G      IDL   ++K P ++ D    DID++    G K K    FN+PD K+P+F   + K+  P G+ D+       ++ GP++D+   DI  K PKG F++ +LK P+    ++KP I  P  D   N        S P +   I+ P  D
Sbjct:  581 HGPDLKLKKPTFSMPKMSGPKLNAPDLDVDLKAPKGDFDISAPNIGGNVSGP----NIDLDGPDLKAPKLNADLDAPDIDLK----GPKGK----FNMPDLKMPSFGMSKPKISGPDGDFDVNLPDADLNISGPKLDLDAPDIDLKGPKGKFNMPDLKMPS--FGMSKPKISGPDGDFDVNLPDADLNISGPKLGGGIKTPKVD 770          

HSP 3 Score: 60.8474 bits (146), Expect = 5.693e-10
Identity = 64/199 (32.16%), Postives = 99/199 (49.75%), Query Frame = 2
Query:   17 LDINLPDWK----LP--KFEGKLKKPKG---DLDVEAPDID-----------------VDIHGKKPKG-EIDLNVKNPNVDIDFHKMDIDIEV---DIDGKKKKHGLDFNLPDWKLPTFEGKVKKPK------GEIDIDVEGPEVDIDIHGKKPKGDFDVN-------LKKPNVDVD-----INKPDIVYPIFDIQSNF 469
            +D+N P+ K    +P    EG LK PK    D+++E+P+ID                 V   G K K    DL++ NPN+D+    M  +I++   ++D K    GLD N PD+ +   + K+KKPK      G     + GP+ D+D+  K PKG+FDV+       L  PN+D+D     I  P++  P F++ +NF
Sbjct: 1115 VDLNTPNIKGAASIPDVNIEGGLKTPKTPALDINMESPNIDITGPHGTLKKSKFKFPKVGFSGSKAKAPTADLDMPNPNLDMKMPNMKGNIDLKSPNVDFKAPDIGLDANAPDFDIQGPDLKLKKPKISMPKFGISGPKLHGPDFDVDL--KAPKGNFDVSTPKIGGKLSGPNLDLDGPEAGIKGPNLKMPTFNVNANF 1311          

HSP 4 Score: 55.4546 bits (132), Expect = 2.446e-8
Identity = 69/233 (29.61%), Postives = 101/233 (43.35%), Query Frame = 2
Query:   38 WKLPKF---EGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDI---DGKKKKHGLDFNLPDWKL-------PTFEGKVKKPKGEIDIDV-------EGPEVDIDIHGKKPKGDF----------------DVNLKKPNVDVDINKPDIVYPIFDIQS--------NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITE 595
             K+PKF   + KL  P+GD DV  PD ++DI      G+I    K+P VD+   KM +D+   ++DI   D K KK    F++P + +       P  +  +K PKG++DI          GP +D+D  G   KG                  D NLK P ++ D+  PDI     D++         +F  SKP I        S  D +F+ NL     +L  P   + E
Sbjct:  234 LKMPKFSMSKPKLSGPEGDFDVNLPDANLDISSPNFGGKI----KSPKVDLKAPKMGLDVDAPDIDIHSPDAKFKKS--KFSMPKFGMSGPKIHGPNVDVDLKAPKGDLDISAPNIGGNFSGPNIDLDGPGGSIKGPHLKMPKFNVAGPKLSGPDANLKAPKMNADLEAPDI-----DVKGPKGKFHMPSFGLSKPKI--------SGPDGDFDVNLPDADLNLSGPKLDVDE 447          

HSP 5 Score: 54.6842 bits (130), Expect = 4.503e-8
Identity = 109/438 (24.89%), Postives = 174/438 (39.73%), Query Frame = 2
Query:   14 GLDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKK---------------HGLDFNLPDWKL----PTFEGKVKKPK-----GEIDIDVEGPEVDI----------------------DIHG-------KKPKGDFDV-------NLKKPNVDVD-----INKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSR-ANFDISTSLSSTFQSIP----DDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSD 1084
            GLDI+ P+  +   E KLKKPK  +         V  PD+DVD+  K PKG ++L+   P V       D D+   E  I G K K                  D NLPD  L    P F GK+K PK      ++ +DV+ P++DI                       IHG       K PKGD D+       N   PN+D+D     I  P +  P F++ +  + S P   ++++ P        N++L +   D+  P  +    S  +   K S    +FD++   +    S P    D+P+I++  P    D +   P     + S P ++   L+ +   LK     +D    +S P +  ++S  N++  D  +   D++             + +I L + P    + PD+    FG   P +   D
Sbjct:  154 GLDIDAPNIDVNAPEAKLKKPKLTMPKFSLSGSKVHGPDVDVDL--KSPKGNVNLSA--PKVGGKVSGPDFDLDGPEGSIKGTKLKMPKFSMSKPKLSGPEGDFDVNLPDANLDISSPNFGGKIKSPKVDLKAPKMGLDVDAPDIDIHSPDAKFKKSKFSMPKFGMSGPKIHGPNVDVDLKAPKGDLDISAPNIGGNFSGPNIDLDGPGGSIKGPHLKMPKFNV-AGPKLSGP--DANLKAP------KMNADLEAPDIDVKGPKGKFHMPSFGLSKPKISGPDGDFDVNLPDADLNLSGPKLDVDEPNIDLHGP----DVKLKKPTFSMPKMSGPKLHAPDLDVD---LKAPKGDFD----ISAPNIGGNLSGPNID-LDGPELNADLD-------------APDIDL-KGPKGKFNMPDLKMPSFGMSKPKISGPD 552          

HSP 6 Score: 51.6026 bits (122), Expect = 3.986e-7
Identity = 74/254 (29.13%), Postives = 103/254 (40.55%), Query Frame = 2
Query:   62 KLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDI-DFHKMDIDIEVDIDGKK---KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSN-------FQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQ-SIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVN 787
            K+  P GD DV+ PD D++I G K  G +     N N+D  D H    +I  +I G        G +  +P  K+P F   V  PK        GP+ D D   + P    +VNLK P V    N P++  P FD+ +N         +S P ++  +  P    D NF +   S   D        T+       D    + +F      + TF  S P      I  P + ID +  SP    N YSSP VN
Sbjct: 1574 KISGPDGDFDVDLPDADLNISGPKLGGGMKAPKLNSNLDTPDVHLKGPNIGGNISGPNIDFDGPGGNMKVPHLKMPKFN--VSLPK------ASGPDFDADFDAESP----NVNLKGPKVKT--NMPNLKTPSFDVDANVPNMGGRLNYSGPNMEGDLHAP----DINFRAPKGSIDLD--------TDL------DVKGPKGHFKGPDMKTPTFGFSGP-----KIRTPEANIDLDGSSPQVKGN-YSSPGVN 1789          

HSP 7 Score: 50.8322 bits (120), Expect = 6.069e-7
Identity = 89/336 (26.49%), Postives = 134/336 (39.88%), Query Frame = 2
Query:   14 GLDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLN-------VKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTF---------EGKVKKPKG-EIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS--------NFQFSKPVIK---SHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDI-STSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDI-LSNPILKEHISIHNLEK 907
            GLD N PD+ +   + KLKKPK  +         +  PD DVD+  K PKG  D++       +  PN+D+D        E  I G           P+ K+PTF         +  +K PKG + D DV  P+ D++I G K  G     +K P V+ + + PD+     D++         +F  SKP I       +  + D+D N +   L      P+       F +  + D    +  F + S  +S    S PDD  +NI  P    D              +P VN  F +     LK    ++D  D+ L  P  K H+    + K
Sbjct: 1220 GLDANAPDFDIQGPDLKLKKPKISMPKFGISGPKLHGPDFDVDL--KAPKGNFDVSTPKIGGKLSGPNLDLDGP------EAGIKG-----------PNLKMPTFNVNANFDAPDVDLKGPKGPDGDFDVGLPDADLNISGPKLGG----GMKAPKVNANFDAPDV-----DLKGPKGKFHMPSFGMSKPKISGPDGDFDADLPDADLNISGPKLGGDLKAPK---VNANFDAPDV-DLKGPKGKFHMPSFGMSKPKISGPDDADLNISGPKLGGD------------LKAPKVNANF-DAPDVDLKGPKANFDAPDVDLKGPKGKFHMPSFGMSK 1510          

HSP 8 Score: 50.0618 bits (118), Expect = 1.069e-6
Identity = 43/139 (30.94%), Postives = 71/139 (51.08%), Query Frame = 2
Query:   62 KLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDF------------DVNLKKPNVDVDINKPDIVY 442
            K+  P GD D + PD D++I G K  G     +K P V+ +F   D+D++    G K K    F++P + +   + K+  P G+ D+D+  P+ D++I G K  G              DV+LK PN+  +I+ P+I +
Sbjct: 1512 KISGPDGDFDADLPDADLNISGPKLGG----GMKAPKVNANFDTPDVDLK----GPKGK----FHMPSFGM--SKPKISGPDGDFDVDL--PDADLNISGPKLGGGMKAPKLNSNLDTPDVHLKGPNIGGNISGPNIDF 1634          

HSP 9 Score: 50.0618 bits (118), Expect = 1.247e-6
Identity = 70/260 (26.92%), Postives = 110/260 (42.31%), Query Frame = 2
Query:    8 KHGLDINLPD--------------WKLPKF------------EGKLKKPKGDLDVEAPDIDVDIHGK-----KPKGEI--------DLNVK-----NPNVDIDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDI-------DVEGPEVD-----IDIHGKKPKGDFDVNLKKPNVDV-DINKPDIVYPIFDI-----QSNFQFSKPVIKSHIEQPVSDSDR-NFNSNLLSKSFDLPQPISQI 589
            K GLD++ PD              + +PKF            +  LK PKGDLD+ AP+I  +  G       P G I          NV       P+ ++   KM+ D+E   +D+ G K K    F++P + L   + K+  P G+ D+       ++ GP++D     ID+HG       DV LKKP   +  ++ P +  P  D+     + +F  S P I  ++  P  D D    N++L +   DL  P  + 
Sbjct:  284 KMGLDVDAPDIDIHSPDAKFKKSKFSMPKFGMSGPKIHGPNVDVDLKAPKGDLDISAPNIGGNFSGPNIDLDGPGGSIKGPHLKMPKFNVAGPKLSGPDANLKAPKMNADLEAPDIDVKGPKGK----FHMPSFGL--SKPKISGPDGDFDVNLPDADLNLSGPKLDVDEPNIDLHGP------DVKLKKPTFSMPKMSGPKLHAPDLDVDLKAPKGDFDISAPNIGGNLSGPNIDLDGPELNADLDAPDIDLKGPKGKF 531          

HSP 10 Score: 47.3654 bits (111), Expect = 8.363e-6
Identity = 60/221 (27.15%), Postives = 94/221 (42.53%), Query Frame = 2
Query:   17 LDINLPDWKL----PKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL--------NVKNPNVDIDFHKMDIDIEV-----DIDGKKKKHGLDFNLPDWKLPTFEGK-------VKKPK----GEIDIDVEGPEVDIDIHGKKPKGDF---DVNLKKPNVDVDINKPDIVYPIFDI-QSNFQFSKPVIK---SHIEQPVSDSDRNFNSNLLSKSFDLPQ 574
             D+ LPD  L    PK  G +K PK + + +APD+D+    K PKG+  +         +  P+ D D    D D+ +       D K  K   +F+ PD  L   +GK       + KPK     + D+++ GP++  D+   K   +F   DV+LK P  + D    D+  P       +F  SKP I       +  + D+D N +   L      P+
Sbjct: 1328 FDVGLPDADLNISGPKLGGGMKAPKVNANFDAPDVDL----KGPKGKFHMPSFGMSKPKISGPDGDFDADLPDADLNISGPKLGGDLKAPKVNANFDAPDVDLKGPKGKFHMPSFGMSKPKISGPDDADLNISGPKLGGDLKAPKVNANFDAPDVDLKGPKANFDAPDVDLKGPKGKFHMPSFGMSKPKISGPDGDFDADLPDADLNISGPKLGGGMKAPK 1544          
BLAST of SMED30000771 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001909.1 (pep scaffold:Pmarinus_7.0:GL476451:21233:28988:1 gene:ENSPMAG00000001734.1 transcript:ENSPMAT00000001909.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 2.437e-10
Identity = 64/171 (37.43%), Postives = 85/171 (49.71%), Query Frame = 2
Query:   17 LDINLPDWKL------PKFEGKLKKPKGDLDVEAPDIDVDIHG----------KKPK-GEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLD-----FNLPDWKLPTFEGKVKKPKG-EIDIDVEGPEVDIDIHGKKPKGDFDVNLKK-------PNVDVDINKPDI 436
            LD+ +P +K       PK EG LK P  D+DVEAP  DVD+HG          K PK G     +  P+VD+D  K DIDI V  ID K     ++     F  P +K+P F     K  G ++D DV  P+ DI++   K KG  DV+  K       P+VD+  N PD+
Sbjct: 1076 LDVKMPKFKGGVDVSGPKVEGDLKVPDVDMDVEAP--DVDLHGPDAKLKFPKMKMPKFGFSGPKLHGPDVDVDLPKGDIDISVPKIDAKAPNLNIEGSDSKFKFPKFKMPKFGFSSPKFHGPDVDFDVSLPKGDIEVKSPKVKGGIDVSGPKVEGEMNVPDVDLSFNSPDV 1244          

HSP 2 Score: 59.3066 bits (142), Expect = 1.500e-9
Identity = 90/332 (27.11%), Postives = 143/332 (43.07%), Query Frame = 2
Query:   17 LDINLPDWKL------PKFEGKLKKPKGDLDVEAPDIDVDIHG----------KKPK-GEIDLNVKNPNVDIDFH--KMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKK-------PNVDVDINKPDIVYPIFDIQSNFQFSKPVI-KSHIEQP-VSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWIS-PVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLE 904
            ++I +P +K       PK EG +  P  DLDVEAP  DVD+HG          K PK G     +  P+VD D    K D+DI   +VD+D K  K   D   P+  +    GK+K PK ++       + GP++++DI   K KG  D++  K       PNVD+D+  PD+   +    + F+F K  + K     P +   D + + +L    FD+  P                  + + D+         S+PD   ++I+ P   I    I  P     Q S+P +N   L+ + P  K   D       +S P L+  + + +++
Sbjct: 1648 MNIKMPKFKGGVDVSGPKLEGDVHVPDVDLDVEAP--DVDLHGPDAKLKFPKMKMPKFGFSGPKLHGPDVDFDLSLPKADVDIAGPKVDLDVKGPKIAGDIEAPNINIEGSGGKIKSPKFKMPSFSGPKISGPDLNVDIKSPKLKGGVDMSGPKVEGDINIPNVDLDVEAPDVD--LHGPDAKFKFPKMKMPKFGFSGPKLHGPDVDLDLSLPKADFDIAAP------------------KVDIDVKGPKLQGDMSLPD---VDIDGPEGKIKGPKIKMPDITGPQISAPDLN---LDIKMPKFKGGVD-------VSGPKLEGDVHVPDVD 1944          

HSP 3 Score: 58.9214 bits (141), Expect = 2.367e-9
Identity = 63/162 (38.89%), Postives = 84/162 (51.85%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVDIHG----------KKPK-GEIDLNVKNPNVDIDFH--KMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-----DIDIHGKKPKGDFDVNLKK-------PNVDVDINKPDI 436
            D   PK EG +  P  DLDVEAPD  VD+HG          K PK G     +  P+VD+D    K D DI   +VDID K  K   D +LPD  +   EGK+K PK ++  D+ GP++     ++DI   K KG  DV+  K       P+VD+D+  PD+
Sbjct: 1794 DMSGPKVEGDINIPNVDLDVEAPD--VDLHGPDAKFKFPKMKMPKFGFSGPKLHGPDVDLDLSLPKADFDIAAPKVDIDVKGPKLQGDMSLPDVDIDGPEGKIKGPKIKMP-DITGPQISAPDLNLDIKMPKFKGGVDVSGPKLEGDVHVPDVDLDVEAPDL 1952          

HSP 4 Score: 55.0694 bits (131), Expect = 3.258e-8
Identity = 70/210 (33.33%), Postives = 100/210 (47.62%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVD---IDFHKMDI-DIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDID----------------------IHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK-SHIEQP-VSDSDRNFNSNL 547
            K HG D++  D  LPK +G +K PK + D+  PD  VD+ G       D  +K PN+    I   K+   D+ +D+   K K G+D + P       EG VK P  ++D+DVE P+VD+                       +HG  P  DFDVNL K +V+V   K DI  P  D+Q  +++   P IK  HI  P +S  D N +  +
Sbjct:  889 KLHGPDVDF-DVNLPKGDGDIKGPKLEGDMSLPD--VDMQGP------DWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGP-----KVEGDVKVP--DVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHG--PDVDFDVNLPKGDVNVSAPKVDIDLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKM 1080          

HSP 5 Score: 53.5286 bits (127), Expect = 9.208e-8
Identity = 50/129 (38.76%), Postives = 70/129 (54.26%), Query Frame = 2
Query:   47 PKFEGK-----LKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD 418
            PKF G      +  PKGD++V++P +   I    PK E ++NV  P+VD+ F+  D+DIE    GK  K    F LP  K+P+F   +  PK        GP+VD+D+    PKGD DV+   P VD+D
Sbjct: 1190 PKFHGPDVDFDVSLPKGDIEVKSPKVKGGIDVSGPKVEGEMNV--PDVDLSFNSPDVDIE----GKDAK----FKLPKMKMPSFG--ISGPK------FHGPDVDLDLS--LPKGDLDVSA--PKVDID 1296          

HSP 6 Score: 53.1434 bits (126), Expect = 1.378e-7
Identity = 61/184 (33.15%), Postives = 86/184 (46.74%), Query Frame = 2
Query:   14 GLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEV-DIDGKKKKHGLD--FNLPDWKLPTFEGKVKKPKG----------EIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD-----INKPDIVYPIFDIQSNFQFSKPVIKSHIEQP 511
            G  I  P +K+P F G    PK    +  PD++VDI   K KG +D++      DI+   +D+D+E  D+D     HG D  F  P  K+P F     K  G          + D D+  P+VDID+ G K +GD  +    P+VD+D     I  P I  P  DI +  Q S P +   I+ P
Sbjct: 1757 GGKIKSPKFKMPSFSG----PK----ISGPDLNVDIKSPKLKGGVDMSGPKVEGDINIPNVDLDVEAPDVD----LHGPDAKFKFPKMKMPKFGFSGPKLHGPDVDLDLSLPKADFDIAAPKVDIDVKGPKLQGDMSL----PDVDIDGPEGKIKGPKIKMP--DI-TGPQISAPDLNLDIKMP 1921          

HSP 7 Score: 51.9878 bits (123), Expect = 2.646e-7
Identity = 71/220 (32.27%), Postives = 101/220 (45.91%), Query Frame = 2
Query:    5 KKHGLDINLPDWKL------PKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDL-NVKNPNVDID---FHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDID----------------------IHGKKPKGDFDVNLKKPNVDVDINKP----DIVYPIFDIQS-NFQFSKPVIK-SHIEQP-VSDSDRNFNSNL 547
            K  G +I +P +K       PK EG +K P  DLDVEAPD+D+    + P G+     +K P         H  D+D +V++   K K G++ +      P  EG VK P  ++D+DVE P+VD+                       +HG  P  DFDVNL  P  D DI  P    D+  P  D+Q  +++   P IK  HI  P +S  D N +  +
Sbjct:  380 KIKGPNIKMPQFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDL----QGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNL--PKVKGGVEVS-----GPKVEGDVKVP--DVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHG--PDVDFDVNL--PKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKM 582          

HSP 8 Score: 51.6026 bits (122), Expect = 4.504e-7
Identity = 55/172 (31.98%), Postives = 88/172 (51.16%), Query Frame = 2
Query:   17 LDINLPDWKL------PKFEGKLKKPKGDLDVEAPDIDVD----------------------IHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEG-KVKKPKGEIDIDVEGPEV--DIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            LD+ +P +K       PK EG +K P  DLDVEAPD+D+                       +HG  P  + D+N+   +V++   K+DID+ +VD+ G   K       P+ K+P   G K+  P  ++++DV+ P+    +D+ G K +GD    LK P+VD+D+  PD+
Sbjct:  953 LDVKMPKFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHG--PDVDFDVNLPKGDVNVSAPKVDIDLPDVDMQGPDWK----IKGPNIKMPHISGPKISAP--DLNLDVKMPKFKGGVDVSGPKVEGD----LKVPDVDMDVEAPDV 1112          

HSP 9 Score: 50.8322 bits (120), Expect = 7.664e-7
Identity = 62/199 (31.16%), Postives = 93/199 (46.73%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDL--------DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKK-HGLDFNLPDWK------LPTFEGKVKKPKGEIDIDVEGPEVDIDIHG----------KKPKGDF-DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSD 526
            LD+  PD  L   EGK K PK  +        +V   D+DV +    PKG ++++V   NVD+   K+  D+   +VDI+G   K  G +  +P +K       P  EG VK P  ++D+DVE P  D+D+ G          K PK  F    L  P+VD D+N P        ++   + S P ++  ++ P  D D
Sbjct:  300 LDVEAPDVNLQGPEGKFKLPKVTMPSFGFSGPNVHGSDVDVSL----PKGGLNVSVPKVNVDVKGPKVQGDMSVPDVDIEGPDCKIKGPNIKMPQFKGGVDVSGPKVEGDVKVP--DVDLDVEAP--DVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLP-------KVKGGVEVSGPKVEGDVKVPDVDLD 483          

HSP 10 Score: 50.447 bits (119), Expect = 8.716e-7
Identity = 67/219 (30.59%), Postives = 101/219 (46.12%), Query Frame = 2
Query:    5 KKHG----LDINLP----DWKLPKFEGKLKKPKGDLD--------------------VEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK-SHIEQP-VSDSDRNFNSNL 547
            K HG     D+NLP    D K PK EG +  P  D+                     + APD+++D+   K KG +D+       +VK P+VD+D    D+D++   DGK       F  P  K+P F      PK      + GP+VD D++   PKGD D+  K P ++ D++ PD+     D+Q  +++   P IK  HI  P +S  D N +  +
Sbjct:  514 KLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDLQ-GPDGK-------FKFPKMKMPKFG--FSGPK------LHGPDVDFDVN--LPKGDGDI--KGPKLEGDMSLPDV-----DMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKM 707          

HSP 11 Score: 50.447 bits (119), Expect = 8.716e-7
Identity = 67/219 (30.59%), Postives = 101/219 (46.12%), Query Frame = 2
Query:    5 KKHG----LDINLP----DWKLPKFEGKLKKPKGDLD--------------------VEAPDIDVDIHGKKPKGEIDL-------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIK-SHIEQP-VSDSDRNFNSNL 547
            K HG     D+NLP    D K PK EG +  P  D+                     + APD+++D+   K KG +D+       +VK P+VD+D    D+D++   DGK       F  P  K+P F      PK      + GP+VD D++   PKGD D+  K P ++ D++ PD+     D+Q  +++   P IK  HI  P +S  D N +  +
Sbjct:  639 KLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKMPKFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDLQ-GPDGK-------FKFPKMKMPKFG--FSGPK------LHGPDVDFDVN--LPKGDGDI--KGPKLEGDMSLPDV-----DMQGPDWKIKGPNIKMPHISGPKISAPDLNLDVKM 832          

HSP 12 Score: 50.0618 bits (118), Expect = 1.327e-6
Identity = 89/364 (24.45%), Postives = 151/364 (41.48%), Query Frame = 2
Query:   17 LDINLP----DWKLPKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPK------GEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHG-----LDFNL--PDWKLPTFEGKVKKPK-------------GEIDIDVEGPEVDIDIHGKKPKGDFDV----------NLKKPNVDV-DINKPDIVYPIFDI-------QSNFQFSKPVIKSHIEQPVSDSDRNF-NSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP---------------DDPSINIEQPNSAIDS-EWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLE 904
            +D+N P    D   PKF+G +K   G LD++ PD+++   D   K PK      G     +  P+VD+D     +   +D+ G K + G     +D N+  PD  L   E K+K PK              ++D D+  P++DI++ G K +GD D+           +K PN+ +  I+ P +  P  D+       +     S P ++  +  P  D D    + +L      L  P  ++ +F  S  P       +FD+S   +    + P               + P+INIE     I S ++  P     + S P +N   ++ + P LK   D       +S P ++  I+I N++
Sbjct: 1458 VDVNPPTADVDISSPKFKGDIKGSAGGLDIQTPDVNIEGPDAKLKMPKMKMPKIGFSGPKLHGPDVDLDLSLPKVKGGIDVSGPKIEGGVKVPNVDVNVDSPDINLEGPESKLKFPKMPKFGFSGPNIHGPDVDFDIAAPKLDINVKGLKMEGDVDIPHLDIEGPEGKIKGPNMKLPSISGPKVSAPDLDMNIKMPKFKGGVDVSGPKLEGDVHVPDVDLDVEAPDVDLHGPDAKLKFPKMKMPKFGFS-GPKLHGPDVDFDLSLPKADVDIAGPKVDLDVKGPKIAGDIEAPNINIEGSGGKIKSPKFKMPSFSGPKISGPDLN---VDIKSPKLKGGVD-------MSGPKVEGDINIPNVD 1810          

HSP 13 Score: 49.6766 bits (117), Expect = 1.760e-6
Identity = 74/262 (28.24%), Postives = 110/262 (41.98%), Query Frame = 2
Query:   47 PKFEGK-----LKKPKGDLDVEAPDIDVD------IHG-----KKPKGEI-DLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLP----DWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI-HGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSD-------------SDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAI 727
            PKF G      L  PKGDLDV AP +D+D      I G     K PK ++ DL+   P +    H  D+D+++ +   K K G+D + P    D  +P F+  ++ P    D+++EGPE  I +   KKPK    +    PN+DVD+N P     I   +     S P +  +IE P                S     S  +  + D+  P + +   S     D   S    DI T            P +NIE P++ +
Sbjct: 1268 PKFHGPDVDLDLSLPKGDLDVSAPKVDIDPSPDMNIEGADAKFKLPKMKMPDLSFSGPKI----HAPDVDMDLSL--TKVKGGIDVSGPKVEGDINVPDFDVDIEAP----DVNIEGPEGKIKLPKMKKPK----IGFASPNIDVDLNIPKADVSIASPKLGIDVSSPDV--NIEGPEMKIKKPKFKMPKFGFSGPKIQSPDIDANVDVNPPTADVDISSPKFKGDIKGSAGGLDIQT------------PDVNIEGPDAKL 1501          

HSP 14 Score: 48.9062 bits (115), Expect = 3.046e-6
Identity = 51/161 (31.68%), Postives = 78/161 (48.45%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQ-SNFQFSKP 484
            K HG D++L           L  PK D D+ AP +D+D+ G K +G++ L    P+VDID        E  I G K K   D   P    P     +K PK +  +DV GP+++ D+H      D D++++ P  D+D++ PD  +    ++   F FS P
Sbjct: 1843 KLHGPDVDL----------DLSLPKADFDIAAPKVDIDVKGPKLQGDMSL----PDVDIDGP------EGKIKGPKIKM-PDITGPQISAPDLNLDIKMPKFKGGVDVSGPKLEGDVHVP----DVDLDVEAP--DLDLHGPDAKFKFPKMKMPKFGFSGP 1976          

HSP 15 Score: 48.1358 bits (113), Expect = 4.147e-6
Identity = 62/186 (33.33%), Postives = 93/186 (50.00%), Query Frame = 2
Query:   17 LDINLPDWKL------PKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPK------GEIDLNVKNPNVDIDFH--KMDIDIEV-DIDGKKKKHGLDFNLPDW-------KLPTFEG-KVKKPKGEIDIDVEGPEV--DIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQ---SNFQFSK 481
            LD+ +P +K       PK EG +K P  DLDVEAPD+D+   D   K PK      G     +  P+VD D +  K D DI+   ++G      +D   PDW       K+P   G K+  P  ++++DV+ P+    +D+ G K +GD    +K P+VD+D+  PD+     D+Q     F+F K
Sbjct:  578 LDVKMPKFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAP--DLNLDVKMPKFKGGVDVSGPKVEGD----VKVPDVDLDVEAPDV-----DLQGPDGKFKFPK 752          

HSP 16 Score: 48.1358 bits (113), Expect = 4.147e-6
Identity = 62/186 (33.33%), Postives = 93/186 (50.00%), Query Frame = 2
Query:   17 LDINLPDWKL------PKFEGKLKKPKGDLDVEAPDIDV---DIHGKKPK------GEIDLNVKNPNVDIDFH--KMDIDIEV-DIDGKKKKHGLDFNLPDW-------KLPTFEG-KVKKPKGEIDIDVEGPEV--DIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQ---SNFQFSK 481
            LD+ +P +K       PK EG +K P  DLDVEAPD+D+   D   K PK      G     +  P+VD D +  K D DI+   ++G      +D   PDW       K+P   G K+  P  ++++DV+ P+    +D+ G K +GD    +K P+VD+D+  PD+     D+Q     F+F K
Sbjct:  703 LDVKMPKFKGGVDVSGPKVEGDVKVPDVDLDVEAPDVDLQGPDGKFKFPKMKMPKFGFSGPKLHGPDVDFDVNLPKGDGDIKGPKLEGDMSLPDVDMQGPDWKIKGPNIKMPHISGPKISAP--DLNLDVKMPKFKGGVDVSGPKVEGD----VKVPDVDLDVEAPDV-----DLQGPDGKFKFPK 877          
BLAST of SMED30000771 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010813.1 (pep scaffold:Pmarinus_7.0:GL477610:65266:75627:1 gene:ENSPMAG00000009796.1 transcript:ENSPMAT00000010813.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 9.588e-8
Identity = 67/239 (28.03%), Postives = 106/239 (44.35%), Query Frame = 2
Query:   17 LDINLPDWKL------PKFEGKLKKPKGDLDVEAPDIDVD------IHGKKPKGEID-------LNVKNPNVDIDFHKMDIDIE-VDIDGKK-------------KKHGLDFNLPDWKLPTF--EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGD-------FDVNLKKPNVDVDINKPDIVYPIFDIQSNF--QFSKPVIKSHIEQP-VSDSD---RNFNSNLLSKSFDLPQPISQI 589
            LD   P +K       PK EG+ K P  D+ VE PD++        ++   PK +ID       L+V  P V +D    D+++   D  GK              K H  D +L D+K P F  +G +  PK  ++ D++GP++D+D+    PKGD       FD  +K P VD+++  PD +    D       +F  P +   +E P V   D   +  N+ +     D+  P +Q+
Sbjct: 1190 LDFKAPHFKTKGGIATPKLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGSDAHGKGFKLKMPDFHISGPKMHAPDVSL-DFKAPHFKTKGGISTPK--LEGDIQGPDLDLDV--SLPKGDIGVPTSEFDAKVKVPEVDLNLTGPDKLKGKGDSLPKLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKTDIDVSLPDAQL 1423          

HSP 2 Score: 50.8322 bits (120), Expect = 5.963e-7
Identity = 57/194 (29.38%), Postives = 88/194 (45.36%), Query Frame = 2
Query:   44 LPKFEGKLKKPKGDLDVEAPDIDVD------IHGKKPKGEID-------LNVKNPNVDIDFHKMDIDIEV-DIDGKK-------------KKHGLDFNLPDWKLPTF--EGKVKKPK--GEI---DIDVEGPEVDIDIHG---KKPKGDFDV-NLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP 511
            LPK EG+ K P  D+ VE PD++        ++   PK +ID       L+V  P V +D    D+++   D  GK              K H  D +L D+K P F  +G +  PK  G+I   D+D +GP+VD+ + G   + P G   + N   P  D+D++ PD         +    S P +K  ++ P
Sbjct:  604 LPKLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMPDFHISGPKMHAPDVSL-DFKAPHFKTKGGIATPKLEGDIQGPDLDFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPD---------AQLDVSAPEVKVDLDAP 787          

HSP 3 Score: 50.8322 bits (120), Expect = 7.646e-7
Identity = 58/174 (33.33%), Postives = 83/174 (47.70%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFE--GKLKKPK--GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFE--GKVKKPKGE--------IDIDVEGPEVDIDIHGKK----------------PKGDFDVNLKKPNVDVDINKPDI 436
            K HG D++L D+K P F+  G +  PK  G     APD+ VD+         DLN+  P+      K+ +  E  I G K  HG D +L D+K P F+  G +  PK E         D+D+EGP+VD+ + G                  PK D DV+L  P V +D++ PD+
Sbjct: 1587 KMHGPDVSL-DFKAPHFKTKGGISTPKLEGATVPNAPDVKVDLDAP------DLNLSGPDARGKGFKLKMP-EFHISGPKM-HGPDISL-DFKAPHFKTKGGISPPKLEELDLNLTGPDVDLEGPDVDVSVEGPDVEGPDGKLKMHLNATVPKADIDVSL--PEVQLDVSAPDV 1748          

HSP 4 Score: 49.6766 bits (117), Expect = 1.697e-6
Identity = 72/277 (25.99%), Postives = 111/277 (40.07%), Query Frame = 2
Query:   44 LPKFEGKLKKPKGDLDVEAPDIDVD------IHGKKPKGEID-------LNVKNPNVDIDFHKMDIDIEV-DIDGKK-------------KKHGLDFNLPDWKLPTF--EGKVKKPKGEIDI--------DVEGPEVDIDIHG---KKPKGDFDV-NLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP---VSDSD-RNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIP------DDPSINIEQPNS 721
            LPK EG+ K P  D+ VE PD++        ++   PK +ID       L+V  P V +D    D++I   D  GK              K H  D +L D+K P F  +G +  PK E DI        + +GP+VD+ + G   + P G   + N   P  D+D++ PD         +    S P +K  +E P   +S  D R     L    F +  P     + S       F ++          +T  + P      D P +N+  P++
Sbjct: 1374 LPKLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKTDIDVSLPDAQLDVSAPEVKVDLDAPDLNISGPDAHGKGFKLKMPDFHISGPKMHAPDVSL-DFKAPHFKTKGGISTPKLEGDIQGPDLDLGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPD---------AQLDVSAPEVKVDLEAPDLNLSGPDARGKGFKLKLPEFHISGPKMHGPDVSLDFKAPHFKTKGGISTPKLEGATVPNAPDVKVDLDAPDLNLSGPDA 1640          

HSP 5 Score: 48.9062 bits (115), Expect = 2.350e-6
Identity = 66/236 (27.97%), Postives = 110/236 (46.61%), Query Frame = 2
Query:    5 KKHGLDINLPDWKLPKFE--GKLKKPK-------GDLDVEAPDIDVDIHG---KKPKGEID-LNVKNPNVDIDF----HKMDI---DIEVDID------------GKK-------------KKHGLDFNLPDWKLPTF--EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLP 571
            K H  D++L D+K P F+  G +  PK        DLD + PD+DV + G   + P G++  LN   P  DID      ++D+   +++VD+D            GK              K H  D +L D+K P F  +G +  PK  ++ D++GP+VD++       G+F    K P+VDV +  PD+  P   ++     + PV K+ I+  + D+  + ++  +    D P
Sbjct:  938 KMHAPDVSL-DFKAPHFKTKGGIATPKLEGDNQGPDLDFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMPDFHISGPKMHAPDVSL-DFKAPHFKTKGGISTPK--LEGDIQGPDVDLE-------GEF----KGPDVDVSVEGPDVEGPDGKLK---MLNAPVPKADIDVSLPDAQLDVSAPEVKVDLDAP 1155          

HSP 6 Score: 48.521 bits (114), Expect = 3.119e-6
Identity = 50/183 (27.32%), Postives = 82/183 (44.81%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEID---LNVKNPNVDIDFHKMDIDIEVDIDGKKKKH---GLDFNLPDWKL------PTFEGKVKKPKGEIDIDVEGPEVDIDIHG---KKPKGDFDV-NLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP 511
             G D+  PD KL      +  PK D+DV  PD  +D+   + K ++D   LNV  P+      K+ +  +  I G K       LDF  P +K       P  EG ++ P  +++ + +GP+VD+ + G   + P G   + N   P  D+D++ PD         +    S P +K  ++ P
Sbjct:  741 EGPDVEGPDGKLKMLNATV--PKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMP-DFHISGPKMHAPDVSLDFKAPHFKTKGGISTPKLEGDIQGPDVDLEGEFKGPDVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPD---------AQLDVSAPEVKVDLDAP 911          

HSP 7 Score: 48.521 bits (114), Expect = 3.733e-6
Identity = 52/167 (31.14%), Postives = 77/167 (46.11%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEID---LNVKNPNVDIDFHKMDIDIEVDIDGKKKKH---GLDFNLPDWKL------PTFEGKVKKPKGEIDIDVEGPEVDID------IHGKKPKGDFDVNL-------KKPNVDVDINKPDI 436
             G D+  PD KL      +  PK D+DV  PD  +D+   + K ++D   LNV  P+      K+ +  +  I G K       LDF  P +K       P  EG+ K P  ++D+ VEGP+V+        ++   PK D DV+L         P V VD++ PD+
Sbjct: 1109 EGPDVEGPDGKLKMLNAPV--PKADIDVSLPDAQLDVSAPEVKVDLDAPDLNVSGPDAHGKGFKLKMP-DFHISGPKMHAPDVSLDFKAPHFKTKGGIATPKLEGEFKGP--DVDVSVEGPDVEGPDGKLKMLNATVPKADIDVSLPDAQLDVSAPEVKVDLDAPDL 1270          
BLAST of SMED30000771 vs. Ensembl Nematostella
Match: EDO33569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRT1])

HSP 1 Score: 47.7506 bits (112), Expect = 8.837e-6
Identity = 56/191 (29.32%), Postives = 79/191 (41.36%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKP----KGDLD---------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKP----KGEIDI-------DVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVY--PIFDIQSNFQFSKPVIKSHIEQP 511
            +D+  PD+K PK EG +  P    KGD+D         +E PD D+D  G K KG      K P+                +GK K   +D   PD+  P  +G +  P    KG+ID        D++GP+ D+   G K KG      K P+        DI Y  P FD      F  P ++  ++ P
Sbjct:  160 IDVEGPDFKGPKVEGDVDTPDINVKGDIDTPDFNVKGDIEGPDADIDSPGWKFKGPKMPKFKGPS---------------FEGKGKSGHIDIEGPDFDGPNVKGDIDTPDINLKGDIDTPDVNVKGDIDGPDADVHGPGWKFKGPKMPKFKGPSFGGKGKSGDIDYDGPDFDGPKGPDFKGPKVEGDVDTP 335          
BLAST of SMED30000771 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 62.3882 bits (150), Expect = 9.133e-10
Identity = 53/149 (35.57%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + KLK PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+PT    +K PK      +E PE DI++ G K  GD DV +  P ++ DI  PD+
Sbjct: 5087 VDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPTLN--IKGPK------MEKPEFDINLKGPKVGGDLDVKV--PKIEGDIKAPDV 5219          

HSP 2 Score: 61.6178 bits (148), Expect = 1.741e-9
Identity = 52/149 (34.90%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K PN++ DI  PD+
Sbjct: 4529 VDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPNIEGDIKTPDL 4661          

HSP 3 Score: 61.6178 bits (148), Expect = 1.741e-9
Identity = 52/149 (34.90%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K PN++ DI  PD+
Sbjct: 4901 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPNIEGDIKTPDL 5033          

HSP 4 Score: 60.8474 bits (146), Expect = 3.018e-9
Identity = 52/149 (34.90%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + KLK PK        ++V  PD+D+++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K P ++ DI  PD+
Sbjct: 2111 VDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPKIEGDIKAPDV 2243          

HSP 5 Score: 60.077 bits (144), Expect = 4.968e-9
Identity = 53/145 (36.55%), Postives = 80/145 (55.17%), Query Frame = 2
Query:   17 LDINLPDWKL--PKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD KL  PKF   + K +G ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 4722 VDIKGPDAKLKGPKFN--MPKMQG-MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKV--PKIEGDIKAPDV 4847          

HSP 6 Score: 60.077 bits (144), Expect = 5.460e-9
Identity = 50/149 (33.56%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE+D+ + G K  GD DV  K P ++ +I  PD+
Sbjct:  995 VDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPELDLKLKGPKVGGDLDV--KAPKIEGEIKTPDV 1127          

HSP 7 Score: 59.6918 bits (143), Expect = 5.848e-9
Identity = 50/149 (33.56%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE+D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 1925 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPELDLKLKGPKVGGDLDVKV--PKIEGDIKAPDV 2057          

HSP 8 Score: 59.6918 bits (143), Expect = 6.483e-9
Identity = 50/149 (33.56%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 3599 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKI--PKIEGDIKAPDV 3731          

HSP 9 Score: 59.6918 bits (143), Expect = 6.483e-9
Identity = 50/149 (33.56%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+   G K  GD DV +  PN++ D+  PD+
Sbjct: 3785 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKFKGPKVGGDLDVKV--PNIEGDLKTPDV 3917          

HSP 10 Score: 59.6918 bits (143), Expect = 7.439e-9
Identity = 50/149 (33.56%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 2297 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKV--PKIEGDIKAPDV 2429          

HSP 11 Score: 59.3066 bits (142), Expect = 8.986e-9
Identity = 52/144 (36.11%), Postives = 76/144 (52.78%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDI 421
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E P+VDI + G K  GD DV  K PN+D DI
Sbjct: 4157 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKSPK------MEKPDVDIKLKGPKVGGDLDV--KTPNIDGDI 4284          

HSP 12 Score: 58.5362 bits (140), Expect = 1.404e-8
Identity = 49/149 (32.89%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ D+  PD+
Sbjct: 3413 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKV--PKIEGDLKAPDV 3545          

HSP 13 Score: 57.7658 bits (138), Expect = 2.290e-8
Identity = 62/208 (29.81%), Postives = 98/208 (47.12%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-------DIDIHGKK-----PKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P++       D+DI G +     PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 3227 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGP 3432          

HSP 14 Score: 57.3806 bits (137), Expect = 3.578e-8
Identity = 54/163 (33.13%), Postives = 74/163 (45.40%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDI-----------------------------DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+                             DVDI  K PK   DL+VK PN+D D   +D  I     G K   G  F +P +K+PTF  K  K        +EGP+VD+++  K      ++ +K P  D+DI  PD+
Sbjct: 4207 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKSPKMEKPDVDIKLKGPKVGGDLDVKTPNIDGDIKALDGKIGGATVGIKGSKG-GFKMPKFKMPTFGSKSHK--------LEGPDVDVNLPSK------NIEVKTP--DMDIALPDV 4350          

HSP 15 Score: 56.6102 bits (135), Expect = 5.264e-8
Identity = 62/208 (29.81%), Postives = 99/208 (47.60%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-------DIDIHGKK-----PKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQ-SNFQFSKP 484
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+I+ ++  P ++ D    ++DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+GP++       D+DI G +     PKG F                    DV++  P+ D+++  P  DI  P FDI+ S+ +F  P
Sbjct:  809 VDIAAPDVDIEGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIETSL--PKIEGDIKTPNLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGSDAKFKGP 1014          

HSP 16 Score: 56.6102 bits (135), Expect = 6.693e-8
Identity = 50/143 (34.97%), Postives = 75/143 (52.45%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD K    +  + K  G ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DIE   V+I G K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K P ++ DI  PD+
Sbjct: 1746 VDIKGPDSKFKGTKFNMPKMPG-MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDV--KAPKIEGDIKAPDV 1871          

HSP 17 Score: 56.225 bits (134), Expect = 7.292e-8
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 2
Query:   17 LDINLPD--WKLP--KFEG-KLKKPKG-DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD   K P  KF+G K   PK   ++V  PD+D ++ G K KG+ + ++  PN+  D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PEVDI + G K  GD DV  K P ++ DI  PD+
Sbjct: 1367 VDITAPDVDMKGPDTKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDKEASL--PNIKGDIKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSIN--IKGPK------MEKPEVDIRLKGPKVGGDLDV--KAPKIEGDIKAPDV 1499          

HSP 18 Score: 56.225 bits (134), Expect = 8.437e-8
Identity = 63/208 (30.29%), Postives = 95/208 (45.67%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-------DIDIHGKK-----PKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI LPD  +   + K K PK        ++V  PD+D ++ G K KG  D+N   P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P +       D+DI G +     PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 4343 MDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKG--DINASLPKIEGDIKAPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGP 4548          

HSP 19 Score: 56.225 bits (134), Expect = 8.583e-8
Identity = 62/202 (30.69%), Postives = 96/202 (47.52%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPK--GEIDI-------DVEGPEVDI-----DIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS 463
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK  G++D+       D++ P+VDI     DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+ 
Sbjct: 2483 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKG 2680          

HSP 20 Score: 56.225 bits (134), Expect = 8.583e-8
Identity = 62/202 (30.69%), Postives = 96/202 (47.52%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPK--GEIDI-------DVEGPEVDI-----DIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS 463
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK  G++D+       D++ P+VDI     DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+ 
Sbjct: 2855 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKG 3052          

HSP 21 Score: 55.8398 bits (133), Expect = 1.091e-7
Identity = 61/210 (29.05%), Postives = 87/210 (41.43%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------------------IHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                             I+ K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+N PD+
Sbjct: 5137 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEKPEFDINLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGAKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMNTPDL 5338          

HSP 22 Score: 55.4546 bits (132), Expect = 1.460e-7
Identity = 66/212 (31.13%), Postives = 90/212 (42.45%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGE---------------IDIDVEGPEVDIDIHGKKPKG----------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G+K      F +P +K+PTF  K  K +G                 D+D+  P+VDI     K KG                D D NLK P V  D+D + P    D+  P  DI+ 
Sbjct: 3835 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKFKGPKVGGDLDVKVPNIEGDLKTPDVDIGGAELDIEGQKG----GFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKG 4040          

HSP 23 Score: 55.4546 bits (132), Expect = 1.486e-7
Identity = 62/210 (29.52%), Postives = 96/210 (45.71%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGP--------------EVDIDIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P              E ++DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 2669 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGP 2874          

HSP 24 Score: 55.4546 bits (132), Expect = 1.486e-7
Identity = 62/210 (29.52%), Postives = 96/210 (45.71%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGP--------------EVDIDIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P              E ++DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 3041 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGP 3246          

HSP 25 Score: 55.0694 bits (131), Expect = 1.704e-7
Identity = 48/144 (33.33%), Postives = 76/144 (52.78%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDI 421
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D +  D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI
Sbjct: 5273 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMNTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKI--PKIEGDI 5400          

HSP 26 Score: 54.6842 bits (130), Expect = 2.040e-7
Identity = 56/191 (29.32%), Postives = 92/191 (48.17%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDI-----QSNFQFSK 481
            L+I  P  + P+F+ KLK PK  GDLDV+AP+I       D+DI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+   + D+     ++ F+  K
Sbjct: 4434 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTKAGFEMPK 4614          

HSP 27 Score: 54.6842 bits (130), Expect = 2.484e-7
Identity = 62/210 (29.52%), Postives = 90/210 (42.86%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGK-------------------VKKPKGEI---DIDVEGPE----------------------VDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K                   VK P+ +I   D+D++GP+                      VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4579 DASLPKIEGDMKTP--DLDIKVPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMQGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 4780          

HSP 28 Score: 54.6842 bits (130), Expect = 2.638e-7
Identity = 50/149 (33.56%), Postives = 75/149 (50.34%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D     +     +V+IDG K      F +P  K+PT    +K PK E+      P+VDI + G K  GD DV  K P ++ DI  PD+
Sbjct: 1181 VDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKTPSVATKGPDVNIDGTK----AGFEMPKVKMPTLN--IKGPKMEM------PDVDIKLKGPKVGGDLDV--KAPKIEGDIKAPDV 1313          

HSP 29 Score: 54.299 bits (129), Expect = 2.683e-7
Identity = 49/139 (35.25%), Postives = 72/139 (51.80%), Query Frame = 2
Query:   29 LPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +P  K+P     +K PK    +E PD+D+ +  K PK   DL+VK P ++ D    D+DI   E+D +G K      F +P +K+PTF  K  K        +EGP+VDI++         D+ +K P  DVDI  PD+
Sbjct: 1264 MPKVKMPTLN--IKGPK----MEMPDVDIKL--KGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKG----GFKMPKFKMPTFGSKGHK--------LEGPDVDINLP------STDIEVKAP--DVDITAPDV 1374          

HSP 30 Score: 54.299 bits (129), Expect = 2.849e-7
Identity = 61/210 (29.05%), Postives = 87/210 (41.43%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G+K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 2161 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPKIEGDIKAPDVDIGEAEMDIEGQK----AGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 2362          

HSP 31 Score: 54.299 bits (129), Expect = 2.949e-7
Identity = 54/171 (31.58%), Postives = 83/171 (48.54%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+AP I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3318 LNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3478          

HSP 32 Score: 54.299 bits (129), Expect = 3.240e-7
Identity = 62/210 (29.52%), Postives = 89/210 (42.38%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGK-------------------VKKPKGEI---DIDVEGPE----------------------VDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K                   VK P  +I   D+D++GP+                      VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4951 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDLNLPSTDIEVKAPDVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 5152          

HSP 33 Score: 53.9138 bits (128), Expect = 3.653e-7
Identity = 60/210 (28.57%), Postives = 85/210 (40.48%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDV-----------------------------DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD+E PD+++                             D+  K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 1789 DASLPKIEGDIKAP--DLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 1990          

HSP 34 Score: 53.9138 bits (128), Expect = 3.684e-7
Identity = 61/210 (29.05%), Postives = 90/210 (42.86%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGK-------------------VKKPKGEI---DIDVEGPE----------------------VDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K                   VK P+ +I   D+D++GP+                      VD+++ G K KGD D +L  P ++ D+  PD+
Sbjct: 1975 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDL 2176          

HSP 35 Score: 53.9138 bits (128), Expect = 3.980e-7
Identity = 65/235 (27.66%), Postives = 104/235 (44.26%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG------------EI---DIDVEGPEVDI---DIHGKKPKGDF----DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP-VSDSDRNFNSNLLSKSFDLPQ 574
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ +    D+DI   E+DI+G K      F +P +K+PTF  K  K +G            E+   D+D+  P+VD+   D   K PK +      +N+  P+VD ++  P        ++ +   S P I+  I+ P V+    + N +     F++P+
Sbjct: 1045 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKAPKIEGEIKTPDVDIGGAELDIEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGP-------KVKGDIDASLPKIEGDIKTPSVATKGPDVNIDGTKAGFEMPK 1266          

HSP 36 Score: 53.1434 bits (126), Expect = 7.565e-7
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct:  900 LNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPEVDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 1060          

HSP 37 Score: 52.7582 bits (125), Expect = 8.101e-7
Identity = 59/208 (28.37%), Postives = 99/208 (47.60%), Query Frame = 2
Query:   29 LPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG------------EI---DIDVEGPEVDI---DIHGKKPKGDF----DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP-VSDSDRNFNSNLLSKSFDLPQ 574
            +P  K+P     +K PK    +E P++D+ + G K  G  DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G            E+   D+D+  P+VD+   D   K PK +      +N+  P+VD ++  P        ++ +   S P I+  I+ P V+    + N +     F++P+
Sbjct: 1450 MPKVKMPSIN--IKGPK----MEKPEVDIRLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGP-------KVKGDIDASLPKIEGDIKTPSVATKGPDVNIDGTKAGFEMPK 1638          

HSP 38 Score: 52.7582 bits (125), Expect = 8.601e-7
Identity = 58/178 (32.58%), Postives = 83/178 (46.63%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIE----------VDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  ++P  + KLK PK  GDLDV+AP I       DVDI G +     PKG   +              ++ P+VDI+    DI+++          VDI G   K  G  FN+P  K+P              ++V  P+VD ++ G K KGD D +L  P ++ DI  PD+
Sbjct: 1644 LNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMP--KMPG-------------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDL 1804          

HSP 39 Score: 52.373 bits (124), Expect = 1.131e-6
Identity = 61/210 (29.05%), Postives = 86/210 (40.95%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K    DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 2533 DASLPKIEGDMKT--SDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 2734          

HSP 40 Score: 52.373 bits (124), Expect = 1.131e-6
Identity = 61/210 (29.05%), Postives = 86/210 (40.95%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K    DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 2905 DASLPKIEGDMKT--SDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3106          

HSP 41 Score: 52.373 bits (124), Expect = 1.222e-6
Identity = 54/171 (31.58%), Postives = 83/171 (48.54%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDID--------------VDIHGKK-----PK------GEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+AP I+              +DI G+K     PK      G     ++ P+VD++    DID++V          +D   PD  +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4062 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKV--------PDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 4222          

HSP 42 Score: 52.373 bits (124), Expect = 1.243e-6
Identity = 62/208 (29.81%), Postives = 95/208 (45.67%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV--------------DIDIHGKKP--------------KG------DFDVNLKKPNVDVDINKPDIVYPIFDIQ-SNFQFSKP 484
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P++              ++DI G+K               KG      D DVNL   ++DV +   DI  P  DI+ S+ +F  P
Sbjct: 3971 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGP 4176          

HSP 43 Score: 52.373 bits (124), Expect = 1.297e-6
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3504 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3664          

HSP 44 Score: 51.9878 bits (123), Expect = 1.488e-6
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHG-----KKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G     + PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4806 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGADLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 4966          

HSP 45 Score: 51.9878 bits (123), Expect = 1.706e-6
Identity = 51/171 (29.82%), Postives = 81/171 (47.37%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDIDVDIHG------------KKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+AP I+ DI              + PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3132 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3292          

HSP 46 Score: 51.6026 bits (122), Expect = 1.973e-6
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3690 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3850          

HSP 47 Score: 51.2174 bits (121), Expect = 2.529e-6
Identity = 66/230 (28.70%), Postives = 92/230 (40.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKK-----PNVDVDINKPDIVYPIFDIQSNFQFSK 481
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L K        D+DI  PD+   I   ++ F+  K
Sbjct: 2347 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTSDLDIKGPDVN--IDGTKAGFEMPK 2568          

HSP 48 Score: 51.2174 bits (121), Expect = 2.875e-6
Identity = 66/230 (28.70%), Postives = 92/230 (40.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKK-----PNVDVDINKPDIVYPIFDIQSNFQFSK 481
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L K        D+DI  PD+   I   ++ F+  K
Sbjct: 2719 DASLPKIEGDMKTP--DLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTSDLDIKGPDVN--IDGTKAGFEMPK 2940          

HSP 49 Score: 50.8322 bits (120), Expect = 3.159e-6
Identity = 60/185 (32.43%), Postives = 83/185 (44.86%), Query Frame = 2
Query:   29 LPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG------------EI---DIDVEGPEVDIDIHGKKPKG----------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            +P  K+P     +K PK    +E PD+D+ + G K  G  DL+VK P ++ D    D+DI   E+D +G K      F +P +K+PTF  K  K +G            E+   D+D+  P VDI     K KG                D D NLK P V  D+D + P    DI  P  DI+ 
Sbjct: 1636 MPKVKMPTLN--IKGPK----MEMPDVDIKLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDTEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDIKAPDLDIEG 1808          

HSP 50 Score: 50.447 bits (119), Expect = 4.929e-6
Identity = 64/212 (30.19%), Postives = 88/212 (41.51%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGE---------------IDIDVEGPEVDIDIHGKKPKG----------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D     +DI   E+DI+G+K      F +P +K+PTF  K  K +G                 D+D+  P+VDI     K KG                D D NLK P V  D+D + P    D+  P  DI+ 
Sbjct: 4021 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKG----GFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKG 4226          
BLAST of SMED30000771 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 62.3882 bits (150), Expect = 9.133e-10
Identity = 53/149 (35.57%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + KLK PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+PT    +K PK      +E PE DI++ G K  GD DV +  P ++ DI  PD+
Sbjct: 5087 VDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPTLN--IKGPK------MEKPEFDINLKGPKVGGDLDVKV--PKIEGDIKAPDV 5219          

HSP 2 Score: 61.6178 bits (148), Expect = 1.741e-9
Identity = 52/149 (34.90%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K PN++ DI  PD+
Sbjct: 4529 VDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPNIEGDIKTPDL 4661          

HSP 3 Score: 61.6178 bits (148), Expect = 1.741e-9
Identity = 52/149 (34.90%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K PN++ DI  PD+
Sbjct: 4901 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPNIEGDIKTPDL 5033          

HSP 4 Score: 60.8474 bits (146), Expect = 3.018e-9
Identity = 52/149 (34.90%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + KLK PK        ++V  PD+D+++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K P ++ DI  PD+
Sbjct: 2111 VDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKIGGDLDV--KAPKIEGDIKAPDV 2243          

HSP 5 Score: 60.077 bits (144), Expect = 4.968e-9
Identity = 53/145 (36.55%), Postives = 80/145 (55.17%), Query Frame = 2
Query:   17 LDINLPDWKL--PKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD KL  PKF   + K +G ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 4722 VDIKGPDAKLKGPKFN--MPKMQG-MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKV--PKIEGDIKAPDV 4847          

HSP 6 Score: 60.077 bits (144), Expect = 5.460e-9
Identity = 50/149 (33.56%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE+D+ + G K  GD DV  K P ++ +I  PD+
Sbjct:  995 VDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPELDLKLKGPKVGGDLDV--KAPKIEGEIKTPDV 1127          

HSP 7 Score: 59.6918 bits (143), Expect = 5.848e-9
Identity = 50/149 (33.56%), Postives = 79/149 (53.02%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE+D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 1925 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPELDLKLKGPKVGGDLDVKV--PKIEGDIKAPDV 2057          

HSP 8 Score: 59.6918 bits (143), Expect = 6.483e-9
Identity = 50/149 (33.56%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 3599 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKI--PKIEGDIKAPDV 3731          

HSP 9 Score: 59.6918 bits (143), Expect = 6.483e-9
Identity = 50/149 (33.56%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+   G K  GD DV +  PN++ D+  PD+
Sbjct: 3785 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKFKGPKVGGDLDVKV--PNIEGDLKTPDV 3917          

HSP 10 Score: 59.6918 bits (143), Expect = 7.439e-9
Identity = 50/149 (33.56%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI  PD+
Sbjct: 2297 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKV--PKIEGDIKAPDV 2429          

HSP 11 Score: 59.3066 bits (142), Expect = 8.986e-9
Identity = 52/144 (36.11%), Postives = 76/144 (52.78%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDI 421
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E P+VDI + G K  GD DV  K PN+D DI
Sbjct: 4157 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKSPK------MEKPDVDIKLKGPKVGGDLDV--KTPNIDGDI 4284          

HSP 12 Score: 58.5362 bits (140), Expect = 1.404e-8
Identity = 49/149 (32.89%), Postives = 78/149 (52.35%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ D+  PD+
Sbjct: 3413 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKV--PKIEGDLKAPDV 3545          

HSP 13 Score: 57.7658 bits (138), Expect = 2.290e-8
Identity = 62/208 (29.81%), Postives = 98/208 (47.12%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-------DIDIHGKK-----PKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P++       D+DI G +     PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 3227 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGP 3432          

HSP 14 Score: 57.3806 bits (137), Expect = 3.578e-8
Identity = 54/163 (33.13%), Postives = 74/163 (45.40%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDI-----------------------------DVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+                             DVDI  K PK   DL+VK PN+D D   +D  I     G K   G  F +P +K+PTF  K  K        +EGP+VD+++  K      ++ +K P  D+DI  PD+
Sbjct: 4207 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKSPKMEKPDVDIKLKGPKVGGDLDVKTPNIDGDIKALDGKIGGATVGIKGSKG-GFKMPKFKMPTFGSKSHK--------LEGPDVDVNLPSK------NIEVKTP--DMDIALPDV 4350          

HSP 15 Score: 56.6102 bits (135), Expect = 5.264e-8
Identity = 62/208 (29.81%), Postives = 99/208 (47.60%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-------DIDIHGKK-----PKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQ-SNFQFSKP 484
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+I+ ++  P ++ D    ++DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+GP++       D+DI G +     PKG F                    DV++  P+ D+++  P  DI  P FDI+ S+ +F  P
Sbjct:  809 VDIAAPDVDIEGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIETSL--PKIEGDIKTPNLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGSDAKFKGP 1014          

HSP 16 Score: 56.6102 bits (135), Expect = 6.693e-8
Identity = 50/143 (34.97%), Postives = 75/143 (52.45%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIE---VDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD K    +  + K  G ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DIE   V+I G K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV  K P ++ DI  PD+
Sbjct: 1746 VDIKGPDSKFKGTKFNMPKMPG-MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDLDIEGPDVNIGGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDV--KAPKIEGDIKAPDV 1871          

HSP 17 Score: 56.225 bits (134), Expect = 7.292e-8
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 2
Query:   17 LDINLPD--WKLP--KFEG-KLKKPKG-DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD   K P  KF+G K   PK   ++V  PD+D ++ G K KG+ + ++  PN+  D    D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PEVDI + G K  GD DV  K P ++ DI  PD+
Sbjct: 1367 VDITAPDVDMKGPDTKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDKEASL--PNIKGDIKTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSIN--IKGPK------MEKPEVDIRLKGPKVGGDLDV--KAPKIEGDIKAPDV 1499          

HSP 18 Score: 56.225 bits (134), Expect = 8.437e-8
Identity = 63/208 (30.29%), Postives = 95/208 (45.67%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-------DIDIHGKK-----PKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI LPD  +   + K K PK        ++V  PD+D ++ G K KG  D+N   P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P +       D+DI G +     PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 4343 MDIALPDVGIEGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKLKG--DINASLPKIEGDIKAPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGP 4548          

HSP 19 Score: 56.225 bits (134), Expect = 8.583e-8
Identity = 62/202 (30.69%), Postives = 96/202 (47.52%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPK--GEIDI-------DVEGPEVDI-----DIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS 463
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK  G++D+       D++ P+VDI     DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+ 
Sbjct: 2483 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKG 2680          

HSP 20 Score: 56.225 bits (134), Expect = 8.583e-8
Identity = 62/202 (30.69%), Postives = 96/202 (47.52%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPK--GEIDI-------DVEGPEVDI-----DIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS 463
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK  G++D+       D++ P+VDI     DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+ 
Sbjct: 2855 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTSDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKG 3052          

HSP 21 Score: 55.8398 bits (133), Expect = 1.091e-7
Identity = 61/210 (29.05%), Postives = 87/210 (41.43%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------------------IHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                             I+ K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+N PD+
Sbjct: 5137 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEKPEFDINLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGAKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMNTPDL 5338          

HSP 22 Score: 55.4546 bits (132), Expect = 1.460e-7
Identity = 66/212 (31.13%), Postives = 90/212 (42.45%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGE---------------IDIDVEGPEVDIDIHGKKPKG----------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G+K      F +P +K+PTF  K  K +G                 D+D+  P+VDI     K KG                D D NLK P V  D+D + P    D+  P  DI+ 
Sbjct: 3835 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKFKGPKVGGDLDVKVPNIEGDLKTPDVDIGGAELDIEGQKG----GFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKG 4040          

HSP 23 Score: 55.4546 bits (132), Expect = 1.486e-7
Identity = 62/210 (29.52%), Postives = 96/210 (45.71%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGP--------------EVDIDIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P              E ++DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 2669 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGP 2874          

HSP 24 Score: 55.4546 bits (132), Expect = 1.486e-7
Identity = 62/210 (29.52%), Postives = 96/210 (45.71%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGP--------------EVDIDIHGKKPKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P              E ++DI G  PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct: 3041 VDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGP 3246          

HSP 25 Score: 55.0694 bits (131), Expect = 1.704e-7
Identity = 48/144 (33.33%), Postives = 76/144 (52.78%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDI 421
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D +  D+DI   +V+IDG K      F +P  K+P+    +K PK      +E PE D+ + G K  GD DV +  P ++ DI
Sbjct: 5273 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMNTPDLDIKGPDVNIDGTK----AGFEMPKVKMPSLN--IKGPK------MEKPEFDLKLKGPKVGGDLDVKI--PKIEGDI 5400          

HSP 26 Score: 54.6842 bits (130), Expect = 2.040e-7
Identity = 56/191 (29.32%), Postives = 92/191 (48.17%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDI-----QSNFQFSK 481
            L+I  P  + P+F+ KLK PK  GDLDV+AP+I       D+DI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+   + D+     ++ F+  K
Sbjct: 4434 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTKAGFEMPK 4614          

HSP 27 Score: 54.6842 bits (130), Expect = 2.484e-7
Identity = 62/210 (29.52%), Postives = 90/210 (42.86%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGK-------------------VKKPKGEI---DIDVEGPE----------------------VDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K                   VK P+ +I   D+D++GP+                      VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4579 DASLPKIEGDMKTP--DLDIKVPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMQGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 4780          

HSP 28 Score: 54.6842 bits (130), Expect = 2.638e-7
Identity = 50/149 (33.56%), Postives = 75/149 (50.34%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D     +     +V+IDG K      F +P  K+PT    +K PK E+      P+VDI + G K  GD DV  K P ++ DI  PD+
Sbjct: 1181 VDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKTPSVATKGPDVNIDGTK----AGFEMPKVKMPTLN--IKGPKMEM------PDVDIKLKGPKVGGDLDV--KAPKIEGDIKAPDV 1313          

HSP 29 Score: 54.299 bits (129), Expect = 2.683e-7
Identity = 49/139 (35.25%), Postives = 72/139 (51.80%), Query Frame = 2
Query:   29 LPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +P  K+P     +K PK    +E PD+D+ +  K PK   DL+VK P ++ D    D+DI   E+D +G K      F +P +K+PTF  K  K        +EGP+VDI++         D+ +K P  DVDI  PD+
Sbjct: 1264 MPKVKMPTLN--IKGPK----MEMPDVDIKL--KGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKG----GFKMPKFKMPTFGSKGHK--------LEGPDVDINLP------STDIEVKAP--DVDITAPDV 1374          

HSP 30 Score: 54.299 bits (129), Expect = 2.849e-7
Identity = 61/210 (29.05%), Postives = 87/210 (41.43%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G+K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 2161 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPKIEGDIKAPDVDIGEAEMDIEGQK----AGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 2362          

HSP 31 Score: 54.299 bits (129), Expect = 2.949e-7
Identity = 54/171 (31.58%), Postives = 83/171 (48.54%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+AP I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3318 LNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3478          

HSP 32 Score: 54.299 bits (129), Expect = 3.240e-7
Identity = 62/210 (29.52%), Postives = 89/210 (42.38%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGK-------------------VKKPKGEI---DIDVEGPE----------------------VDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K                   VK P  +I   D+D++GP+                      VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4951 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKIGGDLDVKAPNIEGDIKTPDLDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDLNLPSTDIEVKAPDVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 5152          

HSP 33 Score: 53.9138 bits (128), Expect = 3.653e-7
Identity = 60/210 (28.57%), Postives = 85/210 (40.48%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDV-----------------------------DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD+E PD+++                             D+  K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 1789 DASLPKIEGDIKAP--DLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGRAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 1990          

HSP 34 Score: 53.9138 bits (128), Expect = 3.684e-7
Identity = 61/210 (29.05%), Postives = 90/210 (42.86%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGK-------------------VKKPKGEI---DIDVEGPE----------------------VDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K                   VK P+ +I   D+D++GP+                      VD+++ G K KGD D +L  P ++ D+  PD+
Sbjct: 1975 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAPDVDIKGPDAKLKGPKFNMPKMPGMNVSMPDVDLNLKGPKVKGDIDASL--PKIEGDMKTPDL 2176          

HSP 35 Score: 53.9138 bits (128), Expect = 3.980e-7
Identity = 65/235 (27.66%), Postives = 104/235 (44.26%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG------------EI---DIDVEGPEVDI---DIHGKKPKGDF----DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP-VSDSDRNFNSNLLSKSFDLPQ 574
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ +    D+DI   E+DI+G K      F +P +K+PTF  K  K +G            E+   D+D+  P+VD+   D   K PK +      +N+  P+VD ++  P        ++ +   S P I+  I+ P V+    + N +     F++P+
Sbjct: 1045 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPELDLKLKGPKVGGDLDVKAPKIEGEIKTPDVDIGGAELDIEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGP-------KVKGDIDASLPKIEGDIKTPSVATKGPDVNIDGTKAGFEMPK 1266          

HSP 36 Score: 53.1434 bits (126), Expect = 7.565e-7
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct:  900 LNIKGPKMEKPEFDIKLKGPKAVGDLDVKGPKIEEDIEAPDVDIGGAELDIEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPEVDITAPDFDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 1060          

HSP 37 Score: 52.7582 bits (125), Expect = 8.101e-7
Identity = 59/208 (28.37%), Postives = 99/208 (47.60%), Query Frame = 2
Query:   29 LPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG------------EI---DIDVEGPEVDI---DIHGKKPKGDF----DVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQP-VSDSDRNFNSNLLSKSFDLPQ 574
            +P  K+P     +K PK    +E P++D+ + G K  G  DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G            E+   D+D+  P+VD+   D   K PK +      +N+  P+VD ++  P        ++ +   S P I+  I+ P V+    + N +     F++P+
Sbjct: 1450 MPKVKMPSIN--IKGPK----MEKPEVDIRLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDITAPDVDMKGPDTKFKGPKFNMPKMPGMNVSMPDVDFNLKGP-------KVKGDIDASLPKIEGDIKTPSVATKGPDVNIDGTKAGFEMPK 1638          

HSP 38 Score: 52.7582 bits (125), Expect = 8.601e-7
Identity = 58/178 (32.58%), Postives = 83/178 (46.63%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIE----------VDIDGKKKK-HGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  ++P  + KLK PK  GDLDV+AP I       DVDI G +     PKG   +              ++ P+VDI+    DI+++          VDI G   K  G  FN+P  K+P              ++V  P+VD ++ G K KGD D +L  P ++ DI  PD+
Sbjct: 1644 LNIKGPKMEMPDVDIKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDTEGPKGGFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMP--KMPG-------------MNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDIKAPDL 1804          

HSP 39 Score: 52.373 bits (124), Expect = 1.131e-6
Identity = 61/210 (29.05%), Postives = 86/210 (40.95%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K    DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 2533 DASLPKIEGDMKT--SDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 2734          

HSP 40 Score: 52.373 bits (124), Expect = 1.131e-6
Identity = 61/210 (29.05%), Postives = 86/210 (40.95%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            D  LPK EG +K    DLD++ PD+++D                 I G            K PK   DL+VK PN++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 2905 DASLPKIEGDMKT--SDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPNIEGDIKAPDVDIGRAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDSKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3106          

HSP 41 Score: 52.373 bits (124), Expect = 1.222e-6
Identity = 54/171 (31.58%), Postives = 83/171 (48.54%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDID--------------VDIHGKK-----PK------GEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+AP I+              +DI G+K     PK      G     ++ P+VD++    DID++V          +D   PD  +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4062 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKV--------PDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 4222          

HSP 42 Score: 52.373 bits (124), Expect = 1.243e-6
Identity = 62/208 (29.81%), Postives = 95/208 (45.67%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV--------------DIDIHGKKP--------------KG------DFDVNLKKPNVDVDINKPDIVYPIFDIQ-SNFQFSKP 484
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P++              ++DI G+K               KG      D DVNL   ++DV +   DI  P  DI+ S+ +F  P
Sbjct: 3971 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKGGFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGP 4176          

HSP 43 Score: 52.373 bits (124), Expect = 1.297e-6
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3504 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3664          

HSP 44 Score: 51.9878 bits (123), Expect = 1.488e-6
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHG-----KKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G     + PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 4806 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGADLDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 4966          

HSP 45 Score: 51.9878 bits (123), Expect = 1.706e-6
Identity = 51/171 (29.82%), Postives = 81/171 (47.37%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDIDVDIHG------------KKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+AP I+ DI              + PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3132 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3292          

HSP 46 Score: 51.6026 bits (122), Expect = 1.973e-6
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+
Sbjct: 3690 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKIPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDL 3850          

HSP 47 Score: 51.2174 bits (121), Expect = 2.529e-6
Identity = 66/230 (28.70%), Postives = 92/230 (40.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKK-----PNVDVDINKPDIVYPIFDIQSNFQFSK 481
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L K        D+DI  PD+   I   ++ F+  K
Sbjct: 2347 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTSDLDIKGPDVN--IDGTKAGFEMPK 2568          

HSP 48 Score: 51.2174 bits (121), Expect = 2.875e-6
Identity = 66/230 (28.70%), Postives = 92/230 (40.00%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG--------EIDIDVEGPEVDI------------------------------------DIHGKKPKGDFDVNLKK-----PNVDVDINKPDIVYPIFDIQSNFQFSK 481
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D    D+DI   E+DI+G K      F +P +K+PTF  K  K +G          DI+V+ PEVDI                                    ++ G K KGD D +L K        D+DI  PD+   I   ++ F+  K
Sbjct: 2719 DASLPKIEGDMKTP--DLDIKRPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGEAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPEVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTSDLDIKGPDVN--IDGTKAGFEMPK 2940          

HSP 49 Score: 50.8322 bits (120), Expect = 3.159e-6
Identity = 60/185 (32.43%), Postives = 83/185 (44.86%), Query Frame = 2
Query:   29 LPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKG------------EI---DIDVEGPEVDIDIHGKKPKG----------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            +P  K+P     +K PK    +E PD+D+ + G K  G  DL+VK P ++ D    D+DI   E+D +G K      F +P +K+PTF  K  K +G            E+   D+D+  P VDI     K KG                D D NLK P V  D+D + P    DI  P  DI+ 
Sbjct: 1636 MPKVKMPTLN--IKGPK----MEMPDVDIKLKGPKVGG--DLDVKAPKIEGDIKAPDVDIGGAELDTEGPKG----GFKMPTFKMPTFGSKGHKLEGPDVDINLPSTDIEVKAPDVDIAAPHVDIKGPDSKFKGTKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDIKAPDLDIEG 1808          

HSP 50 Score: 50.447 bits (119), Expect = 4.929e-6
Identity = 64/212 (30.19%), Postives = 88/212 (41.51%), Query Frame = 2
Query:   35 DWKLPKFEGKLKKPKGDLDVEAPDIDVD-----------------IHG------------KKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGE---------------IDIDVEGPEVDIDIHGKKPKG----------------DFDVNLKKPNV--DVDINKP----DIVYPIFDIQS 463
            D  LPK EG +K P  DLD++ PD+++D                 I G            K PK   DL+VK P ++ D     +DI   E+DI+G+K      F +P +K+PTF  K  K +G                 D+D+  P+VDI     K KG                D D NLK P V  D+D + P    D+  P  DI+ 
Sbjct: 4021 DASLPKIEGDMKTP--DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPVVDIGGAELDIEGQKG----GFRMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKG 4226          
BLAST of SMED30000771 vs. Ensembl Medaka
Match: ENSORLT00000002200.2 (pep primary_assembly:ASM223467v1:13:4398514:4425977:-1 gene:ENSORLG00000001764.2 transcript:ENSORLT00000002200.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.713e-9
Identity = 63/187 (33.69%), Postives = 90/187 (48.13%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKP--KGDL---DVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDI----DGKKKKHGLDFNLPDWKLPTFEGKVKKP--KGE----------------IDIDVEG--------PEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQ 472
            LDI LP  K       ++ P  KGD+   +V++PD+DV+I G +  G     +  PNVD+ F K   D EV++    DGK K    D +LP   LP F+  VK P  KG+                + +DV+         P +DI +   K KG FDVN++ P V  DI+ P++  P  D+  N Q
Sbjct:  192 LDITLPKMKTKGLNVNVEGPEVKGDMSLSEVKSPDVDVNIKGPEVVGGY---ISLPNVDVAFPKTKGDFEVEVPDMKDGKFKMPKFDVSLPKVSLPKFDANVKGPDLKGKAEMPSVDISVPKATTDVGVDVDTGKGSKFHMPSLDISLPKMKAKG-FDVNIEGPEVKGDISLPEVRSP--DVDFNLQ 372          

HSP 2 Score: 54.299 bits (129), Expect = 2.860e-7
Identity = 67/237 (28.27%), Postives = 101/237 (42.62%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLD---VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDID-GKKKKH---GLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKG-DFDVNLKKPNVD---VDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANF---DISTSLSST 670
            K K   ++ +PD K    +GK K PK D+    V  P  D ++ G   KG+ ++    P+VDI   K   D+ VD+D GK  K     LD +LP  K   F           D+++EGPEV  DI   + +  D D NL+ P V+   + + K DI  P    + +F+   P IK                      FD+  P   + +F +S+       +A     DIS +  +T
Sbjct:  252 KTKGDFEVEVPDMK----DGKFKMPKFDVSLPKVSLPKFDANVKGPDLKGKAEM----PSVDISVPKATTDVGVDVDTGKGSKFHMPSLDISLPKMKAKGF-----------DVNIEGPEVKGDISLPEVRSPDVDFNLQGPEVEGGKLSLPKVDIALP--KTEGDFEVEGPDIK--------------GGKFKMPKFDVSLPKVSLPKFDASVEGPDLKGKAEMQSVDISVAKGTT 453          
BLAST of SMED30000771 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 56.9954 bits (136), Expect = 3.546e-8
Identity = 51/151 (33.77%), Postives = 80/151 (52.98%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLD--FNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI   +V+IDG K    LD  F +P +K+PTF  K  K        +EGP+VD+++  K      ++ +K P  D+DI  PD+
Sbjct:  604 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKVGGDLDGGFKMPKFKMPTFGSKSHK--------LEGPDVDVNLPSK------NIEVKTP--DMDIALPDV 736          

HSP 2 Score: 53.5286 bits (127), Expect = 4.988e-7
Identity = 79/313 (25.24%), Postives = 127/313 (40.58%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEID--------------LNVKNPNVDIDFHKMDIDI---EVDIDGKKKKHGLDFNLPDWKLPTFEGK-------------------VKKPKGEI---DIDVEGPE----------------------VDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDI-----QSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSI---IPDKFSSRANFDISTSLSSTFQS----IPDDPSINIEQPN 718
            +DI  PD+ +   + K K PK        ++V  PD+D ++ G K KG+ID              L++K P+++ D    D+DI   E+DI+G K      F +P +K+PTF  K                   VK P  +I   D D++GP+                      VD ++ G K KGD D +L  P ++ D+  PD+     D+     ++ F+  K  I    + P             SK   L  P   +   S+ I   +PD   +  + DI  S  + F+     +P  P +N+  P+
Sbjct:  224 VDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASLPKIEGDMKTPDLDIKGPDIEGDIKAPDVDIGGAELDIEGPKG----GFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKIMPKFKMPT----------FGSKGHKLEGPDVDVNLPSTDIDVKVPDVDITAPDVDIKGS-DAKFKGPKFNMPKMPGMNVSMPD 519          

HSP 3 Score: 53.1434 bits (126), Expect = 5.484e-7
Identity = 55/183 (30.05%), Postives = 87/183 (47.54%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQ 472
            L+I  P  + P+F+ KLK PK  GDLDV+ P I       DVDI G +     PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+     DI+ + +
Sbjct:  129 LNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKGPDIEGDIK 301          

HSP 4 Score: 52.373 bits (124), Expect = 1.064e-6
Identity = 71/240 (29.58%), Postives = 103/240 (42.92%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK--GDLDVEAPDI-------DVDIHGKK-----PKGEI------------------------DLNVKNPNVDIDFHKMDIDI---EVDIDGKK--------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEV-------DIDIHGKK-----PKGDF--------------------DVNLKKPNVDVDINKP--DIVYPIFDIQS-NFQFSKP 484
            L+I  P  + P+F+ KLK PK  GDLDV+AP I       DVDI G +     PKG                          D++   P ++ D    D+DI   +V+IDG K        K   L+   P  + P F+ K+K PK   D+DV+ P++       D+DI G +     PKG F                    DV++  P+ D+++  P  DI  P FDI+  + +F  P
Sbjct:    4 LNIKGPKMEKPQFDLKLKGPKVGGDLDVKAPKIEGDIKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSKGHKLEGPDVKGDIDASLPKIEGDMKTPDLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKPEFDLKLKGPKVGGDLDVKVPKIEGDLKAPDVDIGGAELDIEGPKGGFKMPKFKMPTFGSTGHKLEGPDVDVNLPSTDIEVKAPDVDITAPDFDIKGPDAKFKGP 243          

HSP 5 Score: 52.373 bits (124), Expect = 1.101e-6
Identity = 47/146 (32.19%), Postives = 73/146 (50.00%), Query Frame = 2
Query:   17 LDINLPDWKLPKFEGKLKKPK------GDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            +DI  PD  +   + K K PK        ++V  PD+D ++ G K KG+ID ++  P ++ D    D+DI+V +     K      +P +K+PTF  K  K        +EGP+VD+++    P  D DV +     DVDI  PD+
Sbjct:  484 VDITAPDVDIKGSDAKFKGPKFNMPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVKMPSLNIKGPKMEKMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIDVKVP----DVDITAPDV 611          

HSP 6 Score: 51.2174 bits (121), Expect = 2.228e-6
Identity = 50/175 (28.57%), Postives = 83/175 (47.43%), Query Frame = 2
Query:   44 LPKFEGKLKKPKGDLDVEAPDIDVD-----IHGKKPKGEIDL-------------NVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEI----DIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQ---SNFQFSKPVIK 493
            LPK EG +K P  DLD++ PD+++D     I G  PKG   +              ++ P+VD++    DI++        K   +D   PD+ +   + K K PK  +     ++V  P+VD ++ G K KGD D +L  P ++ D+  PD+   + D+    +   F  P +K
Sbjct:  782 LPKIEGDIKAP--DLDIKGPDVNIDGTKLDIEG--PKGGFKMPKFKMPTFGSKGHKLEGPDVDVNLPSTDIEV--------KAPDVDITAPDFDIKGPDAKFKGPKFNVPKMPGMNVSMPDVDFNLKGPKVKGDIDASL--PKIEGDMKTPDLDIKVPDVNIDGTKAGFEMPKVK 942          
BLAST of SMED30000771 vs. Ensembl Medaka
Match: ENSORLT00000000108.2 (neuroblast differentiation-associated protein AHNAK [Source:NCBI gene;Acc:105358319])

HSP 1 Score: 53.1434 bits (126), Expect = 6.992e-7
Identity = 55/181 (30.39%), Postives = 87/181 (48.07%), Query Frame = 2
Query:   23 INLPDWKLPKFEGKLKKPKGDLDVEAPDIDV-----DIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDI--------DVEGPEVDID------------IHGKKPKG--------DFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
            + +P + LP F+G    P+GD  ++ PD +V     D+ G  PK ++D +V  P+    F K + D+ E D+ G K K G+D   PD KLP  + K   PK +++         +++GP+ D++            + G  PKG          D NLK P V   +N PD+  P  D++S
Sbjct:  761 MKMPKFNLPTFKG----PEGDAKLDHPDFNVNGPNLDLRG--PKADVDADVSGPSGK--FKKPNFDLPEFDVSGPKVKGGID--APDIKLPKMDPKT--PKLDLNAPDVNLKMPELQGPDWDVNGPSGKLKMPKMNLSGTLPKGPNLDADLTSPDFNLKAPKVKGGMNTPDVDLPNVDLKS 929          

HSP 2 Score: 49.6766 bits (117), Expect = 8.073e-6
Identity = 54/178 (30.34%), Postives = 80/178 (44.94%), Query Frame = 2
Query:   23 INLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDI-EVDIDGKKKKHG-----------------LDFNLPD--WKLPTFEG----------KVKKPKGEIDIDV-EGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS 463
             NLP  K P+ + KL  P  D +V  P++++    + PK ++D +V  P+    F K + D+ E D+ G K K G                 LD N PD   K+P  +G          K+K PK  +   + +GP +D D+         D NLK P V   IN PD+  P  D++S
Sbjct:  574 FNLPTHKSPEVDAKLDHP--DFNVNGPNLNL----RGPKADLDADVSGPSGK--FKKPNFDLPEFDVSGPKVKGGIDAPHIKLPKMDPKTPKLDLNAPDVNLKMPELQGPDWDVNGPSGKLKMPKMNLSGTLPKGPNLDADLTSP------DFNLKAPKVKGGINTPDVDLPNVDLKS 737          
BLAST of SMED30000771 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 358/367 (97.55%), Postives = 362/367 (98.64%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 1102
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKG FDVN KKPN+D+DINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVN+EFLNREQPFLKRNSDSYDNSDIL+NPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT
Sbjct: 1981 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNKEFLNREQPFLKRNSDSYDNSDILTNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 2347          

HSP 2 Score: 244.588 bits (623), Expect = 2.591e-70
Identity = 123/145 (84.83%), Postives = 134/145 (92.41%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct: 1352 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 1496          

HSP 3 Score: 241.891 bits (616), Expect = 2.043e-69
Identity = 122/143 (85.31%), Postives = 132/143 (92.31%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP 430
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KP
Sbjct:  875 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP 1017          

HSP 4 Score: 234.958 bits (598), Expect = 4.160e-67
Identity = 120/147 (81.63%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1118 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDI 1264          

HSP 5 Score: 234.187 bits (596), Expect = 8.485e-67
Identity = 121/147 (82.31%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPN+DVDINKPDI
Sbjct: 1671 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDI 1815          

HSP 6 Score: 231.876 bits (590), Expect = 4.562e-66
Identity = 118/147 (80.27%), Postives = 133/147 (90.48%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct: 1196 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 1342          

HSP 7 Score: 231.491 bits (589), Expect = 6.241e-66
Identity = 118/147 (80.27%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  563 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 709          

HSP 8 Score: 229.18 bits (583), Expect = 3.866e-65
Identity = 117/147 (79.59%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  719 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 865          

HSP 9 Score: 228.024 bits (580), Expect = 1.174e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct: 1747 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 1893          

HSP 10 Score: 227.639 bits (579), Expect = 1.576e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKV KPKGEIDIDVEGPEVDIDIHGKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1825 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDI 1971          

HSP 11 Score: 225.713 bits (574), Expect = 6.184e-64
Identity = 119/147 (80.95%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKL  FEGK+KK KG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  347 KKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 491          

HSP 12 Score: 224.942 bits (572), Expect = 1.359e-63
Identity = 115/147 (78.23%), Postives = 130/147 (88.44%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct:  641 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 787          

HSP 13 Score: 191.045 bits (484), Expect = 4.506e-52
Identity = 115/209 (55.02%), Postives = 130/209 (62.20%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGK-----------------VKKPKGEID---------------------------------------------IDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGK                 +KKP  +ID                                             IDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  423 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 631          

HSP 14 Score: 188.734 bits (478), Expect = 2.697e-51
Identity = 104/147 (70.75%), Postives = 127/147 (86.39%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+ KPKG  D+DVE P++D+DIHGKKPKG+ID+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1903 KKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 2047          

HSP 15 Score: 186.422 bits (472), Expect = 1.705e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct:  797 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 941          

HSP 16 Score: 186.422 bits (472), Expect = 1.705e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1274 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 1418          

HSP 17 Score: 179.104 bits (453), Expect = 5.670e-48
Identity = 102/145 (70.34%), Postives = 115/145 (79.31%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINL   ++  F+  + K K D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1056 KKKHGIDINL---QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1186          

HSP 18 Score: 175.252 bits (443), Expect = 9.452e-47
Identity = 113/165 (68.48%), Postives = 127/165 (76.97%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGE-------IDLNVKNPNVDIDF----HKMDIDI-------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG  DLD+  P+ID D + KK K +       +D+NV+ P+  ID     HK DID+       ++D+DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1575 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1739          

HSP 19 Score: 169.474 bits (428), Expect = 1.039e-44
Identity = 108/176 (61.36%), Postives = 118/176 (67.05%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL TFEGKVKK KGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct:  251 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 415          

HSP 20 Score: 151.754 bits (382), Expect = 9.222e-39
Identity = 92/166 (55.42%), Postives = 109/166 (65.66%), Query Frame = 2
Query:    2 KKKHGLDINLPDWK---------------------LPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG++I LP  K                     + K   +LKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIE+   G  +K              FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct:   43 KKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI---GSYQK--------------FEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 191          

HSP 21 Score: 142.124 bits (357), Expect = 1.282e-35
Identity = 80/134 (59.70%), Postives = 99/134 (73.88%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPK--GDFDVN 391
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +  GD  V+
Sbjct: 1428 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVD 1559          

HSP 22 Score: 124.405 bits (311), Expect = 9.603e-30
Identity = 94/236 (39.83%), Postives = 126/236 (53.39%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDF----------------HKMDIDIEVD-----------IDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD-----------INKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSD-------RNFNSNLLSKSFDL 568
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID                 H++  D+ VD           +  KKKKHG+D NL   ++  F+  V   KG++D++VE P+  IDI GKK KGD DV+L  P VD+D           IN PD   P F  +   +  K  I   +E P  D D        +F+ NL   + D+
Sbjct:  951 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL---QIGNFQNLV--IKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTF--EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV 1179          

HSP 23 Score: 103.99 bits (258), Expect = 4.556e-23
Identity = 69/179 (38.55%), Postives = 100/179 (55.87%), Query Frame = 2
Query:   98 APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWK---------------------LPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDL 568
             P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K                     +     ++KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI   I   Q    +  KP  +  I+    + D + + N    + D+
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDV 175          

HSP 24 Score: 92.0485 bits (227), Expect = 2.786e-19
Identity = 78/219 (35.62%), Postives = 102/219 (46.58%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDID-----------------------------VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDIN 424
            H  DI++      KFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D                        IDGKK                          KKHG+D NLP+WK P F  K KK KG++D+D                             VE P+  IDI GKK KGD DV+L  P VD+D++
Sbjct:  126 HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 344          
BLAST of SMED30000771 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 358/367 (97.55%), Postives = 362/367 (98.64%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 1102
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKG FDVN KKPN+D+DINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVN+EFLNREQPFLKRNSDSYDNSDIL+NPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT
Sbjct: 1983 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNKEFLNREQPFLKRNSDSYDNSDILTNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 2349          

HSP 2 Score: 244.202 bits (622), Expect = 2.770e-70
Identity = 123/145 (84.83%), Postives = 134/145 (92.41%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct: 1354 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 1498          

HSP 3 Score: 241.891 bits (616), Expect = 1.967e-69
Identity = 122/143 (85.31%), Postives = 132/143 (92.31%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP 430
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KP
Sbjct:  877 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKP 1019          

HSP 4 Score: 234.958 bits (598), Expect = 4.447e-67
Identity = 120/147 (81.63%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1120 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDI 1266          

HSP 5 Score: 234.187 bits (596), Expect = 9.070e-67
Identity = 121/147 (82.31%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPN+DVDINKPDI
Sbjct: 1673 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDI 1817          

HSP 6 Score: 231.876 bits (590), Expect = 4.830e-66
Identity = 118/147 (80.27%), Postives = 133/147 (90.48%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct: 1198 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 1344          

HSP 7 Score: 231.491 bits (589), Expect = 6.672e-66
Identity = 118/147 (80.27%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  565 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 711          

HSP 8 Score: 229.18 bits (583), Expect = 4.094e-65
Identity = 117/147 (79.59%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  721 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 867          

HSP 9 Score: 228.024 bits (580), Expect = 1.243e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct: 1749 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 1895          

HSP 10 Score: 227.639 bits (579), Expect = 1.669e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKV KPKGEIDIDVEGPEVDIDIHGKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1827 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDI 1973          

HSP 11 Score: 225.713 bits (574), Expect = 6.011e-64
Identity = 119/147 (80.95%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKL  FEGK+KK KG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  347 KKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 491          

HSP 12 Score: 224.942 bits (572), Expect = 1.360e-63
Identity = 115/147 (78.23%), Postives = 130/147 (88.44%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct:  643 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 789          

HSP 13 Score: 188.734 bits (478), Expect = 2.697e-51
Identity = 104/147 (70.75%), Postives = 127/147 (86.39%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+ KPKG  D+DVE P++D+DIHGKKPKG+ID+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1905 KKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 2049          

HSP 14 Score: 186.422 bits (472), Expect = 1.706e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct:  799 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 943          

HSP 15 Score: 186.422 bits (472), Expect = 1.706e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1276 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 1420          

HSP 16 Score: 179.104 bits (453), Expect = 5.565e-48
Identity = 102/145 (70.34%), Postives = 115/145 (79.31%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINL   ++  F+  + K K D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1058 KKKHGIDINL---QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1188          

HSP 17 Score: 175.252 bits (443), Expect = 9.365e-47
Identity = 113/165 (68.48%), Postives = 127/165 (76.97%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGE-------IDLNVKNPNVDIDF----HKMDIDI-------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG  DLD+  P+ID D + KK K +       +D+NV+ P+  ID     HK DID+       ++D+DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1577 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1741          

HSP 18 Score: 174.866 bits (442), Expect = 1.195e-46
Identity = 108/211 (51.18%), Postives = 128/211 (60.66%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVK--------KPKGEIDIDVEGPEVDIDI-----------------HG---------------------------------------KKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKV+        K +G+ D++++ P VDIDI                 HG                                       KK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  423 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 633          

HSP 19 Score: 169.474 bits (428), Expect = 1.020e-44
Identity = 108/176 (61.36%), Postives = 118/176 (67.05%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL TFEGKVKK KGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct:  251 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 415          

HSP 20 Score: 151.754 bits (382), Expect = 9.054e-39
Identity = 92/166 (55.42%), Postives = 109/166 (65.66%), Query Frame = 2
Query:    2 KKKHGLDINLPDWK---------------------LPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG++I LP  K                     + K   +LKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIE+   G  +K              FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct:   43 KKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI---GSYQK--------------FEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 191          

HSP 21 Score: 142.124 bits (357), Expect = 1.283e-35
Identity = 80/134 (59.70%), Postives = 99/134 (73.88%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPK--GDFDVN 391
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +  GD  V+
Sbjct: 1430 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVD 1561          

HSP 22 Score: 124.405 bits (311), Expect = 9.692e-30
Identity = 94/236 (39.83%), Postives = 126/236 (53.39%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDF----------------HKMDIDIEVD-----------IDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD-----------INKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSD-------RNFNSNLLSKSFDL 568
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID                 H++  D+ VD           +  KKKKHG+D NL   ++  F+  V   KG++D++VE P+  IDI GKK KGD DV+L  P VD+D           IN PD   P F  +   +  K  I   +E P  D D        +F+ NL   + D+
Sbjct:  953 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL---QIGNFQNLV--IKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTF--EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV 1181          

HSP 23 Score: 103.99 bits (258), Expect = 4.598e-23
Identity = 69/179 (38.55%), Postives = 100/179 (55.87%), Query Frame = 2
Query:   98 APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWK---------------------LPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDL 568
             P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K                     +     ++KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI   I   Q    +  KP  +  I+    + D + + N    + D+
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDV 175          

HSP 24 Score: 92.0485 bits (227), Expect = 2.786e-19
Identity = 78/219 (35.62%), Postives = 102/219 (46.58%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDID-----------------------------VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDIN 424
            H  DI++      KFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D                        IDGKK                          KKHG+D NLP+WK P F  K KK KG++D+D                             VE P+  IDI GKK KGD DV+L  P VD+D++
Sbjct:  126 HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 344          
BLAST of SMED30000771 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 358/367 (97.55%), Postives = 362/367 (98.64%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 1102
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKG FDVN KKPN+D+DINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVN+EFLNREQPFLKRNSDSYDNSDIL+NPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT
Sbjct: 1971 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNKEFLNREQPFLKRNSDSYDNSDILTNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 2337          

HSP 2 Score: 244.588 bits (623), Expect = 2.422e-70
Identity = 123/145 (84.83%), Postives = 134/145 (92.41%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct: 1342 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 1486          

HSP 3 Score: 244.588 bits (623), Expect = 2.589e-70
Identity = 126/161 (78.26%), Postives = 139/161 (86.34%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKP 484
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+     +I  +    KP
Sbjct:  875 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMD---IEIDGDLSVDKP 1032          

HSP 4 Score: 234.958 bits (598), Expect = 4.078e-67
Identity = 120/147 (81.63%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1108 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDI 1254          

HSP 5 Score: 234.187 bits (596), Expect = 8.318e-67
Identity = 121/147 (82.31%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPN+DVDINKPDI
Sbjct: 1661 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDI 1805          

HSP 6 Score: 231.876 bits (590), Expect = 4.514e-66
Identity = 118/147 (80.27%), Postives = 133/147 (90.48%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct: 1186 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 1332          

HSP 7 Score: 231.491 bits (589), Expect = 6.236e-66
Identity = 118/147 (80.27%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  563 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 709          

HSP 8 Score: 229.18 bits (583), Expect = 3.863e-65
Identity = 117/147 (79.59%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  719 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 865          

HSP 9 Score: 228.024 bits (580), Expect = 1.162e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct: 1737 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 1883          

HSP 10 Score: 227.639 bits (579), Expect = 1.560e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKV KPKGEIDIDVEGPEVDIDIHGKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1815 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDI 1961          

HSP 11 Score: 226.098 bits (575), Expect = 4.736e-64
Identity = 119/147 (80.95%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKL  FEGK+KK KG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  347 KKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 491          

HSP 12 Score: 224.942 bits (572), Expect = 1.082e-63
Identity = 115/147 (78.23%), Postives = 130/147 (88.44%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct:  641 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 787          

HSP 13 Score: 191.43 bits (485), Expect = 3.491e-52
Identity = 115/209 (55.02%), Postives = 130/209 (62.20%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGK-----------------VKKPKGEID---------------------------------------------IDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGK                 +KKP  +ID                                             IDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  423 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 631          

HSP 14 Score: 189.119 bits (479), Expect = 2.149e-51
Identity = 104/147 (70.75%), Postives = 127/147 (86.39%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+ KPKG  D+DVE P++D+DIHGKKPKG+ID+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1893 KKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 2037          

HSP 15 Score: 186.808 bits (473), Expect = 1.359e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct:  797 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 941          

HSP 16 Score: 186.808 bits (473), Expect = 1.359e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1264 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 1408          

HSP 17 Score: 179.104 bits (453), Expect = 4.397e-48
Identity = 102/145 (70.34%), Postives = 115/145 (79.31%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINL   ++  F+  + K K D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1046 KKKHGIDINL---QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1176          

HSP 18 Score: 175.637 bits (444), Expect = 7.829e-47
Identity = 113/165 (68.48%), Postives = 127/165 (76.97%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGE-------IDLNVKNPNVDIDF----HKMDIDI-------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG  DLD+  P+ID D + KK K +       +D+NV+ P+  ID     HK DID+       ++D+DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1565 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1729          

HSP 19 Score: 169.474 bits (428), Expect = 8.453e-45
Identity = 108/176 (61.36%), Postives = 118/176 (67.05%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL TFEGKVKK KGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct:  251 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 415          

HSP 20 Score: 151.754 bits (382), Expect = 7.797e-39
Identity = 92/166 (55.42%), Postives = 109/166 (65.66%), Query Frame = 2
Query:    2 KKKHGLDINLPDWK---------------------LPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG++I LP  K                     + K   +LKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIE+   G  +K              FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct:   43 KKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI---GSYQK--------------FEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 191          

HSP 21 Score: 142.51 bits (358), Expect = 1.105e-35
Identity = 80/134 (59.70%), Postives = 99/134 (73.88%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPK--GDFDVN 391
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +  GD  V+
Sbjct: 1418 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVD 1549          

HSP 22 Score: 134.806 bits (338), Expect = 3.247e-33
Identity = 97/226 (42.92%), Postives = 127/226 (56.19%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDID-----------------GKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD-----------INKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSD-------RNFNSNLLSKSFDL 568
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D D                  KKKKHG+D NL   ++  F+  V   KG++D++VE P+  IDI GKK KGD DV+L  P VD+D           IN PD   P F  +   +  K  I   +E P  D D        +F+ NL   + D+
Sbjct:  951 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGDLSVDKPDADIDIDIDVSNKKKKHGIDINL---QIGNFQNLV--IKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTF--EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV 1169          

HSP 23 Score: 103.99 bits (258), Expect = 4.053e-23
Identity = 69/179 (38.55%), Postives = 100/179 (55.87%), Query Frame = 2
Query:   98 APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWK---------------------LPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDL 568
             P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K                     +     ++KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI   I   Q    +  KP  +  I+    + D + + N    + D+
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDV 175          

HSP 24 Score: 92.4337 bits (228), Expect = 2.504e-19
Identity = 92/283 (32.51%), Postives = 126/283 (44.52%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDID-----------------------------VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP------DIVYPIFDIQS---NFQFSKPVIKSHIEQPVSDSD-------RNFNSNLLSKSFDL 568
            H  DI++      KFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D                        IDGKK                          KKHG+D NLP+WK P F  K KK KG++D+D                             VE P+  IDI GKK KGD DV+L  P VD+D++        DI  P + +Q+     + +K  I   +E P  D D        +F+ NL   + D+
Sbjct:  126 HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV 408          
BLAST of SMED30000771 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 358/367 (97.55%), Postives = 362/367 (98.64%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 1102
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKG FDVN KKPN+D+DINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVN+EFLNREQPFLKRNSDSYDNSDIL+NPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT
Sbjct: 1993 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNKEFLNREQPFLKRNSDSYDNSDILTNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 2359          

HSP 2 Score: 244.588 bits (623), Expect = 2.227e-70
Identity = 142/245 (57.96%), Postives = 175/245 (71.43%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQS--IPDDPSINIEQPNSAID 730
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+     DI+ +           ++ P  D D +   + +S    + +P + I       + +K   +   DI+  + + FQ+  I     +N+E P+++ID
Sbjct:  875 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM-----DIEIDVDLG-------VKTPSIDIDIDGKKHRISGDLSVDKPDADID--IDIDVSNK-KKKHGIDINLQIGN-FQNLVIKGKLDVNVEVPDASID 1103          

HSP 3 Score: 244.202 bits (622), Expect = 2.669e-70
Identity = 123/145 (84.83%), Postives = 134/145 (92.41%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct: 1364 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 1508          

HSP 4 Score: 234.958 bits (598), Expect = 4.536e-67
Identity = 120/147 (81.63%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1130 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDI 1276          

HSP 5 Score: 234.187 bits (596), Expect = 9.430e-67
Identity = 121/147 (82.31%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPN+DVDINKPDI
Sbjct: 1683 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDI 1827          

HSP 6 Score: 231.876 bits (590), Expect = 4.974e-66
Identity = 118/147 (80.27%), Postives = 133/147 (90.48%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct: 1208 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 1354          

HSP 7 Score: 231.491 bits (589), Expect = 6.936e-66
Identity = 118/147 (80.27%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  563 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 709          

HSP 8 Score: 229.18 bits (583), Expect = 4.216e-65
Identity = 117/147 (79.59%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  719 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 865          

HSP 9 Score: 227.639 bits (579), Expect = 1.268e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct: 1759 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 1905          

HSP 10 Score: 227.639 bits (579), Expect = 1.686e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKV KPKGEIDIDVEGPEVDIDIHGKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1837 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDI 1983          

HSP 11 Score: 226.098 bits (575), Expect = 5.218e-64
Identity = 119/147 (80.95%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKL  FEGK+KK KG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  347 KKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 491          

HSP 12 Score: 224.942 bits (572), Expect = 1.158e-63
Identity = 115/147 (78.23%), Postives = 130/147 (88.44%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct:  641 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 787          

HSP 13 Score: 191.43 bits (485), Expect = 3.808e-52
Identity = 115/209 (55.02%), Postives = 130/209 (62.20%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGK-----------------VKKPKGEID---------------------------------------------IDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGK                 +KKP  +ID                                             IDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  423 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 631          

HSP 14 Score: 189.119 bits (479), Expect = 2.257e-51
Identity = 104/147 (70.75%), Postives = 127/147 (86.39%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+ KPKG  D+DVE P++D+DIHGKKPKG+ID+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1915 KKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 2059          

HSP 15 Score: 186.808 bits (473), Expect = 1.441e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct:  797 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 941          

HSP 16 Score: 186.808 bits (473), Expect = 1.441e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1286 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 1430          

HSP 17 Score: 179.104 bits (453), Expect = 4.617e-48
Identity = 102/145 (70.34%), Postives = 115/145 (79.31%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINL   ++  F+  + K K D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1068 KKKHGIDINL---QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1198          

HSP 18 Score: 175.637 bits (444), Expect = 8.455e-47
Identity = 113/165 (68.48%), Postives = 127/165 (76.97%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGE-------IDLNVKNPNVDIDF----HKMDIDI-------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG  DLD+  P+ID D + KK K +       +D+NV+ P+  ID     HK DID+       ++D+DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1587 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1751          

HSP 19 Score: 169.474 bits (428), Expect = 8.874e-45
Identity = 108/176 (61.36%), Postives = 118/176 (67.05%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL TFEGKVKK KGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct:  251 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 415          

HSP 20 Score: 151.754 bits (382), Expect = 7.958e-39
Identity = 92/166 (55.42%), Postives = 109/166 (65.66%), Query Frame = 2
Query:    2 KKKHGLDINLPDWK---------------------LPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG++I LP  K                     + K   +LKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIE+   G  +K              FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct:   43 KKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI---GSYQK--------------FEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 191          

HSP 21 Score: 142.51 bits (358), Expect = 1.139e-35
Identity = 80/134 (59.70%), Postives = 99/134 (73.88%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPK--GDFDVN 391
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +  GD  V+
Sbjct: 1440 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVD 1571          

HSP 22 Score: 128.642 bits (322), Expect = 3.932e-31
Identity = 97/248 (39.11%), Postives = 128/248 (51.61%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDID---------------------------------------GKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD-----------INKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSD-------RNFNSNLLSKSFDL 568
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D+D                                        KKKKHG+D NL   ++  F+  V   KG++D++VE P+  IDI GKK KGD DV+L  P VD+D           IN PD   P F  +   +  K  I   +E P  D D        +F+ NL   + D+
Sbjct:  951 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL---QIGNFQNLV--IKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTF--EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV 1191          

HSP 23 Score: 104.375 bits (259), Expect = 3.917e-23
Identity = 69/179 (38.55%), Postives = 100/179 (55.87%), Query Frame = 2
Query:   98 APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWK---------------------LPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDL 568
             P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K                     +     ++KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI   I   Q    +  KP  +  I+    + D + + N    + D+
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDV 175          

HSP 24 Score: 92.4337 bits (228), Expect = 2.464e-19
Identity = 92/283 (32.51%), Postives = 126/283 (44.52%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDID-----------------------------VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKP------DIVYPIFDIQS---NFQFSKPVIKSHIEQPVSDSD-------RNFNSNLLSKSFDL 568
            H  DI++      KFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D                        IDGKK                          KKHG+D NLP+WK P F  K KK KG++D+D                             VE P+  IDI GKK KGD DV+L  P VD+D++        DI  P + +Q+     + +K  I   +E P  D D        +F+ NL   + D+
Sbjct:  126 HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV 408          
BLAST of SMED30000771 vs. Planmine SMEST
Match: SMESG000022407.1 (SMESG000022407.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 358/367 (97.55%), Postives = 362/367 (98.64%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 1102
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKG FDVN KKPN+D+DINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVN+EFLNREQPFLKRNSDSYDNSDIL+NPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT
Sbjct: 1995 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGGFDVNFKKPNIDIDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPVTCHNQYSSPSVNKEFLNREQPFLKRNSDSYDNSDILTNPILKEHISIHNLEKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMFGNRSPNLFHSDYSLTPT 2361          

HSP 2 Score: 244.588 bits (623), Expect = 2.228e-70
Identity = 142/245 (57.96%), Postives = 175/245 (71.43%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFSSSIIPDKFSSRANFDISTSLSSTFQS--IPDDPSINIEQPNSAID 730
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+     DI+ +           ++ P  D D +   + +S    + +P + I       + +K   +   DI+  + + FQ+  I     +N+E P+++ID
Sbjct:  877 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM-----DIEIDVDLG-------VKTPSIDIDIDGKKHRISGDLSVDKPDADID--IDIDVSNK-KKKHGIDINLQIGN-FQNLVIKGKLDVNVEVPDASID 1105          

HSP 3 Score: 244.202 bits (622), Expect = 2.721e-70
Identity = 123/145 (84.83%), Postives = 134/145 (92.41%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLPKFEGKLKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIEVDIDGKKKKHGLDFNLPDWKLP FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct: 1366 KKKHGLDINLPDWKLPKFEGKLKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 1510          

HSP 4 Score: 234.958 bits (598), Expect = 4.624e-67
Identity = 120/147 (81.63%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1132 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDI 1278          

HSP 5 Score: 234.187 bits (596), Expect = 9.522e-67
Identity = 121/147 (82.31%), Postives = 134/147 (91.16%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPN+DVDINKPDI
Sbjct: 1685 KKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDI 1829          

HSP 6 Score: 231.876 bits (590), Expect = 5.070e-66
Identity = 118/147 (80.27%), Postives = 133/147 (90.48%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct: 1210 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 1356          

HSP 7 Score: 231.491 bits (589), Expect = 7.071e-66
Identity = 118/147 (80.27%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  565 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 711          

HSP 8 Score: 229.18 bits (583), Expect = 4.297e-65
Identity = 117/147 (79.59%), Postives = 132/147 (89.80%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPN+DVDINKPDI
Sbjct:  721 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDI 867          

HSP 9 Score: 227.639 bits (579), Expect = 1.293e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKKPKG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct: 1761 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 1907          

HSP 10 Score: 227.254 bits (578), Expect = 1.719e-64
Identity = 116/147 (78.91%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DI GKKPKG+ID+N+K  N+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKV KPKGEIDIDVEGPEVDIDIHGKKPKGD DVNLKKPN+DVDINKPDI
Sbjct: 1839 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDI 1985          

HSP 11 Score: 226.098 bits (575), Expect = 5.269e-64
Identity = 119/147 (80.95%), Postives = 131/147 (89.12%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHGLDINLPDWKL  FEGK+KK KG  D+DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +K DID+  D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  347 KKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDL--DVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 491          

HSP 12 Score: 224.942 bits (572), Expect = 1.169e-63
Identity = 115/147 (78.23%), Postives = 130/147 (88.44%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDI GKKPKGD DVNLKK N+DVDINKPDI
Sbjct:  643 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIDGKKPKGDIDVNLKKANIDVDINKPDI 789          

HSP 13 Score: 189.119 bits (479), Expect = 2.279e-51
Identity = 104/147 (70.75%), Postives = 127/147 (86.39%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+ KPKG  D+DVE P++D+DIHGKKPKG+ID+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1917 KKKHGFGINLPDWKLPTFEGKVMKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 2061          

HSP 14 Score: 186.422 bits (472), Expect = 1.455e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct:  799 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 943          

HSP 15 Score: 186.422 bits (472), Expect = 1.455e-50
Identity = 103/147 (70.07%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PN+D+D +K DIDI++DID KKKKHGLD NLPDWKLP FEGK+KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI
Sbjct: 1288 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDI 1432          

HSP 16 Score: 179.104 bits (453), Expect = 4.574e-48
Identity = 102/145 (70.34%), Postives = 115/145 (79.31%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINL   ++  F+  + K K D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1070 KKKHGIDINL---QIGNFQNLVIKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1200          

HSP 17 Score: 175.637 bits (444), Expect = 8.536e-47
Identity = 113/165 (68.48%), Postives = 127/165 (76.97%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGE-------IDLNVKNPNVDIDF----HKMDIDI-------EVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG  DLD+  P+ID D + KK K +       +D+NV+ P+  ID     HK DID+       ++D+DGKKKKHGLD NLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct: 1589 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 1753          

HSP 18 Score: 175.252 bits (443), Expect = 1.079e-46
Identity = 108/211 (51.18%), Postives = 128/211 (60.66%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVK--------KPKGEIDIDVEGPEVDIDI-----------------HG---------------------------------------KKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG  INLPDWKLP FEGK+KKPKG  D+DVE P++D+DIHGKK KG+ D+N+K PNVD+D +K DIDI++D+DGKKKKHG   NLPDWKLPTFEGKV+        K +G+ D++++ P VDIDI                 HG                                       KK KGDFDVNLKKPNVDVDINKPDI
Sbjct:  423 KKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTFMEKTEGDFDVNLKKPNVDIDINKPDIDIDLDADDKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDFDVNLKKPNVDVDINKPDI 633          

HSP 19 Score: 169.474 bits (428), Expect = 8.793e-45
Identity = 108/176 (61.36%), Postives = 118/176 (67.05%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG+DINLP+WK PKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKKKHGLD NLPDWKL TFEGKVKK KGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI
Sbjct:  251 KKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKKHGLDINLPDWKLQTFEGKVKKAKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 415          

HSP 20 Score: 151.754 bits (382), Expect = 7.959e-39
Identity = 92/166 (55.42%), Postives = 109/166 (65.66%), Query Frame = 2
Query:    2 KKKHGLDINLPDWK---------------------LPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDI 436
            KKKHG++I LP  K                     + K   +LKKPKG LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHK DIDIE+   G  +K              FEGK+KKPKGE+DID+ GPEVD+DIHG + KG+ DV   KP++++DI KPD+
Sbjct:   43 KKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGALDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEI---GSYQK--------------FEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDM 191          

HSP 21 Score: 142.51 bits (358), Expect = 1.139e-35
Identity = 80/134 (59.70%), Postives = 99/134 (73.88%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPK--GDFDVN 391
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K   FEGK KKPK E+D+ V+ P +DIDI GKK +  GD  V+
Sbjct: 1442 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISGDLSVD 1573          

HSP 22 Score: 128.642 bits (322), Expect = 3.969e-31
Identity = 97/248 (39.11%), Postives = 128/248 (51.61%), Query Frame = 2
Query:    2 KKKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDID---------------------------------------GKKKKHGLDFNLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVD-----------INKPDIVYPIFDIQSNFQFSKPVIKSHIEQPVSDSD-------RNFNSNLLSKSFDL 568
            KKKHGLD NLPDWKLPKFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D+D                                        KKKKHG+D NL   ++  F+  V   KG++D++VE P+  IDI GKK KGD DV+L  P VD+D           IN PD   P F  +   +  K  I   +E P  D D        +F+ NL   + D+
Sbjct:  953 KKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDVDLGVKTPSIDIDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINL---QIGNFQNLV--IKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLPDWKLPTF--EGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDV 1193          

HSP 23 Score: 103.99 bits (258), Expect = 4.024e-23
Identity = 69/179 (38.55%), Postives = 100/179 (55.87%), Query Frame = 2
Query:   98 APDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWK---------------------LPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIFDIQS-NFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDL 568
             P++DVDIHG + KG +D+    P+++ID  K D+DIE  IDGKKKKHG++  LP  K                     +     ++KKPKG   +DVE P++D+DIHGKKPKG+ D+N+K PNVD+D +KPDI   I   Q    +  KP  +  I+    + D + + N    + D+
Sbjct:    1 GPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIE--IDGKKKKHGINIGLPSMKGLKYRQQEKETWIRYQLARLEITKIRRELKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDV 175          

HSP 24 Score: 92.4337 bits (228), Expect = 2.486e-19
Identity = 78/219 (35.62%), Postives = 102/219 (46.58%), Query Frame = 2
Query:   11 HGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKMDIDIEVD------------------------IDGKK--------------------------KKHGLDFNLPDWKLPTFEGKVKKPKGEIDID-----------------------------VEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDIN 424
            H  DI++      KFEGKLKKPKG  D+D+  P++DVDIHG + KG +D+    P+++ID  K D+DIE+D                        IDGKK                          KKHG+D NLP+WK P F  K KK KG++D+D                             VE P+  IDI GKK KGD DV+L  P VD+D++
Sbjct:  126 HKPDIDIEIGSYQKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINISEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD 344          
The following BLAST results are available for this feature:
BLAST of SMED30000771 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AHNAK8.646e-936.24AHNAK nucleoprotein [Source:HGNC Symbol;Acc:HGNC:3... [more]
AHNAK26.984e-728.17AHNAK nucleoprotein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of SMED30000771 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000771 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000771 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ahnak4.301e-933.73AHNAK nucleoprotein [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
si:ch211-125o16.46.121e-827.04si:ch211-125o16.4 [Source:ZFIN;Acc:ZDB-GENE-131120... [more]
BX005403.16.613e-827.04si:ch211-125o16.4 [Source:NCBI gene;Acc:566639][more]
back to top
BLAST of SMED30000771 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000017705.13.046e-1138.33pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000032494.13.853e-1039.29pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000018110.13.862e-1035.03pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000017926.13.989e-1039.29pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
ENSXETT00000032614.14.679e-1039.29pep primary_assembly:Xenopus_tropicalis_v9.1:4:413... [more]
back to top
BLAST of SMED30000771 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ahnak6.800e-934.43AHNAK nucleoprotein (desmoyokin) [Source:MGI Symbo... [more]
back to top
BLAST of SMED30000771 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q09666|AHNK_HUMAN4.152e-836.24Neuroblast differentiation-associated protein AHNA... [more]
sp|Q8IVF2|AHNK2_HUMAN3.354e-628.17Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 P... [more]
back to top
BLAST of SMED30000771 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K2VA861.961e-1338.37Neuroblast differentiationassociated protein AHNAK... [more]
C3YDK35.372e-1229.52Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A0K2TTI41.371e-1038.32Uncharacterized protein (Fragment) OS=Lepeophtheir... [more]
V9K8N63.075e-1030.23Neuroblast differentiation-associated protein AHNA... [more]
A0A3P8STC04.185e-1037.85Uncharacterized protein OS=Amphiprion percula OX=1... [more]
back to top
BLAST of SMED30000771 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000039323.11.563e-1030.95pep primary_assembly:Astyanax_mexicanus-2.0:24:370... [more]
ENSAMXT00000011221.27.241e-729.05pep primary_assembly:Astyanax_mexicanus-2.0:9:1257... [more]
ENSAMXT00000036931.19.346e-734.38pep primary_assembly:Astyanax_mexicanus-2.0:24:370... [more]
ENSAMXT00000011223.29.782e-729.05pep primary_assembly:Astyanax_mexicanus-2.0:9:1257... [more]
back to top
BLAST of SMED30000771 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002063.13.023e-1225.45pep scaffold:Pmarinus_7.0:GL491826:26:5749:-1 gene... [more]
ENSPMAT00000004925.12.853e-1129.15pep scaffold:Pmarinus_7.0:GL480373:16762:23670:1 g... [more]
ENSPMAT00000001909.12.437e-1037.43pep scaffold:Pmarinus_7.0:GL476451:21233:28988:1 g... [more]
ENSPMAT00000010813.19.588e-828.03pep scaffold:Pmarinus_7.0:GL477610:65266:75627:1 g... [more]
back to top
BLAST of SMED30000771 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000771 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335698.837e-629.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30000771 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AHNAK9.133e-1035.57AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
AHNAK9.133e-1035.57AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
ENSORLT00000002200.21.713e-933.69pep primary_assembly:ASM223467v1:13:4398514:442597... [more]
AHNAK3.546e-833.77AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
ENSORLT00000000108.26.992e-730.39neuroblast differentiation-associated protein AHNA... [more]
back to top
BLAST of SMED30000771 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022407.12.591e-7097.55SMESG000022407.1[more]
SMESG000022407.12.770e-7097.55SMESG000022407.1[more]
SMESG000022407.12.422e-7097.55SMESG000022407.1[more]
SMESG000022407.12.227e-7097.55SMESG000022407.1[more]
SMESG000022407.12.228e-7097.55SMESG000022407.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000771 ID=SMED30000771|Name=SMED30000771|organism=Schmidtea mediterranea sexual|type=transcript|length=1488bp
GAAAAAGAAACATGGATTAGATATCAACTTGCCCGATTGGAAATTACCAA
AATTCGAAGGGAAACTTAAAAAACCGAAAGGAGATTTAGATGTTGAAGCA
CCTGACATCGACGTTGACATTCATGGAAAGAAACCGAAAGGGGAAATAGA
TCTCAATGTAAAGAACCCGAATGTCGATATAGATTTTCATAAAATGGATA
TTGATATTGAAGTTGATATCGATGGAAAGAAAAAGAAACATGGATTAGAC
TTTAATTTACCAGATTGGAAGTTACCGACATTTGAAGGAAAAGTAAAGAA
GCCTAAAGGAGAAATAGACATTGATGTTGAAGGTCCAGAAGTCGACATTG
ACATTCATGGGAAAAAACCGAAAGGAGATTTTGATGTCAATTTGAAGAAA
CCGAATGTTGATGTAGACATTAATAAACCAGATATTGTCTATCCGATTTT
TGATATTCAATCTAATTTTCAATTTTCGAAACCTGTTATCAAATCTCATA
TTGAGCAACCAGTTTCTGACAGTGATAGAAACTTTAATTCTAATCTTCTT
TCAAAATCGTTTGATCTTCCTCAACCTATTTCGCAAATAACAGAGTTTTC
TTCAAGTATTATTCCTGACAAGTTTTCAAGTAGAGCAAATTTCGATATAT
CCACAAGTCTCTCCTCTACTTTTCAATCAATTCCTGATGATCCTTCAATC
AATATCGAACAACCGAATTCAGCTATTGATTCTGAATGGATATCACCAGT
TACCTGTCACAATCAATACTCATCGCCATCTGTCAATGAAGAATTTTTAA
ATCGAGAACAACCTTTCCTAAAGCGAAATTCGGATTCATATGATAATTCT
GATATTCTTTCTAATCCAATCCTTAAAGAACACATTAGTATTCATAATTT
AGAGAAATTTGATTGGATTGACTCTGAAACTGACATAAATTCAGTTACAG
CTTTAAATGATGTATTTAGTTCGAAGAGTTCTACTGAGATTTCTTTACCG
CGAACGCCTTTGTCTAGTAGTCATACACCGGACATTAATCACTACATGTT
TGGTAACCGAAGCCCTAACTTGTTTCATTCTGATTACAGTCTTACTCCAA
CATTTAAGATCAAAAAATGAGTCTTTTTCTTTTGAAATGATTCTATTATT
CGTTTTACCTAAGAATCCATTTTCATTTTGTATTTAATATATTAATTGAC
TTCGAATACGGCATTTGCTATTGCTGGATAATTCTTTAAACCTAATTGAT
TTTATTTGACTTATATATTTCATTTTTCATGTGGTGTTACTTTTTTTTCG
AGCATGCTCTGTTAATAAATTTTCGACTTACTCTTTATAGAGGCAACTTG
TCTGGCGTTCAACAATACTCGTTTCCCTCAATCAATATTATTTTTCAAAT
TTGTAATTAATTTTTGTACTTCTTTTATTATGCTTTTTGTTCATCTTTGA
TTTTGCGAGCACATTTTATTTCCATAATTTTATAGCAG
back to top

protein sequence of SMED30000771-orf-1

>SMED30000771-orf-1 ID=SMED30000771-orf-1|Name=SMED30000771-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=373bp
KKKHGLDINLPDWKLPKFEGKLKKPKGDLDVEAPDIDVDIHGKKPKGEID
LNVKNPNVDIDFHKMDIDIEVDIDGKKKKHGLDFNLPDWKLPTFEGKVKK
PKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIVYPIF
DIQSNFQFSKPVIKSHIEQPVSDSDRNFNSNLLSKSFDLPQPISQITEFS
SSIIPDKFSSRANFDISTSLSSTFQSIPDDPSINIEQPNSAIDSEWISPV
TCHNQYSSPSVNEEFLNREQPFLKRNSDSYDNSDILSNPILKEHISIHNL
EKFDWIDSETDINSVTALNDVFSSKSSTEISLPRTPLSSSHTPDINHYMF
GNRSPNLFHSDYSLTPTFKIKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0044548S100 protein binding
GO:0045296cadherin binding
GO:0097493structural molecule activity conferring elasticity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005765lysosomal membrane
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0015629actin cytoskeleton
GO:0016020membrane
GO:0030315T-tubule
GO:0031982vesicle
GO:0042383sarcolemma
GO:0043034costamere
GO:0044291cell-cell contact zone
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0043484regulation of RNA splicing
GO:0051259protein oligomerization
GO:1901385regulation of voltage-gated calcium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR23348PERIAXIN/AHNAKcoord: 7..168