EGFR-5

Overview
NameEGFR-5 (AGA95411.1)
Smed IDSMED30000756
Length (bp)4812
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EGFR-5 (SMED30000756) t-SNE clustered cells

Violin plots show distribution of expression levels for EGFR-5 (SMED30000756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EGFR-5 (SMED30000756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EGFR-5 (SMED30000756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridial progenitor cellSMED30000756SMESG000044603.1 SMED30000756smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000756SMESG000044603.1 dd_Smed_v4_11310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000756SMESG000044603.1 dd_Smed_v4_11310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000756SMESG000044603.1 dd_Smed_v4_11310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000756SMESG000044603.1 dd_Smed_v4_11310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000756SMESG000044603.1 dd_Smed_v4_11310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000756SMESG000044603.1 dd_Smed_v4_11310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig3764newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig3764uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000014578.1 SMESG000014566.1 SMESG000014562.1 SMESG000014553.1 SMESG000014544.1 Contig3764newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000014578.1 SMESG000014566.1 SMESG000014562.1 SMESG000014553.1 SMESG000014544.1 Contig3764uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig38162newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig38162uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig9427newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig9427uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig40123newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000756SMESG000044603.1 Contig40123uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30000756SMESG000044603.1 dd_Smed_v4_11310_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000756SMESG000044603.1 dd_Smed_v6_11310_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
flame cellSMED30000756SMESG000044603.1 EGFR-5smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
proximal tubuleSMED30000756SMESG000044603.1 EGFR-5smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EGFR-5 vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 338.576 bits (867), Expect = 3.039e-95
Identity = 190/497 (38.23%), Postives = 280/497 (56.34%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFIT---VNETAKPXXXXXXXXXXXXXXXLGSTNYDCLR---CKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             S+C+ C P C +       CHG    +C+ C +F+    C++KCP         + + A P+ EC  CH  C++GC G T++DC+      H+ +  +  T        G    L     I+     +Y R                         +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +++GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L VCL+   +L+TQ MP G LLE+V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  523 GSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILV----IVGLTFAVYVR----------------------RKSIKKKRALRRFLETELV--------EPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 965          

HSP 2 Score: 209.149 bits (531), Expect = 8.335e-54
Identity = 177/648 (27.31%), Postives = 284/648 (43.83%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRS--QEVVIVETN-EKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHK--GRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP 2446
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  N ++SFL S+ +++GY+++  N    + L  L++IRG   L       ++ + Y    N  L+ +   NL  IL   V+ + N  LCYA   I+W  ++R      + +V TN    CG       CH+SC        CWG + + CQ +    CA +    CY     Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    N   K  +   CV KCP  F  +  +CV  C + K        + C PC +  CPK C             V    + +  NCT  +GN++     + GD ++ +    + I  + L     + EI G+L I   +  N TD      NL  I    + S  S  + I+    +  L  ++LKE+  GNI I  N+ LC+ +T+   ++      R +   N K ENC+ +   C+  C    GCWGP    C+ C+ F     + C+  C+   G F     + E    C +C  +C     G+ TCHG   + C   C ++K G +C++KCP            Y D  + C+PCH NCT+        C+GP
Sbjct:    2 VCAGTENKLSSLSDLEQQYRALRKYYE-NCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTK-LYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYAD-TIHWQDIVRNPWPSNLTLVSTNGSSGCG------RCHKSCTGR-----CWGPTENHCQTLTRTVCAEQCDGRCYGP---YVSDCCHRECAGGCSG------PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAI----EAIDPEKLNVFRTVREITGFLNIQS-WPPNMTD-FSVFSNLVTIGGRVLYSGLS--LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSD-GCWGPGPDQCLSCRRF--SRGRICIESCNLYDGEF----REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG-------CNGP 602          
BLAST of EGFR-5 vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 338.191 bits (866), Expect = 5.119e-95
Identity = 190/497 (38.23%), Postives = 280/497 (56.34%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFIT---VNETAKPXXXXXXXXXXXXXXXLGSTNYDCLR---CKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             S+C+ C P C +       CHG    +C+ C +F+    C++KCP         + + A P+ EC  CH  C++GC G T++DC+      H+ +  +  T        G    L     I+     +Y R                         +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +++GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L VCL+   +L+TQ MP G LLE+V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  549 GSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILV----IVGLTFAVYVR----------------------RKSIKKKRALRRFLETELV--------EPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 991          

HSP 2 Score: 209.534 bits (532), Expect = 7.179e-54
Identity = 177/648 (27.31%), Postives = 284/648 (43.83%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRS--QEVVIVETN-EKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHK--GRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP 2446
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  N ++SFL S+ +++GY+++  N    + L  L++IRG   L       ++ + Y    N  L+ +   NL  IL   V+ + N  LCYA   I+W  ++R      + +V TN    CG       CH+SC        CWG + + CQ +    CA +    CY     Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    N   K  +   CV KCP  F  +  +CV  C + K        + C PC +  CPK C             V    + +  NCT  +GN++     + GD ++ +    + I  + L     + EI G+L I   +  N TD      NL  I    + S  S  + I+    +  L  ++LKE+  GNI I  N+ LC+ +T+   ++      R +   N K ENC+ +   C+  C    GCWGP    C+ C+ F     + C+  C+   G F     + E    C +C  +C     G+ TCHG   + C   C ++K G +C++KCP            Y D  + C+PCH NCT+        C+GP
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYYE-NCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTK-LYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYAD-TIHWQDIVRNPWPSNLTLVSTNGSSGCG------RCHKSCTGR-----CWGPTENHCQTLTRTVCAEQCDGRCYGP---YVSDCCHRECAGGCSG------PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAI----EAIDPEKLNVFRTVREITGFLNIQS-WPPNMTD-FSVFSNLVTIGGRVLYSGLS--LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSD-GCWGPGPDQCLSCRRF--SRGRICIESCNLYDGEF----REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG-------CNGP 628          
BLAST of EGFR-5 vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 338.191 bits (866), Expect = 6.537e-95
Identity = 190/497 (38.23%), Postives = 280/497 (56.34%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFIT---VNETAKPXXXXXXXXXXXXXXXLGSTNYDCLR---CKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             S+C+ C P C +       CHG    +C+ C +F+    C++KCP         + + A P+ EC  CH  C++GC G T++DC+      H+ +  +  T        G    L     I+     +Y R                         +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +++GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L VCL+   +L+TQ MP G LLE+V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  549 GSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILV----IVGLTFAVYVR----------------------RKSIKKKRALRRFLETELV--------EPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 991          

HSP 2 Score: 209.149 bits (531), Expect = 8.885e-54
Identity = 177/648 (27.31%), Postives = 284/648 (43.83%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRS--QEVVIVETN-EKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHK--GRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP 2446
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  N ++SFL S+ +++GY+++  N    + L  L++IRG   L       ++ + Y    N  L+ +   NL  IL   V+ + N  LCYA   I+W  ++R      + +V TN    CG       CH+SC        CWG + + CQ +    CA +    CY     Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    N   K  +   CV KCP  F  +  +CV  C + K        + C PC +  CPK C             V    + +  NCT  +GN++     + GD ++ +    + I  + L     + EI G+L I   +  N TD      NL  I    + S  S  + I+    +  L  ++LKE+  GNI I  N+ LC+ +T+   ++      R +   N K ENC+ +   C+  C    GCWGP    C+ C+ F     + C+  C+   G F     + E    C +C  +C     G+ TCHG   + C   C ++K G +C++KCP            Y D  + C+PCH NCT+        C+GP
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYYE-NCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTK-LYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYAD-TIHWQDIVRNPWPSNLTLVSTNGSSGCG------RCHKSCTGR-----CWGPTENHCQTLTRTVCAEQCDGRCYGP---YVSDCCHRECAGGCSG------PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAI----EAIDPEKLNVFRTVREITGFLNIQS-WPPNMTD-FSVFSNLVTIGGRVLYSGLS--LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSD-GCWGPGPDQCLSCRRF--SRGRICIESCNLYDGEF----REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG-------CNGP 628          
BLAST of EGFR-5 vs. Ensembl Human
Match: ERBB2 (erb-b2 receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:3430])

HSP 1 Score: 316.62 bits (810), Expect = 1.322e-89
Identity = 147/313 (46.96%), Postives = 210/313 (67.09%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG +PN A + ++ E++L + +++GSGAFG VYKGIW P+                      ++K+ VA+K+L + + P  N+EIL+EA VMA V  P   R+L +CLT+  +L+TQ MP G LL+ V+ NR  + S  LL W  QIA GM YLE   ++H DLAARNVL++SP  VKITDFGLA++LD  + +Y   GG++PIKW+A+E I  R F+ +SDVWSYGVT+WE+ ++G KP+  I A +I + LEKG+RL QP IC+ID Y I+V+CW++D + RP F EL   F  M+ +P R++++Q+ED
Sbjct:  425 TPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPD--------------------GENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNED 717          

HSP 2 Score: 113.62 bits (283), Expect = 1.425e-24
Identity = 91/329 (27.66%), Postives = 141/329 (42.86%), Query Frame = 2
Query: 1496 NQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFL---KNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGR--FLRALNGKIENCSKK--KCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKC---SNEPGYFYNSSSDHEVNRSCSKCHSECLP--GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY-----------YVDSMKNCYPCHTNCTEN 2413
             Q C  C +  C ++C    +   +E+  V    +     C    G++     S +GD   N +     ++ + L+  E LEEI GYL I     S W DSL  L   +NL++IR   +  + +  + + G   + +LGLR+L+E+ +G  +I  N  LCF +T+    +        L   N   + C  +   CH  C  R  CWGP    CV C  F+    + C+ +C      P  + N+       R C  CH EC P  G  TC G   ++C + C +YK    C+ +CP+             + D    C PC  NCT +
Sbjct:   52 TQRCEKC-SKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAP----LQPEQLQVFETLEEITGYLYI-----SAWPDSLPDLSVFQNLQVIRG-RILHNGAYSLTLQGL-GISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLC-ARGHCWGPGPTQCVNCSQFL--RGQECVEECRVLQGLPREYVNA-------RHCLPCHPECQPQNGSVTCFGPEADQC-VACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHS 357          

HSP 3 Score: 58.9214 bits (141), Expect = 8.128e-8
Identity = 74/299 (24.75%), Postives = 124/299 (41.47%), Query Frame = 2
Query:  722 AHITNENISFLNSIEDISGYLMI--FSNAVESISLIK-LKVIRGE------NPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSAC------QKINDCAN--RTCYDSTKCYINE---ILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDI 1558
            A +  E +    ++E+I+GYL I  + +++  +S+ + L+VIRG         L ++GL  S + G  S+ E  L   L +I       ++N  LC+    + W+ L R   + ++   N  +     E L+CH+ C     + +CWG   + C       +  +C    R      + Y+N    +    EC  +     C GP   QC+AC ++ +   CV  CP   K D           L++  I       KF +E G C   C    T+    +CV   +  CP   RA  +
Sbjct:  114 APLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWL-GLRSLRE--LGSGLALI-------HHNTHLCFV-HTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCA----RGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPD-----------LSYMPIW------KFPDEEGAC-QPCPINCTH----SCVDLDDKGCPAEQRASPL 375          
BLAST of EGFR-5 vs. Ensembl Human
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 317.775 bits (813), Expect = 2.795e-89
Identity = 148/313 (47.28%), Postives = 214/313 (68.37%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++  + +++GSGAFG VYKG+W P                    +   +K+ VA+K L + + P  N+EIL+EA VMASVD+P   R+L +CLT+  +LITQ MP G LL++V+ ++  I S  LL W  QIA GM YLE + ++H DLAARNVL+++P+ VKITDFGLAK+L   +++Y  +GG++PIKW+A+E I +RI++ +SDVWSYGVT+WE+ ++G KP+  I A +I   LEKG+RL QP IC+ID Y I+V+CW++D D+RP F EL   F  M+ +P RYL++Q ++
Sbjct:  648 TPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIP--------------------EGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDE 940          

HSP 2 Score: 213.772 bits (543), Expect = 1.767e-55
Identity = 190/657 (28.92%), Postives = 301/657 (45.81%), Query Frame = 2
Query:  611 KVCKSTQ---TQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSC----HESCQAHLNKTYCWGNSSSACQ--KINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQ--NPLGKLAFYYICVDKCPKKFF-NEHGNCVTQCSAEKTYAVNQ----TCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILH-KGRFLRALNGKIENCSK---KKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCS---NEPGYFYNSSSDHEVNRSCSKCHSECLP-GIN-TCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGC 2473
            KVC+ T    TQ+   ++ + SL+R F+ NC  ++G++ I ++  N ++SFL +I++++GY++I  N VE I L                                   NLQ+I R N+++ N+  L   S   N+++     +E+ +     + C  +    SC     E+CQ  L K  C    S  C+    +DC +  C  +  C                    TGP  S CL C+ F +   C + CPP   ++   Y    NP GK +F   CV KCP+ +   +HG+CV  C A+ +Y + +     C  C  G C K+C    I + ++   ++   +   +NCT   G++ I   +  GD+F +       +  Q+L  L+ ++EI G+L I   +  N TD L   +NL IIR    + H    + +V +  +  LGLR+LKE+ +G++II  N  LC++NT+  K +    G+  + ++ + EN  K   + CH+ C    GCWGPE   CV C++  +   + C+ KC+    EP  F         N  C +CH ECLP  +N TC G   + C + C +Y  G  C+K CPA            Y D+   C+ CH NCT         C GP    G +GC
Sbjct:   29 KVCQGTSNKLTQLGTFEDHFLSLQRMFN-NCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPL----------------------------------ENLQII-RGNMYYENSYALAVLS---NYDANKTGLKELPMRNLQGQKCDPSCPNGSCWGAGEENCQ-KLTKIICAQQCSGRCRGKSPSDCCHNQC--AAGC--------------------TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGAD-SYEMEEDGVRKCKKC-EGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPP----LDPQELDILKTVKEITGFLLIQA-WPENRTD-LHAFENLEIIRGR-TKQHGQFSLAVV-SLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE-GCWGPEPRDCVSCRN--VSRGRECVDKCNLLEGEPREFVE-------NSECIQCHPECLPQAMNITCTGRGPDNC-IQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYG-------CTGP----GLEGC 591          
BLAST of EGFR-5 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 390.578 bits (1002), Expect = 1.828e-113
Identity = 339/1199 (28.27%), Postives = 552/1199 (46.04%), Query Frame = 2
Query:  737 ENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVET--NEKDCGLNNEELS-CHESCQAHLNKTYCWGNSSSACQKI-NDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQT---CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSR-GIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSIL-HKGRFLRALNGKIENCSKKKCHSE-------CEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCK-----NYKFGE--SCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSS---WHCSLCKYFR-----SDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRF--NMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFK-TKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQ--EIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHP-KLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            ++I+F +++E+I G L+I+   ++ IS  +L+VI G+          +L +  N  +  ++   L+VI   +V   +NPK+CY   KI+W  L+    +V  VET  + + C  N + ++ CHESC        CWG+  + CQ++      ++C   ++C+ +    S ECC   C+GGCTG     C+AC  +  +GIC+E CP    F H   + + NP G+      CV +CP +   E+  CV  CS    Y   +    C  C +  CPKIC            ++  + L  LE C   DG+++I                      + LK LE ++ +  Y+ I      N+ D L+FLKNL+II  E  + H  R  + I     L+ L L +LK ++ G ++I  N++LC+ + +   SI+  KG+  +      EN   K C +E       C +R GCWG E   C++CK++  +   TC+ KC  + G+  N +S       C +C  EC     TC+G  E +C L C+     N  FG    C+  CP  ++      C  CH  C +N       C GP+ +LG  GC  C + +   N +     SS  N + C++N D+    +Y S  D             T  ++E              + C  C   C  C         +  +CK+       S+  C+ +CP   F+ V +T     +      + +  C    +  C +CK+  ++     Q  C S C   +     +   C D+ I SR      + IG            I+      +   KK K  ++V+  +  P D    + V PNM+ + LI  S+L  +  + +G+GAFG V+ GI+ P                    +  ++K+ VA+K+    +D S   E+LEEA  M  + H   L+I+  C+     K++T + PLG+L  F++ ++  + +   +++  QIASGM+YLE + ++H DLA RNVL++    V+ITDFGL+K+L +       K G++ IKWLA+E      ++  SDVW++GVT WE+ ++G+ P+  +    I   L+ G RL+QP  CS D Y  L++CW+ DP +RP F  L + F+     P  +L   ++ S   L  E     ++  E    
Sbjct:   43 KSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVFHDN----ALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELL-YDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK-----CWGSGDNDCQRVYRSVCPKSC---SQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVD--------GHLTNETLKNLEGCEQIDGHLIIEH----------------AFTYEQLKVLETVKIVSEYITI---VQQNFYD-LKFLKNLQII--EGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKR-GCWGKEPEDCLECKTW--KSVGTCVEKCDTK-GFLRNQTS-----MKCERCSPEC----ETCNGLGELDC-LTCRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG------CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNV-CVEN-DL--PNYYISTYD-------------TEGVIE--------------THCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFM-VPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ--CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPID----ASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYP-------------------KRAKNVKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDG 1119          
BLAST of EGFR-5 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 390.578 bits (1002), Expect = 5.128e-113
Identity = 339/1199 (28.27%), Postives = 552/1199 (46.04%), Query Frame = 2
Query:  737 ENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVET--NEKDCGLNNEELS-CHESCQAHLNKTYCWGNSSSACQKI-NDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQT---CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSR-GIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSIL-HKGRFLRALNGKIENCSKKKCHSE-------CEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCK-----NYKFGE--SCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSS---WHCSLCKYFR-----SDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRF--NMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFK-TKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQ--EIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHP-KLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            ++I+F +++E+I G L+I+   ++ IS  +L+VI G+          +L +  N  +  ++   L+VI   +V   +NPK+CY   KI+W  L+    +V  VET  + + C  N + ++ CHESC        CWG+  + CQ++      ++C   ++C+ +    S ECC   C+GGCTG     C+AC  +  +GIC+E CP    F H   + + NP G+      CV +CP +   E+  CV  CS    Y   +    C  C +  CPKIC            ++  + L  LE C   DG+++I                      + LK LE ++ +  Y+ I      N+ D L+FLKNL+II  E  + H  R  + I     L+ L L +LK ++ G ++I  N++LC+ + +   SI+  KG+  +      EN   K C +E       C +R GCWG E   C++CK++  +   TC+ KC  + G+  N +S       C +C  EC     TC+G  E +C L C+     N  FG    C+  CP  ++      C  CH  C +N       C GP+ +LG  GC  C + +   N +     SS  N + C++N D+    +Y S  D             T  ++E              + C  C   C  C         +  +CK+       S+  C+ +CP   F+ V +T     +      + +  C    +  C +CK+  ++     Q  C S C   +     +   C D+ I SR      + IG            I+      +   KK K  ++V+  +  P D    + V PNM+ + LI  S+L  +  + +G+GAFG V+ GI+ P                    +  ++K+ VA+K+    +D S   E+LEEA  M  + H   L+I+  C+     K++T + PLG+L  F++ ++  + +   +++  QIASGM+YLE + ++H DLA RNVL++    V+ITDFGL+K+L +       K G++ IKWLA+E      ++  SDVW++GVT WE+ ++G+ P+  +    I   L+ G RL+QP  CS D Y  L++CW+ DP +RP F  L + F+     P  +L   ++ S   L  E     ++  E    
Sbjct:  109 KSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVFHDN----ALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELL-YDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK-----CWGSGDNDCQRVYRSVCPKSC---SQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVD--------GHLTNETLKNLEGCEQIDGHLIIEH----------------AFTYEQLKVLETVKIVSEYITI---VQQNFYD-LKFLKNLQII--EGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKR-GCWGKEPEDCLECKTW--KSVGTCVEKCDTK-GFLRNQTS-----MKCERCSPEC----ETCNGLGELDC-LTCRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG------CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNV-CVEN-DL--PNYYISTYD-------------TEGVIE--------------THCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFM-VPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ--CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPID----ASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYP-------------------KRAKNVKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDG 1185          
BLAST of EGFR-5 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 390.193 bits (1001), Expect = 7.707e-113
Identity = 339/1199 (28.27%), Postives = 552/1199 (46.04%), Query Frame = 2
Query:  737 ENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVET--NEKDCGLNNEELS-CHESCQAHLNKTYCWGNSSSACQKI-NDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQT---CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSR-GIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSIL-HKGRFLRALNGKIENCSKKKCHSE-------CEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCK-----NYKFGE--SCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSS---WHCSLCKYFR-----SDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRF--NMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFK-TKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQ--EIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHP-KLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            ++I+F +++E+I G L+I+   ++ IS  +L+VI G+          +L +  N  +  ++   L+VI   +V   +NPK+CY   KI+W  L+    +V  VET  + + C  N + ++ CHESC        CWG+  + CQ++      ++C   ++C+ +    S ECC   C+GGCTG     C+AC  +  +GIC+E CP    F H   + + NP G+      CV +CP +   E+  CV  CS    Y   +    C  C +  CPKIC            ++  + L  LE C   DG+++I                      + LK LE ++ +  Y+ I      N+ D L+FLKNL+II  E  + H  R  + I     L+ L L +LK ++ G ++I  N++LC+ + +   SI+  KG+  +      EN   K C +E       C +R GCWG E   C++CK++  +   TC+ KC  + G+  N +S       C +C  EC     TC+G  E +C L C+     N  FG    C+  CP  ++      C  CH  C +N       C GP+ +LG  GC  C + +   N +     SS  N + C++N D+    +Y S  D             T  ++E              + C  C   C  C         +  +CK+       S+  C+ +CP   F+ V +T     +      + +  C    +  C +CK+  ++     Q  C S C   +     +   C D+ I SR      + IG            I+      +   KK K  ++V+  +  P D    + V PNM+ + LI  S+L  +  + +G+GAFG V+ GI+ P                    +  ++K+ VA+K+    +D S   E+LEEA  M  + H   L+I+  C+     K++T + PLG+L  F++ ++  + +   +++  QIASGM+YLE + ++H DLA RNVL++    V+ITDFGL+K+L +       K G++ IKWLA+E      ++  SDVW++GVT WE+ ++G+ P+  +    I   L+ G RL+QP  CS D Y  L++CW+ DP +RP F  L + F+     P  +L   ++ S   L  E     ++  E    
Sbjct:  104 KSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVFHDN----ALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELL-YDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK-----CWGSGDNDCQRVYRSVCPKSC---SQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVD--------GHLTNETLKNLEGCEQIDGHLIIEH----------------AFTYEQLKVLETVKIVSEYITI---VQQNFYD-LKFLKNLQII--EGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKR-GCWGKEPEDCLECKTW--KSVGTCVEKCDTK-GFLRNQTS-----MKCERCSPEC----ETCNGLGELDC-LTCRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG------CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNV-CVEN-DL--PNYYISTYD-------------TEGVIE--------------THCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFM-VPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ--CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPID----ASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYP-------------------KRAKNVKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDG 1180          
BLAST of EGFR-5 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 390.193 bits (1001), Expect = 8.859e-113
Identity = 339/1199 (28.27%), Postives = 552/1199 (46.04%), Query Frame = 2
Query:  737 ENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVET--NEKDCGLNNEELS-CHESCQAHLNKTYCWGNSSSACQKI-NDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQT---CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSR-GIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSIL-HKGRFLRALNGKIENCSKKKCHSE-------CEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCK-----NYKFGE--SCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSS---WHCSLCKYFR-----SDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRF--NMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFK-TKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQ--EIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHP-KLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            ++I+F +++E+I G L+I+   ++ IS  +L+VI G+          +L +  N  +  ++   L+VI   +V   +NPK+CY   KI+W  L+    +V  VET  + + C  N + ++ CHESC        CWG+  + CQ++      ++C   ++C+ +    S ECC   C+GGCTG     C+AC  +  +GIC+E CP    F H   + + NP G+      CV +CP +   E+  CV  CS    Y   +    C  C +  CPKIC            ++  + L  LE C   DG+++I                      + LK LE ++ +  Y+ I      N+ D L+FLKNL+II  E  + H  R  + I     L+ L L +LK ++ G ++I  N++LC+ + +   SI+  KG+  +      EN   K C +E       C +R GCWG E   C++CK++  +   TC+ KC  + G+  N +S       C +C  EC     TC+G  E +C L C+     N  FG    C+  CP  ++      C  CH  C +N       C GP+ +LG  GC  C + +   N +     SS  N + C++N D+    +Y S  D             T  ++E              + C  C   C  C         +  +CK+       S+  C+ +CP   F+ V +T     +      + +  C    +  C +CK+  ++     Q  C S C   +     +   C D+ I SR      + IG            I+      +   KK K  ++V+  +  P D    + V PNM+ + LI  S+L  +  + +G+GAFG V+ GI+ P                    +  ++K+ VA+K+    +D S   E+LEEA  M  + H   L+I+  C+     K++T + PLG+L  F++ ++  + +   +++  QIASGM+YLE + ++H DLA RNVL++    V+ITDFGL+K+L +       K G++ IKWLA+E      ++  SDVW++GVT WE+ ++G+ P+  +    I   L+ G RL+QP  CS D Y  L++CW+ DP +RP F  L + F+     P  +L   ++ S   L  E     ++  E    
Sbjct:  116 KSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVFHDN----ALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELL-YDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK-----CWGSGDNDCQRVYRSVCPKSC---SQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVD--------GHLTNETLKNLEGCEQIDGHLIIEH----------------AFTYEQLKVLETVKIVSEYITI---VQQNFYD-LKFLKNLQII--EGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKR-GCWGKEPEDCLECKTW--KSVGTCVEKCDTK-GFLRNQTS-----MKCERCSPEC----ETCNGLGELDC-LTCRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG------CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNV-CVEN-DL--PNYYISTYD-------------TEGVIE--------------THCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFM-VPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ--CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPID----ASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYP-------------------KRAKNVKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDG 1192          
BLAST of EGFR-5 vs. Ensembl Celegans
Match: kin-23 (pep chromosome:WBcel235:I:11640687:11642206:-1 gene:WBGene00002205.1 transcript:W04G5.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:kin-23)

HSP 1 Score: 174.866 bits (442), Expect = 3.587e-47
Identity = 108/300 (36.00%), Postives = 171/300 (57.00%), Query Frame = 2
Query: 3269 LTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVD-HPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSIT----------LLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFK--GGRMPIKWLAVECIRNRI--FSSKSDVWSYGVTLWEMFSYGEKPFADIK----AYDIL--EHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEM 4105
            ++ ++ IGSG FG+VY+                L+R  ++     SI  +VAVK  ++  D S  + + EE KVM  +  HP  L ++ V +  +  LI +++  G LL+F++R   +   +           LL +A QIA GM+YLE    +H DLA RNVLI+    ++I DFGLA+  + ++  Y+ +  G  +P+ WLA EC    I  F SKSDVWS+GV L+E+FS GE P+ +++    AYD+L  + L KG +L+QP+ C+++ YT +  CW + P+ARPSF+   + F++
Sbjct:   76 ISNEQSIGSGFFGVVYRAK--------------LRRKPTQEVSSHSIYFDVAVKESSNNHDISQKKLVYEELKVMCGMKKHPNILSLVGVVIERNVMLIMEYVEGGDLLKFLKRKSYVRYQLEPDGDALCMADLLSFAFQIAHGMQYLERVPCVHRDLALRNVLIKRNGVIRIADFGLARRHE-NKDYYRTRSVGTAIPLNWLAPECFEGSINKFDSKSDVWSFGVCLFELFSLGEPPYKELESNNIAYDLLLADFLRKGNQLSQPEHCTLEIYTFMKACWNLIPEARPSFSACTRFFQI 360          
BLAST of EGFR-5 vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071654)

HSP 1 Score: 557.755 bits (1436), Expect = 4.692e-172
Identity = 437/1431 (30.54%), Postives = 676/1431 (47.24%), Query Frame = 2
Query:  482 FFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDK-RYRHGKVCKSTQTQIDVSKNS---YESLKRNFDKNCSYIIGDVVIAHITNENI--SFLNSIEDISGYLMIFSNAVESISLIKLKVIRGEN--PLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVI---VETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIN------DCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILI--NRFSLEGDNFHN--LSKQNDGIRKQDLKKLENLEEIYGYLRI---HVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSEC--HGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKI--------YVNGSTQFFCNSTCGDRIQL--FQTSEI--ICTDHLIYSR-------FNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLV-------NQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ-DEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIP 4597
            F    S  +N++R   +  + L    +     L +++K  +  GK+C  T++++ V  N    Y +L+  +  NC+Y+ G++ +  + NEN+  SFL++I +++GY++I    V+ +   KL++IRG     L ++  K++L V Y+ M   +  P+L+ +L   V F+NN  LC+  R I W+ ++    +          E++C        CHESC        CWG     CQK +       CA   CY           K  ECCH  C GGCTGP +  C+ACKNF + G+C E CPP  K++   Y+   NP GK A+   CV +CP     ++G CV  C  +K     + CVPC NG CPK C          ++ +H   +    NCTV DGNI I    FS   D + N  +  +   +  + L+    ++EI GYL I   H  F      +L + +NL  I    +       + IV + +L  L +RNLK++ +G+++I  N  LC+ + +   +I  +   +     N + + C K    C  +C +  GCWG     C+ CK+F    + TC++ C    GY  N+      NR+C  CH EC     TC+G+  + C   C + + G+ C+ +CP   Y D    C  CH  C          C GP+D++G   C+ CN  I++++            + +CL   D CP G++           V+   Q ++K L               +VC  CHP C  C  +G     CS C +++   +C  +CP +++    +                 GC G    DC  C++ K+        YVN ST F C S C   ++   +Q + I   C      S         NM   I G   +    +  +V +I   K + KK   K+        +     PS+ G       N+  L ++ +++L +  ++G GAFG VYKG+W P                    +  ++K+ VA+K L   +   ++ E L EA +MASV+H   L++LAVC+++   LITQ MPLG LL++V+ NR  I S  LL W+ QIA GM YLE K ++H DLAARNVL+Q+P  VKITDFGLAK+L     +Y+  GG+MPIKWLA+ECIRNR+F+SKSDVW++GVT+WE+ ++G++P  +I A DI + +E G +L QP+ICS+D Y  L+ CW +D   RP+F +L   F   + +P RYL +  D+ +  P Y   +E      + ++ L   +              D     +  D Y + +A               G  H T+ T+ +   L    K+ SN+  ST  D  DS                 RE  +    L+  + ED YL+P
Sbjct:   56 FLYRSSSAQNRQRGGANFALGLGANGVTIPTSLEDKNKNEFVKGKICIGTKSRLSVPSNKEHHYRNLRDRY-TNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMY-TLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSNGTDAYYNYDFTAPERECP------KCHESCTHG-----CWGEGPKNCQKFSKLTCSPQCAGGRCYGP---------KPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGE-CVPC-NGPCPKTCPG--------VTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFR-----NLSYFRNLETIHGRQLMESMFAALAIVKS-SLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNED-GCWGAGTDQCLTCKNFNF--NGTCIADC----GYISNAYKFD--NRTCKICHPEC----RTCNGAGADHCQ-ECVHVRDGQHCVSECPKNKYNDR-GVCRECHATC--------DGCTGPKDTIGIGACTTCNLAIINNDA----------TVKRCLLKDDKCPDGYFWEY--------VHPQEQGSLKPLAG------------RAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQ------RECFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVN-STMFNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGA------NLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVP--------------------EGENVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTRLPAYTSQDE-----KDLIRKLAPTT--------------DGSEAIAEPDDYLQPKA-------------APGPSHRTDCTD-EIPKLNRYCKDPSNKNSSTGDDETDSSA---------------REVGVGNLRLDLPVDEDDYLMP 1313          
BLAST of EGFR-5 vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071653)

HSP 1 Score: 553.518 bits (1425), Expect = 7.178e-171
Identity = 430/1387 (31.00%), Postives = 658/1387 (47.44%), Query Frame = 2
Query:  611 KVCKSTQTQIDVSKNS---YESLKRNFDKNCSYIIGDVVIAHITNENI--SFLNSIEDISGYLMIFSNAVESISLIKLKVIRGEN--PLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVI---VETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIN------DCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILI--NRFSLEGDNFHN--LSKQNDGIRKQDLKKLENLEEIYGYLRI---HVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSEC--HGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKI--------YVNGSTQFFCNSTCGDRIQL--FQTSEI--ICTDHLIYSR-------FNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLV-------NQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ-DEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIP 4597
            KVC  T++++ V  N    Y +L+  +  NC+Y+ G++ +  + NEN+  SFL++I +++GY++I    V+ +   KL++IRG     L ++  K++L V Y+ M   +  P+L+ +L   V F+NN  LC+  R I W+ ++    +          E++C        CHESC        CWG     CQK +       CA   CY           K  ECCH  C GGCTGP +  C+ACKNF + G+C E CPP  K++   Y+   NP GK A+   CV +CP     ++G CV  C  +K     + CVPC NG CPK C          ++ +H   +    NCTV DGNI I    FS   D + N  +  +   +  + L+    ++EI GYL I   H  F      +L + +NL  I    +       + IV + +L  L +RNLK++ +G+++I  N  LC+ + +   +I  +   +     N + + C K    C  +C +  GCWG     C+ CK+F    + TC++ C    GY  N+      NR+C  CH EC     TC+G+  + C   C + + G+ C+ +CP   Y D    C  CH  C          C GP+D++G   C+ CN  I++++            + +CL   D CP G++           V+   Q ++K L               +VC  CHP C  C  +G     CS C +++   +C  +CP +++    +                 GC G    DC  C++ K+        YVN ST F C S C   ++   +Q + I   C      S         NM   I G   +    +  +V +I   K + KK   K+        +     PS+ G       N+  L ++ +++L +  ++G GAFG VYKG+W P                    +  ++K+ VA+K L   +   ++ E L EA +MASV+H   L++LAVC+++   LITQ MPLG LL++V+ NR  I S  LL W+ QIA GM YLE K ++H DLAARNVL+Q+P  VKITDFGLAK+L     +Y+  GG+MPIKWLA+ECIRNR+F+SKSDVW++GVT+WE+ ++G++P  +I A DI + +E G +L QP+ICS+D Y  L+ CW +D   RP+F +L   F   + +P RYL +  D+ +  P Y   +E      + ++ L   +              D     +  D Y + +A               G  H T+ T+ +   L    K+ SN+  ST  D  DS                 RE  +    L+  + ED YL+P
Sbjct:   51 KVCIGTKSRLSVPSNKEHHYRNLRDRY-TNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMY-TLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSNGTDAYYNYDFTAPERECP------KCHESCTHG-----CWGEGPKNCQKFSKLTCSPQCAGGRCYGP---------KPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGE-CVPC-NGPCPKTCPG--------VTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFR-----NLSYFRNLETIHGRQLMESMFAALAIVKS-SLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNED-GCWGAGTDQCLTCKNFNF--NGTCIADC----GYISNAYKFD--NRTCKICHPEC----RTCNGAGADHCQ-ECVHVRDGQHCVSECPKNKYNDR-GVCRECHATC--------DGCTGPKDTIGIGACTTCNLAIINNDA----------TVKRCLLKDDKCPDGYFWEY--------VHPQEQGSLKPLAG------------RAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQ------RECFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVN-STMFNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGA------NLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVP--------------------EGENVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTRLPAYTSQDE-----KDLIRKLAPTT--------------DGSEAIAEPDDYLQPKA-------------APGPSHRTDCTD-EIPKLNRYCKDPSNKNSSTGDDETDSSA---------------REVGVGNLRLDLPVDEDDYLMP 1264          
BLAST of EGFR-5 vs. Ensembl Fly
Match: Shark (gene:FBgn0015295 transcript:FBtr0087244)

HSP 1 Score: 206.068 bits (523), Expect = 7.869e-54
Identity = 112/300 (37.33%), Postives = 166/300 (55.33%), Query Frame = 2
Query: 3248 LLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFV-QRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQF-KGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 4141
              I   +L     IG G FG V+ G W             L++  S   ++S  +L VA+K+L+D  + SN +E L EA VM  ++H C +R++ +       ++ +  PLGS+L+++      +  +  L +WA QIA GM YLES+  +H DLAARN+L+ +  Q KI+DFG+++ L     +YQF +GGR PI+W A E     IFS  SDVWS+GVT+WEMFS G  P+ +I   D ++ ++ G+RL QP +C    Y ++  CW   P  RP+F  L + F       N   LVQ
Sbjct:  655 FFIEPEKLVLDREIGHGEFGSVHSG-W------------LLRK--SGAGEES--RLEVAIKMLSD--EHSNKQEFLREASVMMRLEHKCIVRLIGIAKGEMLMMVQELAPLGSMLQYILDHGHEITANAELKVWASQIACGMHYLESQHFVHRDLAARNILLTARHQAKISDFGMSRSLRPGSTEYQFTQGGRWPIRWYAPESFNLGIFSHASDVWSFGVTIWEMFSLGAPPYGEISNVDAIKLVDSGERLPQPNLCPAYIYAVMQSCWKERPKDRPTFVYLTEFFARDPDYQNLPELVQ 935          
BLAST of EGFR-5 vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300549)

HSP 1 Score: 185.267 bits (469), Expect = 6.049e-48
Identity = 103/288 (35.76%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3251 LITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTA-HPKLITQFMPLGSLLEFVQ-RNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMM 4108
            +I E++L  +E IG G FG V  GI                RN             VAVK+L    D    ++ L EA VM +++H   ++ + +  T+ H  L+T++M  GSL+++++ R R  I     +I+A   ASGMEYLE+K ++H DLAARNVLI      K++DFGLA+     ++ Y    G++PIKW A E ++N  FS+KSD+WS+G+ LWE++S+G  P+  I   D+++H+E G ++  P+ C  + Y ++ Q W ++P  RP+F EL+   +++
Sbjct:  465 VIPEAELQLRESIGKGEFGDVMLGIL---------------RN-----------EKVAVKML---KDEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAR-----EECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAELKVKLQLL 718          
BLAST of EGFR-5 vs. Ensembl Fly
Match: Csk (gene:FBgn0262081 transcript:FBtr0300547)

HSP 1 Score: 185.267 bits (469), Expect = 6.049e-48
Identity = 103/288 (35.76%), Postives = 165/288 (57.29%), Query Frame = 2
Query: 3251 LITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTA-HPKLITQFMPLGSLLEFVQ-RNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMM 4108
            +I E++L  +E IG G FG V  GI                RN             VAVK+L    D    ++ L EA VM +++H   ++ + +  T+ H  L+T++M  GSL+++++ R R  I     +I+A   ASGMEYLE+K ++H DLAARNVLI      K++DFGLA+     ++ Y    G++PIKW A E ++N  FS+KSD+WS+G+ LWE++S+G  P+  I   D+++H+E G ++  P+ C  + Y ++ Q W ++P  RP+F EL+   +++
Sbjct:  465 VIPEAELQLRESIGKGEFGDVMLGIL---------------RN-----------EKVAVKML---KDEGAVQKFLAEASVMTTLEHDNLVKFIGLVFTSKHLYLVTEYMSKGSLVDYLRSRGRQHITKKDQIIFAYDTASGMEYLEAKKVVHRDLAARNVLISEDCVAKVSDFGLAR-----EECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIYSFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPPEIYEMMRQAWDLNPAKRPTFAELKVKLQLL 718          
BLAST of EGFR-5 vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 333.183 bits (853), Expect = 6.290e-94
Identity = 188/496 (37.90%), Postives = 269/496 (54.23%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTC-GDRIQ----LFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             SVC+ C   C +       CHG    HC  C + +    C++KCP                               TN +C  C H            C   C G RIQ    +   + +I    LI   F + I   G A         I    +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +I+G+GAFG+VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++LD  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   DI + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  344 GSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGL----------------QGANSFIFKYAETNNECHPC-HPN----------CTQGCTGPRIQDCVGILDRTPLIAAG-LIGGLFVIVIIALGVA-------VYIRRKSIKKKRALRRFLETELV--------EPLTPSGAAPNQAQLRILKETELKRVKILGAGAFGMVYKGIWVP--------------------EGETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDTDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDD 776          

HSP 2 Score: 173.326 bits (438), Expect = 5.883e-43
Identity = 132/423 (31.21%), Postives = 197/423 (46.57%), Query Frame = 2
Query: 1274 PARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKT-YAVNQT--CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKL---ENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRAL---NGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGIN---TCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            P  + C AC NFN++G CV  CP  F ++   +    NP  K  +   CV KCP  F  +H +CV  C + K     NQT  C+PC +  CPK+C        Q    V    + +  NCT  +GN++     ++GD FH       GIR  D  +L     + EI G+L +   +  N TD L    NL  I   ++ S  S  + I+    +  L  ++L+E+  GN+ + +N+QLCF +T+ N + L +    RAL   N +   CSK++  C   C +  GCWGP    C+ CK F     KTC+  C+     +Y    +      C +C S+C        TCHG   + C + C + K G +C++KCP            Y ++   C+PCH NCT+        C GP  +D +G
Sbjct:   36 PKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCTD-ICPKVCDGIGTGSLQMAQTVDSSNIEKFVNCTKINGNLIFLITGIKGDMFH-------GIRALDPDRLNVFRTVREITGFLNVQS-WPENMTD-LGVFSNLATIGGRSLYSGIS--LLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYSTV-NWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSE-AGCWGPGPDQCLSCKYF--SRGKTCVKSCN----LYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHC-VKCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQG-------CTGPRIQDCVG 430          

HSP 3 Score: 56.6102 bits (135), Expect = 2.778e-7
Identity = 56/231 (24.24%), Postives = 99/231 (42.86%), Query Frame = 2
Query:  701 IIGDVV--IAHITNENISFLNSIEDISGYLMIFS---NAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCA-NRTCYDSTKCYINEILK-----------SXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCP 1342
            I GD+   I  +  + ++   ++ +I+G+L + S   N  +      L  I G +  L  G+  SL++     + ++ F +L+ I   NV+  NN +LC+ S  +NW SL R S +  +++ N +    + E+  C   C    ++  CWG     C      +  +TC  S   Y  ++ +           S+     E    C GP    C+ C +  +   CVE CP
Sbjct:  168 IKGDMFHGIRALDPDRLNVFRTVREITGFLNVQSWPENMTDLGVFSNLATIGGRS--LYSGI--SLLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYS-TVNWTSLFRTSTQRALIKNNREPRECSKEQKICDPLC----SEAGCWGPGPDQCLSCKYFSRGKTCVKSCNLYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCP 389          
BLAST of EGFR-5 vs. Ensembl Zebrafish
Match: si:ch73-383l1.1 (si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-64])

HSP 1 Score: 320.472 bits (820), Expect = 1.462e-93
Identity = 146/313 (46.65%), Postives = 212/313 (67.73%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +I+G+GAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++L+ ++++Y    G+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:    6 TPSGTAPNQAQLRILKETELKRVKILGTGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLETNEKEYSADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDD 298          
BLAST of EGFR-5 vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 332.798 bits (852), Expect = 5.318e-93
Identity = 188/496 (37.90%), Postives = 269/496 (54.23%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTC-GDRIQ----LFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             SVC+ C   C +       CHG    HC  C + +    C++KCP                               TN +C  C H            C   C G RIQ    +   + +I    LI   F + I   G A         I    +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +I+G+GAFG+VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++LD  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   DI + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  522 GSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGL----------------QGANSFIFKYAETNNECHPC-HPN----------CTQGCTGPRIQDCVGILDRTPLIAAG-LIGGLFVIVIIALGVA-------VYIRRKSIKKKRALRRFLETELV--------EPLTPSGAAPNQAQLRILKETELKRVKILGAGAFGMVYKGIWVP--------------------EGETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDTDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDD 954          

HSP 2 Score: 228.024 bits (580), Expect = 8.577e-60
Identity = 194/666 (29.13%), Postives = 304/666 (45.65%), Query Frame = 2
Query:  623 STQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSM------LENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQK------------------INDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKT-YAVNQT--CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKL---ENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRAL---NGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGIN---TCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            ST + +D     Y++L R F +NC  ++G++ I  I  N N+SFL SI +++GY+++  N  + + L  L++IRG    L +G ++SL +  N        L  +   NL  IL   V+ + N  LC+A   I+W+ +++  + E+++V +N       N    CH SC        CWG+    CQ                   +++C +R C  +  C+                    GP  + C AC NFN++G CV  CP  F ++   +    NP  K  +   CV KCP  F  +H +CV  C + K     NQT  C+PC +  CPK+C        Q    V    + +  NCT  +GN++     ++GD FH       GIR  D  +L     + EI G+L +   +  N TD L    NL  I   ++ S  S  + I+    +  L  ++L+E+  GN+ + +N+QLCF +T+ N + L +    RAL   N +   CSK++  C   C +  GCWGP    C+ CK F     KTC+  C+     +Y    +      C +C S+C        TCHG   + C + C + K G +C++KCP            Y ++   C+PCH NCT+        C GP  +D +G
Sbjct:   10 STLSDLD---QQYKTL-RKFYENCEVVMGNLEITSIERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK--LYEG-RYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQNKFLCHAD-TIHWHDIIKNPRSELLVVPSNNS----GNTCRRCHRSCNGR-----CWGHQEDQCQSLTKTVCAEQCDGRCFGPYVSNCCHREC--AGGCF--------------------GPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCTD-ICPKVCDGIGTGSLQMAQTVDSSNIEKFVNCTKINGNLIFLITGIKGDMFH-------GIRALDPDRLNVFRTVREITGFLNVQS-WPENMTD-LGVFSNLATIGGRSLYSGIS--LLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYSTV-NWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSE-AGCWGPGPDQCLSCKYF--SRGKTCVKSCN----LYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHC-VKCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQG-------CTGPRIQDCVG 608          
BLAST of EGFR-5 vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 331.257 bits (848), Expect = 7.045e-93
Identity = 193/513 (37.62%), Postives = 278/513 (54.19%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYV----------------NGSTQFFCNST--CGDRIQ----LFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             SVC+ C   C +       CHG    HC  C + +    C++KCP       +   K      +CH        GS   +  RC+   +Y                 N     F N T   G RIQ    +   + +I    LI   F + I   G A         I    +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +I+G+GAFG+VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++LD  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   DI + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  522 GSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQGSVACNRFRCRTRILYRTSCDNPMQSYNCSLDRNMFDAMFLNVTYCTGPRIQDCVGILDRTPLIAAG-LIGGLFVIVIIALGVA-------VYIRRKSIKKKRALRRFLETELV--------EPLTPSGAAPNQAQLRILKETELKRVKILGAGAFGMVYKGIWVP--------------------EGETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDTDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDD 998          

HSP 2 Score: 228.024 bits (580), Expect = 8.307e-60
Identity = 194/633 (30.65%), Postives = 300/633 (47.39%), Query Frame = 2
Query:  623 STQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSM------LENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKT-YAVNQT--CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKL---ENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRAL---NGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGIN---TCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENS 2416
            ST + +D     Y++L R F +NC  ++G++ I  I  N N+SFL SI +++GY+++  N  + + L  L++IRG    L +G ++SL +  N        L  +   NL  IL   V+ + N  LC+A   I+W+ +++  + E+++V +N       N    CH SC        CWG+    CQ +    CA +        Y++           EC GGC GP  + C AC NFN++G CV  CP  F ++   +    NP  K  +   CV KCP  F  +H +CV  C + K     NQT  C+PC +  CPK+C        Q    V    + +  NCT  +GN++     ++GD FH       GIR  D  +L     + EI G+L +   +  N TD L    NL  I   ++ S  S  + I+    +  L  ++L+E+  GN+ + +N+QLCF +T+ N + L +    RAL   N +   CSK++  C   C +  GCWGP    C+ CK F     KTC+  C+     +Y    +      C +C S+C        TCHG   + C + C + K G +C++KCP            Y ++   C+PCH NCT+ S
Sbjct:   10 STLSDLD---QQYKTL-RKFYENCEVVMGNLEITSIERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK--LYEG-RYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQNKFLCHAD-TIHWHDIIKNPRSELLVVPSNNS----GNTCKRCHRSCNGR-----CWGHQEDQCQSLTKTVCAEQCDGRCFGPYVSNCCHR------ECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCTD-ICPKVCDGIGTGSLQMAQTVDSSNIEKFVNCTKINGNLIFLITGIKGDMFH-------GIRALDPDRLNVFRTVREITGFLNVQS-WPENMTD-LGVFSNLATIGGRSLYSGIS--LLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYSTV-NWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSE-AGCWGPGPDQCLSCKYF--SRGKTCVKSCN----LYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHC-VKCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQGS 598          

HSP 3 Score: 71.2478 bits (173), Expect = 1.056e-11
Identity = 84/315 (26.67%), Postives = 121/315 (38.41%), Query Frame = 2
Query: 1610 ENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHK-SRGIEI----VGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGR---FLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKN-------------------------------YKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTC 2437
            ENC V  GN+ I   S+E              R ++L  L+++ E+ GY+ + +    N  D L  L+NLRIIR   +   + S  I +     G   L+ LGL+NL E+ NG + +  N  LC ++T+    I+   R    +   N     C  K+CH  C  R  CWG ++  C      V  E   C  +C     Y  N             CH EC  G   C G  + +C   C N                               Y +G  C+KKCP  + VD       C +N  E  +N+   C
Sbjct:   27 ENCEVVMGNLEIT--SIE--------------RNRNLSFLKSIREVTGYVLVAL----NQFDYLP-LENLRIIRGTKLYEGRYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQNKFLCHADTIHWHDIIKNPRSELLVVPSNNSGNTC--KRCHRSCNGR--CWGHQEDQCQSLTKTVCAEQ--CDGRCFGP--YVSNC------------CHRECAGG---CFGPKDTDC-FACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMC 296          
BLAST of EGFR-5 vs. Ensembl Zebrafish
Match: egfra (epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) [Source:ZFIN;Acc:ZDB-GENE-030918-1])

HSP 1 Score: 323.168 bits (827), Expect = 1.197e-90
Identity = 148/335 (44.18%), Postives = 225/335 (67.16%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            T SG  PN A L ++ E++  + +++GSGAFG V+KG+W P                    +  ++K+ VA+K+L + + P  N+EI++EA VMASV+HP   R+L +CLT+  +LITQ MP G LL++V+ N+  I S  LL W  QIA GM YLE + ++H DLAARNVL+++P+ VKITDFGLAK+L+  +++Y   GG++PIKW+A+E I++R ++ +SDVWSYGVT+WE+ ++G KP+  I A +I   LEKG+RL QP IC+ID Y I+V+CW++D ++RP F EL   F  M+ +P+RYL++Q +D    +++    D++ Y   +  
Sbjct:  692 TPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVHKGLWVP--------------------EGENVKIPVAIKVLREATSPKANKEIMDEAYVMASVEHPHVCRLLGICLTSTVQLITQLMPYGCLLDYVRENKDRIGSQHLLNWCVQIAKGMNYLEERHLVHRDLAARNVLVKTPQHVKITDFGLAKLLNADEKEYHADGGKVPIKWMALESIQHRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIAEFTKMARDPSRYLVIQGDDR---MHLPSPSDSKFYRSLMSG 1003          

HSP 2 Score: 233.417 bits (594), Expect = 1.101e-61
Identity = 201/659 (30.50%), Postives = 307/659 (46.59%), Query Frame = 2
Query:  611 KVCKSTQ---TQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNE-NISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLEN----ILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETN---EKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHD--GMKYIQNPLGKLAFYYICVDKCPKKF-FNEHGNCVTQCSAEKTYAVNQT----CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFL---KNLRIIRAENVRSHKSRGIE--IVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGK---IENCSKKKC---HSECEQRL---GCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECL--PGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQNKESTCHGPE 2449
            KVC+      T +   ++ Y+ L R + +NC+ ++ ++ I HIT + ++SFL SI+++ GY++I  N V  I L  L++IRG + L       +++V YN+ +E     +   +L  IL+  V FN N  LC     I W  ++       IV  N    K+CG       C  SC    N + CWG     CQ++    CA +    S +C   +  +  +CC+E C  GCTGP  + CLACK+F + G C + CP    +D    +   NP GK +F   C+  CP  +   +HG CV  CS   TY V++     C  C  G CPK+C    +     +  ++   +   ENCT   GN+ I   +  GD   N S    G+    L  L  ++EI GYL I +     W +S++ L   +NL +IR       K++G     V   A+ +LG+R+L+E+ +G++ I  N  LC+S      S  H  R  ++       IEN     C   +S C +     GCWGP    C  C+ +     K C++ C+           ++EVN++C +C  ECL      TC+G   ++C + C NYK G  C+ +CP             Y D    C PCH NCT+        C GP+
Sbjct:   26 KVCQGANNKLTLLGTVEDHYQVLLRMY-RNCTVVLENLEITHITEKYDLSFLKSIQEVGGYVLIAVNTVSKIPLENLRIIRGHS-LYEDKFALAVLVNYNNSIEQGVKELPLTSLTEILKGGVRFNMNNHLCNVG-TIEWADILNMKSLPTIVSHNISYGKNCG------KCDPSC---FNGS-CWGTGPDKCQRMTKVICAEQC---SGRC---KGPRPIDCCNEHCAAGCTGPRPTDCLACKDFQDEGTCKDACPRLMLYDPNTHQLAPNPYGKYSFGATCIKTCPHNYVVTDHGACVRTCSP-GTYEVDEGGVRKCKRC-EGLCPKVCNGLGMGPLANVLSINATNIDSFENCTKISGNVAILSTTFRGDPHTNTS----GLDPAKLSVLSTVKEITGYLMIQL-----WPESMQSLSAFENLEVIRGRT----KTQGTYSFAVTKTAITHLGMRSLREISDGDVSIVKNKNLCYS------SPEHWKRLFKSKQQSVKMIENMDAATCANQNSTCNEMCTADGCWGPGPTMCFGCEHY--SRGKHCVASCN----LLNGEPREYEVNKTCMECDPECLLMNETQTCNGPGPDKCTV-CANYKDGPHCVHRCPQGVPGEKDTLIWKYADVTHVCQPCHENCTQG-------CTGPD 630          
BLAST of EGFR-5 vs. Ensembl Xenopus
Match: EGFR (epidermal growth factor receptor [Source:NCBI gene;Acc:100492965])

HSP 1 Score: 345.51 bits (885), Expect = 3.200e-98
Identity = 279/917 (30.43%), Postives = 424/917 (46.24%), Query Frame = 2
Query: 1706 RKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNP------ALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALN--------------------------GKIENCSKKKCHSECEQRL---------------GCWGPEKYHCVKCKSFVIRESKTCLSKCS-----NEPGYFYNSSSDHEVNRSCSKCHSECLPG-INTCHGSNENECNLGCKNYKF-GESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKE-----STCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPK-GFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCL-------PCHPYCSE--CHGGSSWHCSLCKYFRSDNKCIQKC------PKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYD-CLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEII-------------------CTDH------LIYSRFNMYI-YIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            R  D   L N++E+ GY+ I +    N   S+  L+NL+I+R  N+    +  + IV N       AL+ L +  L E+ NG ++I  N +LC+ NT+    I+H    +  ++                          G  +  +K  C  +C  R                GC GP + +C+ C+ F  R+ +TC   C      N   Y  + + D + +   S C  +C    + T HGS    CN   +  +  G    KKC   Y V    N     +  + N+ N +     +  +G    L   G           + +      S   I   L N     K G Y   I  RS    +  ++S  ++ +  + I TN +L   SV          C P CSE  C G   + C  C+ +    +C++ C      P+EY     E  K  +   +C +            D C +C H       S   FC  TC   IQ   ++ I                    C  H      L +S  ++    +GG  G V+  +        S  N+++  +  L  +    P    T SG  PN A L ++ E++  + +++GSGAFG VY+G+W P                    +   IK+ VA+K L + + P  N+EIL+EA VMASV++P   R+L +CLT+  +LITQ MP G LL++V+ N+  I S  LL W  QIA GM YLE + ++H DLAARNVL++ P+ VKITDFGLAK+L   ++ Y  +GG++PIKW+A+E I +R ++ +SDVWSYGVT+WE+ ++G KP+  I A +I   LEKG+RL QP IC+ID Y I+V+CW++D ++RP F EL   F  M+ +P RYL++Q +D
Sbjct:   62 RLNDTSFLRNIQEVGGYVLIAI----NSVRSIH-LENLQIVRG-NMLYKSTYALAIVSNESLNTTNALEELHMGRLTEILNGGVLISKNRKLCYLNTIQWNDIVHTDNPINKISVDKSFSPQCPKCDAESCNGSCWGPGQGNCQKLTKLTCAQQCSGRCRGPLPSDCCHSQCASGCTGPRENNCLACRKF--RDGETCKEGCPQLQIYNPATYQMDLNPDGKYSFGAS-CVKKCPHNYVVTDHGSCVRTCNSDSQEVEENGIRICKKCDGSYKVCDGINMGKLKSVLSVNASNIDLFQNCTKVNGDVAILHVAGYGDPFTNTSKLDPAKLSVFKSVREITGWLCNLPFIAKFGIYSLAIVKRS--ITSLGLRSLKEVSDGDVIIKTNKNLCFFSVLGFLESEGNVCDPLCSEEGCWGPGPFQCVSCRKYMRGRECVENCNFLSGEPREY----TEDGKCFACNAECLQLNETQTCSGPGADECFKCGH------NSDGPFCVKTCPAGIQGENSTLIWKYPDETGACQLCHPECKLGCVGHGLDGCPLPWSSHSVAAGVVGGILGAVVIGLVAFFFIRRSRINRKRTLRRILQERELVEPV---TPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYQGLWIP--------------------EGEGIKIPVAIKELREATSPKANKEILDEAYVMASVENPYVCRLLGICLTSTVQLITQLMPFGCLLDYVRDNKDNIGSQHLLNWCVQIAKGMNYLEERRLVHRDLAARNVLVKGPQHVKITDFGLAKLLGADEKAYHAEGGKVPIKWMALESILHRTYTHQSDVWSYGVTVWELMTFGLKPYDGIPASEISNILEKGERLPQPPICTIDVYMIMVKCWMIDAESRPKFRELSAEFTKMARDPTRYLVIQGDD 934          

HSP 2 Score: 175.637 bits (444), Expect = 1.299e-43
Identity = 171/614 (27.85%), Postives = 271/614 (44.14%), Query Frame = 2
Query:  635 QIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNEN-ISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSM-----LENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQ--NPLGKLAFYYICVDKCPKKF-FNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP--GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNC 2404
            Q+  +   Y SLKR +D  C  ++G++ I ++   N  SFL +I+++ GY++I  N+V SI L  L+++RG   +L K      IV   S+     LE +    L  IL   V  + N KLCY +  I WN ++     +  +  ++      +    C + C A      CWG     CQK+      TC           L S +CCH +C  GCTGP  + CLAC+ F +   C E CP    ++   Y    NP GK +F   CV KCP  +   +HG+CV  C+++         + C  C      K+C   ++   + +  V+   +   +NCT  +G++ I   +  GD F N SK    +    L   +++ EI G+L  ++PF + +      + +L I++                  ++  LGLR+LKEV +G++II +N  LCF + L          FL +  G +       C   C +  GCWGP  + CV C+ ++    + C+  C+    +      ++  +  C  C++ECL      TC G   +EC   C +   G  C+K CPA            Y D    C  CH  C
Sbjct:   30 QLGNTDEHYASLKRMYD-GCEIVLGNLEITYLDRLNDTSFLRNIQEVGGYVLIAINSVRSIHLENLQIVRGN--MLYKSTYALAIVSNESLNTTNALEELHMGRLTEILNGGVLISKNRKLCYLN-TIQWNDIVHTDNPINKISVDK------SFSPQCPK-CDAESCNGSCWGPGQGNCQKL---TKLTCAQQCSGRCRGPLPS-DCCHSQCASGCTGPRENNCLACRKFRDGETCKEGCPQLQIYNPATYQMDLNPDGKYSFGASCVKKCPHNYVVTDHGSCVRTCNSDSQEVEENGIRICKKCDGSY--KVCDGINMGKLKSVLSVNASNIDLFQNCTKVNGDVAILHVAGYGDPFTNTSK----LDPAKLSVFKSVREITGWL-CNLPFIAKFG-----IYSLAIVKR-----------------SITSLGLRSLKEVSDGDVIIKTNKNLCFFSVLG---------FLES-EGNV-------CDPLCSEE-GCWGPGPFQCVSCRKYM--RGRECVENCN----FLSGEPREYTEDGKCFACNAECLQLNETQTCSGPGADEC-FKCGHNSDGPFCVKTCPAGIQGENSTLIWKYPDETGACQLCHPEC 574          
BLAST of EGFR-5 vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 323.939 bits (829), Expect = 4.016e-91
Identity = 148/313 (47.28%), Postives = 211/313 (67.41%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L V L+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP +C+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  517 TPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 809          

HSP 2 Score: 171.785 bits (434), Expect = 2.310e-42
Identity = 144/480 (30.00%), Postives = 205/480 (42.71%), Query Frame = 2
Query: 1073 NNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRS-CSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKES 2431
            N E   C +SC        CWG S   CQ++    CA +    CY S   Y+++    E             P  + C +C  FN++G CV  CP    +     +  QNP  K  +   CV+KCP  F  +  +CV  C + K        + C PC  G CPK+C        Q    V    + +  NCT  +GN+      ++GD +HN++     +  Q L     + EI G+L I   +  N TD L    NL  I    + S  S  + I+   +L  L  ++LKE+  GN+ I  N  LC+ +T+   S+      R     N K ENC+ +   C   C    GCWGP    C+ C+ F     K+C+  C+      Y   S   VN S C  C S+C      I TC+G   + C   C N+K G +C++KCP            Y D  K C+PCH NCT+   N  S
Sbjct:    4 NAECGRCPKSCMGR-----CWGPSDQHCQRLTKTVCAEQCDGRCYGS---YVSDCCHRECAGGCTG------PKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYHNIA----ALEPQKLNIFFTVREITGFLNIQS-WPRNMTD-LSVFSNLVNIGGRVLYSGIS--LLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSN-AGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTS 451          

HSP 3 Score: 58.9214 bits (141), Expect = 8.791e-8
Identity = 71/274 (25.91%), Postives = 112/274 (40.88%), Query Frame = 2
Query:  611 KVCKSTQTQIDVSKNSYESLKRNFDK--NCSYIIGDVV-------------IAHITNENISFLNSIEDISGYLMIFS---NAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCA-NRTCYDSTKCYINE-----------ILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCP 1342
            KVC    T    S  + +S   N DK  NC+ I G++              IA +  + ++   ++ +I+G+L I S   N  +      L  I G   +L  G+  SL++     L ++ F +L+ I   NV+  +N  LCY    +NW SL R S +   +  N+K      E + C   C    +   CWG  ++ C      +  ++C  S   Y  E           +  S+    E+ +  C GP    C  C NF +   CVE CP
Sbjct:  153 KVCDGIGTGSLQSAQTVDS--SNIDKFINCTKINGNLHFLVTGIDGDPYHNIAALEPQKLNIFFTVREITGFLNIQSWPRNMTDLSVFSNLVNIGGR--VLYSGI--SLLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYY-HTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLC----SNAGCWGPGANQCLSCRYFSRGKSCVRSCNLYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTKCSNFKDGPNCVEKCP 415          
BLAST of EGFR-5 vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 323.168 bits (827), Expect = 1.104e-90
Identity = 148/313 (47.28%), Postives = 211/313 (67.41%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L V L+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP +C+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  632 TPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 924          

HSP 2 Score: 185.267 bits (469), Expect = 1.558e-46
Identity = 174/635 (27.40%), Postives = 263/635 (41.42%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHI-TNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHL--NKTYCWGNSSSAC--QKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRS-CSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENS 2416
            VC  T+ ++    +    Y++L++ ++ NC  ++G++ I  I    N+SFL SI +++GY+++  N  + + L  L++IRG   L       ++ + Y    N  L  +   NL  IL   V+   N  LCYA   I+W  ++R     ++  ++  +  L    L  H  C   L   KT C       C    ++DC +R C  +  C                    TGP  + C +C  FN++G CV  CP    +     +  QNP  K  +   CV+KCP  F  +  +CV  C + K        + C PC  G CPK+C        Q    V    + +  NCT  +GN+            H L    DG        L+     + +L I   +  N TD L    NL  I                   +L  L  ++LKE+  GN+ I  N  LC+ +T+   S+      R     N K ENC+ +   C   C    GCWGP    C+ C+ F     K+C+  C+      Y   S   VN S C  C S+C      I TC+G   + C   C N+K G +C++KCP            Y D  K C+PCH NCT+ +
Sbjct:   19 VCAGTENKLSSLSDLEQQYKALRKYYE-NCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIK-LYEDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQNKFLCYAD-TIHWQDIVRTPNATLVPMSSNAEFLLLQPVLPAH-MCLPFLLVTKTVCAEQCDGRCYGSYVSDCCHREC--AGGC--------------------TGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNL------------HFLVTGIDG------SVLKQYFFFFRFLNIQS-WPRNMTD-LSVFSNLVNIGGRQQ--------------SLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSN-AGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGT 583          
BLAST of EGFR-5 vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 323.553 bits (828), Expect = 2.307e-90
Identity = 148/313 (47.28%), Postives = 211/313 (67.41%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L V L+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP +C+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  666 TPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 958          

HSP 2 Score: 219.164 bits (557), Expect = 5.241e-57
Identity = 186/626 (29.71%), Postives = 282/626 (45.05%), Query Frame = 2
Query:  650 KNSYESLKRNFDKNCSYIIGDVVIAHI-TNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRS-CSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKES 2431
            +  Y++L++ ++ NC  ++G++ I  I    N+SFL SI +++GY+++  N  + + L  L++IRG   L       ++ + Y    N  L  +   NL  IL   V+   N  LCYA   I+W  ++R     ++  ++ +          C +SC        CWG S   CQ++    CA +    CY S   Y+++          EC GGCTGP  + C +C  FN++G CV  CP    +     +  QNP  K  +   CV+KCP  F  +  +CV  C + K        + C PC  G CPK+C        Q    V    + +  NCT  +GN+      ++GD +HN++     +  Q L     + EI G+L I   +  N TD L    NL  I    + S  S  + I+   +L  L  ++LKE+  GN+ I  N  LC+ +T+   S+      R     N K ENC+ +   C   C    GCWGP    C+ C+ F     K+C+  C+      Y   S   VN S C  C S+C      I TC+G   + C   C N+K G +C++KCP            Y D  K C+PCH NCT+   N  S
Sbjct:   20 EQQYKALRKYYE-NCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIK-LYEDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQNKFLCYAD-TIHWQDIVRTPNATLVPMSSGR----------CPKSCMGR-----CWGPSDQHCQRLTKTVCAEQCDGRCYGS---YVSDCCHR------ECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYHNIA----ALEPQKLNIFFTVREITGFLNIQS-WPRNMTD-LSVFSNLVNIGGRVLYSGIS--LLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSN-AGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTS 600          
BLAST of EGFR-5 vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 323.939 bits (829), Expect = 2.333e-90
Identity = 148/313 (47.28%), Postives = 211/313 (67.41%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L V L+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP +C+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  670 TPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 962          

HSP 2 Score: 220.705 bits (561), Expect = 2.141e-57
Identity = 189/641 (29.49%), Postives = 288/641 (44.93%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHI-TNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRS-CSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKES 2431
            VC  T+ ++    +    Y++L++ ++ NC  ++G++ I  I    N+SFL SI +++GY+++  N  + + L  L++IRG   L       ++ + Y    N  L  +   NL  IL   V+   N  LCYA   I+W  ++R     ++  ++ +          C +SC        CWG S   CQ++    CA +    CY S   Y+++          EC GGCTGP  + C +C  FN++G CV  CP    +     +  QNP  K  +   CV+KCP  F  +  +CV  C + K        + C PC  G CPK+C        Q    V    + +  NCT  +GN+      ++GD +HN++     +  Q L     + EI G+L I   +  N TD L    NL  I    + S  S  + I+   +L  L  ++LKE+  GN+ I  N  LC+ +T+   S+      R     N K ENC+ +   C   C    GCWGP    C+ C+ F     K+C+  C+      Y   S   VN S C  C S+C      I TC+G   + C   C N+K G +C++KCP            Y D  K C+PCH NCT+   N  S
Sbjct:    9 VCAGTENKLSSLSDLEQQYKALRKYYE-NCEVVMGNLEITSIEPGRNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGIK-LYEDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQNKFLCYAD-TIHWQDIVRTPNATLVPMSSGR----------CPKSCMGR-----CWGPSDQHCQRLTKTVCAEQCDGRCYGS---YVSDCCHR------ECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPC-AGICPKVCDGIGTGSLQSAQTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYHNIA----ALEPQKLNIFFTVREITGFLNIQS-WPRNMTD-LSVFSNLVNIGGRVLYSGIS--LLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSN-AGCWGPGANQCLSCRYF--SRGKSCVRSCN-----LYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCT-KCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTS 604          
BLAST of EGFR-5 vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 326.635 bits (836), Expect = 2.457e-91
Identity = 149/313 (47.60%), Postives = 212/313 (67.73%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +++GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  699 TPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 991          

HSP 2 Score: 213.772 bits (543), Expect = 2.154e-55
Identity = 180/648 (27.78%), Postives = 285/648 (43.98%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRS--QEVVIVETN-EKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHK--GRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP 2446
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  N ++SFL SI +++GY+++  N    + L  L++IRG   L       ++ + Y    N  L+ +   NL  IL   V+ + N  LCYA   I+W  ++R      + +V TN    CG       CH+SC        CWG + + CQ +    CA +    CY     Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    N   K  +   CV KCP  F  +  +CV  C + K        + C PC +  CPK C             V    + +  NCT  +GN++     + GD ++ +    D I  + L     + EI G+L I   +  N TD      NL  I    + S  S  + I+    +  L  ++LKE+  GNI I  N+ LC+ +T+   ++      R +   N + ENC+ +   C+  C    GCWGP    C+ C+ F     K C+  C+   G F     + E    C +C S+C     G+ TCHG   + C   C ++K G +C++KCP            Y D  + C+PCH NCT+        C+GP
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYYE-NCEVVMGNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTK-LYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYAD-TIHWQDIVRNPWPSNMTLVSTNGSSGCG------RCHKSCTGR-----CWGPTENHCQTLTRTVCAEQCDGRCYGP---YVSDCCHRECAGGCSG------PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAI----DAIDPEKLNVFRTVREITGFLNIQS-WPPNMTD-FSVFSNLVTIGGRVLYSGLS--LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCSND-GCWGPGPDQCLSCRRF--SRGKICIESCNLYDGEF----REFENGSICVECDSQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQG-------CNGP 628          
BLAST of EGFR-5 vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 326.635 bits (836), Expect = 2.644e-91
Identity = 149/313 (47.60%), Postives = 212/313 (67.73%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +++GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  699 TPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 991          

HSP 2 Score: 213.386 bits (542), Expect = 2.888e-55
Identity = 180/648 (27.78%), Postives = 285/648 (43.98%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRS--QEVVIVETN-EKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHK--GRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP 2446
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  N ++SFL SI +++GY+++  N    + L  L++IRG   L       ++ + Y    N  L+ +   NL  IL   V+ + N  LCYA   I+W  ++R      + +V TN    CG       CH+SC        CWG + + CQ +    CA +    CY     Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    N   K  +   CV KCP  F  +  +CV  C + K        + C PC +  CPK C             V    + +  NCT  +GN++     + GD ++ +    D I  + L     + EI G+L I   +  N TD      NL  I    + S  S  + I+    +  L  ++LKE+  GNI I  N+ LC+ +T+   ++      R +   N + ENC+ +   C+  C    GCWGP    C+ C+ F     K C+  C+   G F     + E    C +C S+C     G+ TCHG   + C   C ++K G +C++KCP            Y D  + C+PCH NCT+        C+GP
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYYE-NCEVVMGNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTK-LYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYAD-TIHWQDIVRNPWPSNMTLVSTNGSSGCG------RCHKSCTGR-----CWGPTENHCQTLTRTVCAEQCDGRCYGP---YVSDCCHRECAGGCSG------PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAI----DAIDPEKLNVFRTVREITGFLNIQS-WPPNMTD-FSVFSNLVTIGGRVLYSGLS--LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCSND-GCWGPGPDQCLSCRRF--SRGKICIESCNLYDGEF----REFENGSICVECDSQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQG-------CNGP 628          
BLAST of EGFR-5 vs. Ensembl Mouse
Match: Egfr (epidermal growth factor receptor [Source:MGI Symbol;Acc:MGI:95294])

HSP 1 Score: 318.931 bits (816), Expect = 4.201e-89
Identity = 149/313 (47.60%), Postives = 214/313 (68.37%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++  + +++GSGAFG VYKG+W P                    +   +K+ VA+K L + + P  N+EIL+EA VMASVD+P   R+L +CLT+  +LITQ MP G LL++V+ ++  I S  LL W  QIA GM YLE + ++H DLAARNVL+++P+ VKITDFGLAK+L   +++Y  +GG++PIKW+A+E I +RI++ +SDVWSYGVT+WE+ ++G KP+  I A DI   LEKG+RL QP IC+ID Y I+V+CW++D D+RP F EL   F  M+ +P RYL++Q ++
Sbjct:  695 TPSGEAPNQAHLRILKETEFKKIKVLGSGAFGTVYKGLWIP--------------------EGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYLVIQGDE 987          

HSP 2 Score: 243.047 bits (619), Expect = 1.139e-64
Identity = 197/663 (29.71%), Postives = 310/663 (46.76%), Query Frame = 2
Query:  611 KVCKSTQ---TQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNS---MLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCY-----DSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQ--NPLGKLAFYYICVDKCPKKFF-NEHGNCVTQCSAEKTYAVNQT----CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILH-KGRFLRALNGKIENCSKK---KCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCS---NEPGYFYNSSSDHEVNRSCSKCHSECLP-GIN-TCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSI 2479
            KVC+ T    TQ+   ++ + SL+R ++ NC  ++G++ I ++  N ++SFL +I++++GY++I  N VE I L  L++IRG N L       +++  Y +    L  +   NLQ IL   V F+NNP LC     I W  +++     V +     D  L +   SC + C        CWG     CQK+    CA +  +       + C  N+                  P  S CL C+ F +   C + CPP   ++   Y    NP GK +F   CV KCP+ +   +HG+CV  C  +  Y V +     C  C +G C K+C    I + ++   ++   +   + CT   G++ I   + +GD+F     +   +  ++L+ L+ ++EI G+L I   +  NWTD L   +NL IIR    + H    + +VG   +  LGLR+LKE+ +G++II  N  LC++NT+  K +     +  + +N + E   K     C+  C    GCWGPE   CV C++  +   + C+ KC+    EP  F         N  C +CH ECLP  +N TC G   + C + C +Y  G  C+K CPA            Y D+   C+ CH NCT         C GP    G +GC +
Sbjct:   29 KVCQGTSNRLTQLGTFEDHFLSLQRMYN-NCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRG-NALYENTYALAILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMD-TIQWRDIVQN----VFMSNMSMD--LQSHPSSCPK-CDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGCTG-----------PRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGPD-YYEVEEDGIRKCKKC-DGPCRKVCNGIGIGEFKDTLSINATNIKHFKYCTAISGDLHILPVAFKGDSF----TRTPPLDPRELEILKTVKEITGFLLIQA-WPDNWTD-LHAFENLEIIRGR-TKQHGQFSLAVVGL-NITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKLFGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSE-GCWGPEPRDCVSCQN--VSRGRECVEKCNILEGEPREFVE-------NSECIQCHPECLPQAMNITCTGRGPDNC-IQCAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYG-------CAGP----GLQGCEV 638          
BLAST of EGFR-5 vs. Ensembl Mouse
Match: Erbb2 (erb-b2 receptor tyrosine kinase 2 [Source:MGI Symbol;Acc:MGI:95410])

HSP 1 Score: 314.309 bits (804), Expect = 1.766e-87
Identity = 146/313 (46.65%), Postives = 210/313 (67.09%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG +PN A + ++ E++L + +++GSGAFG VYKGIW P+                      ++K+ VA+K+L + + P  N+EIL+EA VMA V  P   R+L +CLT+  +L+TQ MP G LL+ V+ +R  + S  LL W  QIA GM YLE   ++H DLAARNVL++SP  VKITDFGLA++LD  + +Y   GG++PIKW+A+E I  R F+ +SDVWSYGVT+WE+ ++G KP+  I A +I + LEKG+RL QP IC+ID Y I+V+CW++D + RP F EL   F  M+ +P R++++Q+ED
Sbjct:  702 TPSGAVPNQAQMRILKETELRKLKVLGSGAFGTVYKGIWIPD--------------------GENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNED 994          

HSP 2 Score: 195.282 bits (495), Expect = 1.048e-49
Identity = 171/659 (25.95%), Postives = 278/659 (42.19%), Query Frame = 2
Query:  611 KVCKST--QTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHI-TNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN----------------SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKI------NDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPP--EFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFN-EHGNCVTQCSAEKTYAV----NQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDS---LEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTL--------TNKSILHKGRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP--GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY-----------YVDSMKNCYPCHTNCTEN 2413
            +VC  T  + ++  S  ++  + R+  + C  + G++ + ++  N ++SFL  I+++ GY++I  N V+ + L +L+++RG     +   K++L V  N                  L  +   +L  IL+  V    NP+LCY    + W  ++R++ ++  V+ +       N   +C   C       +CWG S   CQ +      + CA       T C   +               CTGP  S CLAC +FN++GIC  +CP    +  D  + + NP G+  F   CV  CP  + + E G+C   C             Q C  C +  C  +C    +   +    +    +     C    G++     S +G    N S     ++ + L+  E LEEI GYL I     S W +S   L   +NLR+IR   +  H       +    +  LGLR+L+E+ +G  +I  N  LCF NT+         ++++LH G      N   E C  +   C+S C  R  CWGP    CV C  F+    + C+ +C      +     ++   + C  CH EC P     TC+GS  ++C   C +YK   SC+ +CP+             Y D    C PC  NCT +
Sbjct:   24 QVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQ---LFEDKYALAVLDNRDPLDNVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQD-MVLWKDVLRKNNQLAPVDMD------TNRSRAC-PPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAG-----------CTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKC-SKPCAGVCYGLGMEHLRGARAITSDNIQEFAGCKKIFGSLAFLPESFDG----NPSSGVAPLKPEHLQVFETLEEITGYLYI-----SAWPESFQDLSVFQNLRVIRGRIL--HDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNTVPWDQLFRNPHQALLHSG------NRPEEACGLEGLVCNSLC-ARGHCWGPGPTQCVNCSQFL--RGQECVEECR----VWKGLPREYVRGKHCLPCHPECQPQNSSETCYGSEADQCE-ACAHYKDSSSCVARCPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHS 634          
BLAST of EGFR-5 vs. Ensembl Mouse
Match: Erbb3 (erb-b2 receptor tyrosine kinase 3 [Source:MGI Symbol;Acc:MGI:95411])

HSP 1 Score: 262.692 bits (670), Expect = 1.418e-70
Identity = 150/491 (30.55%), Postives = 245/491 (49.90%), Query Frame = 2
Query: 2711 CLPCHPYC------SECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTC-GDRIQ--LFQTSEIICTDHLIYS----RFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGD-FYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 4141
            C  CHP C      S C+G  S  C+ C +FR    C+  CP           K                      +C  C              C   C G  +Q  L Q   ++   HL+ +       +++ +GG              +    + Q K+   + + +G+   P D    +    N     +  E++L + +++GSG FG V+KGIW                    I +  SIK+ V +K++ D S   + + + +    + S+DH   +R+L +C  +  +L+TQ++PLGSLL+ V+++R  +    LL W  QIA GM YLE   ++H DLA RNV+++SP QV++ DFG+A +L    +Q      + PIKW+A+E I    ++ +SDVWSYGVT+WE+ ++G +P+A ++  +I + LEKG+RL QP+IC+ID Y ++V+CW++D + RP+F EL   F  M+ +P RYL+++
Sbjct:  549 CFSCHPECQPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPIYK----------------YPDAQNECRPCHEN-----------CTQGCKGPELQDCLGQAEVLMSKPHLVIAVTVGLTVIFLILGG-----------SFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKA----NKVLARIFKETELRKLKVLGSGVFGTVHKGIW--------------------IPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAVGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAKGMYYLEEHSMVHRDLALRNVMLKSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEIPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIK 977          

HSP 2 Score: 216.083 bits (549), Expect = 4.229e-56
Identity = 185/662 (27.95%), Postives = 283/662 (42.75%), Query Frame = 2
Query:  614 VCKSTQTQIDV---SKNSYESLKRNFDKNCSYIIGDV-VIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIV--GYNS----MLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CA---NRTCY--DSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYY--ICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIE--IVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILH---KGRFLRALNGKIENC--SKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCS---NEPGYFYNSSSDHEVNRSCSKCHSECLP--GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGPE--DSLGQ 2464
            VC  T   + V   + N Y++L + ++K C  ++G++ ++    N ++SFL  I +++GY+++  N    + L  L+V+RG     +   KF++ V   YN+     L  + F  L  IL   V+   N KLC+    I+W  ++R     ++V+ N  +C        CHE C     K  CWG     CQ +    CA   N  C+  +  +C  +E                  P  + C AC++FN++G CV  CP    ++ + +   P   + + Y  +CV  CP  F  +   CV  C A+K        + C PC  G CPK C             V    +    NCT   GN+      L GD +H +      +  + L     + EI GYL I      +W   +        +     RS  +RG    I+ N  +  LG R+LKE+  G + I +N QLC+ ++L    +L    + R     N  +  C    K C   C    GCWGP    C+ C+++  RE   C++ C+    EP  F      HE +  C  CH EC P  G +TC+GS  + C   C +++ G  C+  CP            Y D+   C PCH NCT+        C GPE  D LGQ
Sbjct:   28 VCPGTLNGLSVTGDADNQYQTLYKLYEK-CEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQ---VYDGKFAIFVMLNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHMD-TIDWRDIVRVPDAEIVVKNNGGNCP------PCHEVC-----KGRCWGPGPEDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSG-----------PQDTDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKYQYGGVCVASCPHNFVVDQTFCVRACPADKMEVDKNGLKMCEPC-RGLCPKACEGTG--SGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIP----ALDPEKLNVFRTVREITGYLNIQ-----SWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPAEERLDIKYNRPLGECVAEGKVCDPLCSSG-GCWGPGPGQCLSCRNYS-REG-VCVTHCNVLQGEPREFV-----HEAH--CFSCHPECQPMEGTSTCNGSGSDACAR-CAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQG-------CKGPELQDCLGQ 632          
BLAST of EGFR-5 vs. UniProt/SwissProt
Match: sp|P04412|EGFR_DROME (Epidermal growth factor receptor OS=Drosophila melanogaster OX=7227 GN=Egfr PE=1 SV=3)

HSP 1 Score: 548.51 bits (1412), Expect = 1.178e-167
Identity = 435/1431 (30.40%), Postives = 672/1431 (46.96%), Query Frame = 2
Query:  482 FFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDK-RYRHGKVCKSTQTQIDVSKNS---YESLKRNFDKNCSYIIGDVVIAHITNENI--SFLNSIEDISGYLMIFSNAVESISLIKLKVIRGEN--PLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVI---VETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIN------DCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILI--NRFSLEGDNFHN--LSKQNDGIRKQDLKKLENLEEIYGYLRI---HVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSEC--HGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKI--------YVNGSTQFFCNSTCGDRIQL--FQTSEI--ICTDHLIYSR-------FNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLV-------NQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ-DEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIP 4597
            F    S  +N++R   +  + L    +     L +++K  +  GK+C  T++++ V  N    Y +L+  +  NC+Y+ G++ +  + NEN+  SFL++I +++GY++I    V+ +   KL++IRG     L ++  K++L V Y+ M   +  P+L+ +L   V F+NN  LC+  R I W+ ++    +          E++C        CHESC        CWG     CQK +       CA   CY           K  ECCH  C GGCTGP +  C+ACKNF +  +  E CPP  K++   Y+   NP GK A+   CV +CP     ++G CV  C  +K     + CVPC NG CPK C          ++ +H   +    NCTV DGNI I    FS   D + N  +  +   +  +  +    ++EI GYL I   H  F      +L + +NL  I    +       + IV + +L  L +RNLK++ +G+++I  N  LC+ + +   +I  +   +     N + + C K    C  +C +  GCWG     C+ CK+F    + TC++ C    GY  N+      NR+C  CH EC     TC+G+  + C   C + + G+ C+ +CP   Y D    C  CH  C          C GP+D++G   C+ CN  I++++            + +CL   D CP G++           V+   Q ++K L               +VC  CHP C  C  +G     CS C +++   +C  +CP +++    +                 GC G    DC  C++ K+        YVN ST F C S C   ++   +Q + I   C      S         NM   I G   +    +  +V +I   K + KK   K+        +     PS+ G       N+  L ++ +++L +  ++G GAFG VYKG+W P                    +  ++K+ VA+K L   +   ++ E L EA +MAS +H   L++LAVC+++   LITQ MPLG LL++V+ NR  I S  LL W+ QIA GM YLE K ++H DLAARNVL+Q+P  VKITDFGLAK+L     +Y+  GG+MPIKWLA+ECIRNR+F+SKSDVW++GVT+WE+ ++G++P  +I A DI + +E G +L QP+ICS+D Y  L+ CW +D   RP+F +L   F   + +P RYL +  D+ +  P Y   +E         + L+      +    A  KP          D Y + +A               G  H T+ T+ +   L    K+ SN+  ST  D  DS                 RE  +    L+  + ED YL+P
Sbjct:   56 FLYRSSSAQNRQRGGANFALGLGANGVTIPTSLEDKNKNEFVKGKICIGTKSRLSVPSNKEHHYRNLRDRY-TNCTYVDGNLKLTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMY-TLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSNGTDAYYNYDFTAPERECP------KCHESCTHG-----CWGEGPKNCQKFSKLTCSPQCAGGRCYGP---------KPRECCHLFCAGGCTGPTQKDCIACKNFFDEAVSKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGE-CVPC-NGPCPKTCPG--------VTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERREVFSTVKEITGYLNIEGTHPQFR-----NLSYFRNLETIHGRQLMESMFAALAIVKS-SLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNED-GCWGAGTDQCLTCKNFNF--NGTCIADC----GYISNAYKFD--NRTCKICHPEC----RTCNGAGADHCQ-ECVHVRDGQHCVSECPKNKYNDR-GVCRECHATC--------DGCTGPKDTIGIGACTTCNLAIINNDA----------TVKRCLLKDDKCPDGYFWEY--------VHPQEQGSLKPLAG------------RAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQ------RECFQRHPECNGCTGPGADDCKSCRNFKLFDANETGPYVN-STMFNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGA------NLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVP--------------------EGENVKIPVAIKELLKSTGAESSEEFLREAYIMASEEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTRLPAYTSQDE---------KDLIRKLAPTTDGSEAIAKP----------DDYLQPKA-------------APGPSHRTDCTD-EMPKLNRYCKDPSNKNSSTGDDERDSSA---------------REVGVGNLRLDLPVDEDDYLMP 1313          
BLAST of EGFR-5 vs. UniProt/SwissProt
Match: sp|P0CY46|EGFR_APIME (Epidermal growth factor receptor OS=Apis mellifera OX=7460 GN=Egfr PE=2 SV=1)

HSP 1 Score: 528.48 bits (1360), Expect = 1.830e-161
Identity = 365/1099 (33.21%), Postives = 554/1099 (50.41%), Query Frame = 2
Query:  965 NNPKLCYASRKINWNSLMRRSQE----VVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXX--XXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEG-----DNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRI---HVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLT----NKSILHKGRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHG-GSSWH-CSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVN-----GSTQFFCNSTCGDRI--QLFQT-SEIIC---TDHLIYSRFNMYIYIGGPA---GXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDE 4147
            NN  LC+  R INW  ++         V    + E+ C        C +SC+       CWG     CQK    +   C  S +C+             H  C GGCTGP +S C+ACKNF ++G+C + CPP  K++   Y    NP GK A+   CV +CP+    ++G CV  C  +K  A+N  CVPC +G CPK C+         +  VH   +   ++CT+ +G+I I   S +G      NF +  K+ + +    L+    L+EI G+L I   H  F +     L + +NL +I    +  + +  + +V   +L   GL +LK++ +G+I I  N  LC++ ++      KS  H+   L + N     C K    C  +C    GCWGP    C+ CK+F++     CL  C+  PG +          ++C  CH EC     +C G N + C   CK+ + G  C+ +CPA  Y D+   C  CH NC          C GPE+++G  GC  C+  I++ +               CL+  + CP G+Y   +                      +E G    L   +VC  CH  C +C G G   H C  C  ++   +C  +CP +YF   N+   P     +          G     C +C++ KIY++      +T F C  TC      ++F   SE  C   T  LI +     I  G        ++    I+  + + +K +E   K  +   G    ++    +GV PN+A L +I E ++ +  I+G GAFG VYKG+W P                    +  ++K+ VA+K+L D +  + ++E L+EA +MASV+HP  L++LAVC+T+   L+TQ MPLG LL+FV+R +  I S  LL W  QIA GM YLE + ++H DLAARNVL+Q+P  VKITDFGLAK+LD +++QY+  GG+MPIKWLA+ECI++R+F+ KSDVW++GVT+WE+ +YG +P+ ++ A ++ E LEKG+RL QP IC+ID Y I+++CW++D ++RPSF EL + F  MS +P RYL ++ +
Sbjct:    3 NNYNLCHI-RTINWEEIITGPSAMYSYVYNFTSPERAC------TPCDKSCEQG-----CWGEGPENCQKY---SKTNC--SPQCWQGRCFGPNPRECCHLFCAGGCTGPKQSDCIACKNFFDDGVCTQECPPMQKYNPTTYSWEPNPDGKYAYGATCVRRCPEHLLKDNGACVRSCPPKKK-ALNGECVPC-DGPCPKTCKG--------VEKVHSGNIDSFKDCTIIEGSITILDQSFQGFQHVYRNF-SFGKRYEKMHPDKLEVFSTLKEITGFLNIQGDHKDFKN-----LSYFRNLEVIGGRTLTEYFA-SLYVVKT-SLVSFGLSSLKKIYSGSIAILENKNLCYAQSINWTRIKKSSEHES--LLSNNRNESECIKDGLVCDEQCSDE-GCWGPGPAQCLSCKNFIL--GNDCLQDCT-APGIYQADE------KTCKVCHEEC---DGSCIGPNTDHCK-KCKHARDGPFCVPECPASKYNDN-GVCKSCHGNCV-------GGCEGPENNIGPNGCHSCDKAILNDHVPE-----------GCLQKKESCPDGYYYEWVSP--------------------LEQGPLKPLASKAVCRKCHSRCKKCTGYGFHEHVCQECTKYKRGEQCEDECPADYFADANKLCIPCFSECRGC-------FGPGPNQCYKCRNYKIYIDEDTDGNTTSFNCTETCTPEYPHKIFNPDSEPYCSLETAGLIENELQPAILAGVAVFALAFLVVAAIIMYFWRVRAKAKENTVKMTMALTG-LDDNEPLRPTGVKPNLAKLRIIKEEEMRKGGILGYGAFGNVYKGVWVP--------------------EGENVKIPVAIKVLHDGTGANTSKEFLDEAYIMASVEHPNLLQLLAVCMTSQMMLVTQLMPLGCLLDFVRRFKDKIGSKALLNWCTQIARGMAYLEERRLVHRDLAARNVLVQTPNCVKITDFGLAKLLDINEEQYKAAGGKMPIKWLALECIQHRVFTHKSDVWAFGVTIWEVLTYGGRPYENVPARNVPELLEKGERLPQPAICTIDVYMIMIKCWMLDAESRPSFKELAEDFAKMSRDPGRYLAIKGD 983          
BLAST of EGFR-5 vs. UniProt/SwissProt
Match: sp|P24348|LET23_CAEEL (Receptor tyrosine-protein kinase let-23 OS=Caenorhabditis elegans OX=6239 GN=let-23 PE=1 SV=3)

HSP 1 Score: 390.193 bits (1001), Expect = 9.804e-112
Identity = 339/1199 (28.27%), Postives = 552/1199 (46.04%), Query Frame = 2
Query:  737 ENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVET--NEKDCGLNNEELS-CHESCQAHLNKTYCWGNSSSACQKI-NDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPE--FKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQT---CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSR-GIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSIL-HKGRFLRALNGKIENCSKKKCHSE-------CEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCK-----NYKFGE--SCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSS---WHCSLCKYFR-----SDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRF--NMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFK-TKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQ--EIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHP-KLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            ++I+F +++E+I G L+I+   ++ IS  +L+VI G+          +L +  N  +  ++   L+VI   +V   +NPK+CY   KI+W  L+    +V  VET  + + C  N + ++ CHESC        CWG+  + CQ++      ++C   ++C+ +    S ECC   C+GGCTG     C+AC  +  +GIC+E CP    F H   + + NP G+      CV +CP +   E+  CV  CS    Y   +    C  C +  CPKIC            ++  + L  LE C   DG+++I                      + LK LE ++ +  Y+ I      N+ D L+FLKNL+II  E  + H  R  + I     L+ L L +LK ++ G ++I  N++LC+ + +   SI+  KG+  +      EN   K C +E       C +R GCWG E   C++CK++  +   TC+ KC  + G+  N +S       C +C  EC     TC+G  E +C L C+     N  FG    C+  CP  ++      C  CH  C +N       C GP+ +LG  GC  C + +   N +     SS  N + C++N D+    +Y S  D             T  ++E              + C  C   C  C         +  +CK+       S+  C+ +CP   F+ V +T     +      + +  C    +  C +CK+  ++     Q  C S C   +     +   C D+ I SR      + IG            I+      +   KK K  ++V+  +  P D    + V PNM+ + LI  S+L  +  + +G+GAFG V+ GI+ P                    +  ++K+ VA+K+    +D S   E+LEEA  M  + H   L+I+  C+     K++T + PLG+L  F++ ++  + +   +++  QIASGM+YLE + ++H DLA RNVL++    V+ITDFGL+K+L +       K G++ IKWLA+E      ++  SDVW++GVT WE+ ++G+ P+  +    I   L+ G RL+QP  CS D Y  L++CW+ DP +RP F  L + F+     P  +L   ++ S   L  E     ++  E    
Sbjct:  104 KSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVFHDN----ALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELL-YDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK-----CWGSGDNDCQRVYRSVCPKSC---SQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVD--------GHLTNETLKNLEGCEQIDGHLIIEH----------------AFTYEQLKVLETVKIVSEYITI---VQQNFYD-LKFLKNLQII--EGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKR-GCWGKEPEDCLECKTW--KSVGTCVEKCDTK-GFLRNQTS-----MKCERCSPEC----ETCNGLGELDC-LTCRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG------CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNV-CVEN-DL--PNYYISTYD-------------TEGVIE--------------THCEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFM-VPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDIAQ--CVSECPKNLPFSNPANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPID----ASVRPNMSRICLIPSSELQTKLDKKLGAGAFGTVFAGIYYP-------------------KRAKNVKIPVAIKVFQ--TDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDG 1180          
BLAST of EGFR-5 vs. UniProt/SwissProt
Match: sp|Q15303|ERBB4_HUMAN (Receptor tyrosine-protein kinase erbB-4 OS=Homo sapiens OX=9606 GN=ERBB4 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 3.139e-94
Identity = 190/497 (38.23%), Postives = 280/497 (56.34%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFIT---VNETAKPXXXXXXXXXXXXXXXLGSTNYDCLR---CKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             S+C+ C P C +       CHG    +C+ C +F+    C++KCP         + + A P+ EC  CH  C++GC G T++DC+      H+ +  +  T        G    L     I+     +Y R                         +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +++GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS+DHP  +R+L VCL+   +L+TQ MP G LLE+V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++L+  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  549 GSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILV----IVGLTFAVYVR----------------------RKSIKKKRALRRFLETELV--------EPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 991          

HSP 2 Score: 209.149 bits (531), Expect = 4.267e-53
Identity = 177/648 (27.31%), Postives = 284/648 (43.83%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRS--QEVVIVETN-EKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANR---TCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHK--GRFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLP---GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP 2446
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  N ++SFL S+ +++GY+++  N    + L  L++IRG   L       ++ + Y    N  L+ +   NL  IL   V+ + N  LCYA   I+W  ++R      + +V TN    CG       CH+SC        CWG + + CQ +    CA +    CY     Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    N   K  +   CV KCP  F  +  +CV  C + K        + C PC +  CPK C             V    + +  NCT  +GN++     + GD ++ +    + I  + L     + EI G+L I   +  N TD      NL  I    + S  S  + I+    +  L  ++LKE+  GNI I  N+ LC+ +T+   ++      R +   N K ENC+ +   C+  C    GCWGP    C+ C+ F     + C+  C+   G F     + E    C +C  +C     G+ TCHG   + C   C ++K G +C++KCP            Y D  + C+PCH NCT+        C+GP
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYYE-NCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTK-LYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYAD-TIHWQDIVRNPWPSNLTLVSTNGSSGCG------RCHKSCTGR-----CWGPTENHCQTLTRTVCAEQCDGRCYGP---YVSDCCHRECAGGCSG------PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTD-ICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAI----EAIDPEKLNVFRTVREITGFLNIQS-WPPNMTD-FSVFSNLVTIGGRVLYSGLS--LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSD-GCWGPGPDQCLSCRRF--SRGRICIESCNLYDGEF----REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG-------CNGP 628          
BLAST of EGFR-5 vs. UniProt/SwissProt
Match: sp|P00535|ERBB_AVIER (Tyrosine-protein kinase transforming protein erbB OS=Avian erythroblastosis virus (strain ES4) OX=79685 GN=V-ERBB PE=3 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.928e-92
Identity = 149/334 (44.61%), Postives = 223/334 (66.77%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQ 4213
            T SG  PN A L ++ E++  + +++GSGAFG +YKG+W P                    +   +K+ VA+K L + + P  N+EIL+EA VMASVD+P   R+L +CLT+  +LITQ MP G LL++++ ++  I S  LL W  QIA GM YLE + ++H DLAARNVL+++P+ VKITDFGLAK+L   +++Y  +GG++PIKW+A+E I +RI++ +SDVWSYGVT+WE+ ++G KP+  I A +I   LEKG+RL QP IC+ID Y I+V+CW++D D+RP F EL   F  M+ +P RYL++Q    +E +++    D++ Y   ++
Sbjct:  113 TPSGEAPNQAHLRILKETEFKKVKVLGSGAFGTIYKGLWIP--------------------EGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPYGCLLDYIREHKDNIGSQYLLNWCVQIAKGMNYLEERRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGADEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIAEFSKMARDPPRYLVIQ---GDERMHLPSPTDSKFYRTLME 423          
BLAST of EGFR-5 vs. TrEMBL
Match: A0A1B1ACY9 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2825.42 bits (7323), Expect = 0.000e+0
Identity = 1448/1454 (99.59%), Postives = 1450/1454 (99.72%), Query Frame = 2
Query:  347 MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLN---NEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 4699
            MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLN   +EELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCS+CHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITV ETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVISFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE
Sbjct:    1 MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVTETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVISFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 1454          
BLAST of EGFR-5 vs. TrEMBL
Match: L0H9P9 (EGFR-5 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 513/514 (99.81%), Postives = 514/514 (100.00%), Query Frame = 2
Query: 2924 CLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWS 4465
            CLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVISFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISK+SQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWS
Sbjct:    1 CLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVISFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKLSQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWS 514          
BLAST of EGFR-5 vs. TrEMBL
Match: A0A1B1ACY8 (Epidermal growth factor receptor Smed-egfr-6 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 486/1204 (40.37%), Postives = 707/1204 (58.72%), Query Frame = 2
Query:  590 DKRYRHGKVCKSTQTQIDV--SKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN----SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNE--ELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKN--CYPCHTNCT-ENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQ-----STMK-ILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGS-TQFFCNSTCGDRIQLFQTSEIICT--DHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 4141
            D    H   C S     D+    N+Y  +  N +KNC+++IG+V+I  ITNEN+SFLNSIE+I+G+L +FSN+VESISL  LK+IRGENP + + +KFSL+V  N    +ML+ ++ P  QVIL+HN+   NNP + Y    I+WNS++ + Q + IVE +      + E  +LSCH SCQ H+ K +CWGNSS  CQ INDC  +TC  S+KC++   LK E+CCHEECVGGC GP  +QCL CK+FNN G CVE CP +  H+G+K+I+N L K  F+  CVDKCP K+F E+  CV +C    TYAVN+TC+PCPNG CPK C  +D++ +  I Y++RK+L RLENCTVY GNI+IN  S+EGD  +   K   GI+ +DL+KL NL+EIYG L I+V   + W  +L + +NL IIRAE   +    G+ I  N  L +LGL+ LKEVRNG + I +N +LC++++LTNKSILH  +     NGK   C  +KC   C  + GCWGP    CVKC+ F I E   C+S CS +PGYFYN  +       CSKCH++CL    TC+G   ++C  GC NYK+ + C +KCP  +Y D   +  C  CH +CT EN  + + TC GP + +G  GC  CN++ + +N S  + +    + L C+ +S+ C  G++K  +DF S   + + ++     S++K +LE WI+   NH+    ++CLPCHP CS+C  G+   C  CK  R   +C+  C ++ +I+ N ++  ES C KCHEEC EGC GST YDC +CK  KIY+N S T+FFCNS CGD  ++F  SE++C     L   + + YI   G + + +  V I+   I  S N+ K++  KL     F   D    S   P+   LL I E Q   + I+  G F I+ KG W    +  +   S  K  + KI  D  + LNV +K+L++ SD ++N++ L++ K++ S D P  LRI+ V + A+ +L  Q    GSL+EF+++N S++  I++L+WA Q+ASG  Y++ +GII+ D+   N+ I+SP ++ I+D GL+K+ +   +  + K G++ I W   E   ++ FSSKS V +Y                                                     D D RP+  +L+++ EM+  NP  ++++Q
Sbjct:   64 DSHSDHQNTCISKLVYEDIRDKPNNYMKVTANLNKNCTHVIGNVIITGITNENLSFLNSIEEITGFLFLFSNSVESISLKNLKIIRGENPWIYREVKFSLVVVSNIIGENMLKYLILPKFQVILQHNILVYNNPGMLYFKNNIHWNSILGKHQFLEIVEPHNSSNFTSKEIGDLSCHSSCQPHMGKRFCWGNSSGQCQIINDCVRKTCKLSSKCFLYGELKIEQCCHEECVGGCYGPLNTQCLICKHFNNQGACVEKCPRKLVHNGVKHIKNRLEKFTFHNTCVDKCPDKYFIENEKCVPKCKNGATYAVNETCLPCPNGVCPKDCLIKDVVQNYNIQYLNRKMLARLENCTVYHGNIIINTLSIEGDIGNGWPKNIYGIQGKDLEKLTNLKEIYGSLEINVGSKAPWLKTLLYFRNLEIIRAETTNNKHLTGLSINQNDDLVFLGLQELKEVRNGIVEIVNNPKLCYTDSLTNKSILHSNQMNIYNNGKDGKCEARKCSKLCHPKYGCWGPLGMFCVKCRHFQITEKNMCISNCSKQPGYFYNKENHQTHEMQCSKCHNQCLSSNITCYGPGADQCTFGCVNYKYNDYCTEKCPQDHYGDGSTSNICKACHQSCTKENLFSFKRTCTGPGNHIGVNGCRKCNYVQLLTNGSEGFISRFTVHSLTCIHSSNNCLDGYFKISLDFHSPENIMSLLKLYSNNSSLKMVLENWIDRQANHEYQFGAICLPCHPLCSQCSDGTIESCHRCKSHRRGKECVHNCYEDDYISKN-SSNAESLCLKCHEECMEGCTGSTEYDCKQCKRVKIYLNSSKTKFFCNSICGDNFRIFVNSEMVCVQPQELKPIQNSWYIAAVGGSVVSVLAVGIVWKCICMSLNKRKRYDLKLKFPNGFSTVD--IESDFAPSSTKLLPIAEGQPANEHILDLGKFCIMDKGTWTQKSNNTNCKKSCFKECLFKIIPDELVGLNVTIKVLSECSDLADNKDFLQKLKIITSTDPPWNLRIILVVVCAYSELSKQLTTTGSLIEFLKQNPSVVEDISILLWAHQVASGFGYIKYEGIINYDVETSNIKIESPLRIAISDSGLSKLSNTCNRMKKIKEGKLGIIWSLKENCNDQGFSSKSSVMTYNCN-------------------------------------------------SDHDTRPNLRKLKQSIEMIMKNPCSFIILQ 1215          
BLAST of EGFR-5 vs. TrEMBL
Match: A0A059PB47 (Receptor protein-tyrosine kinase OS=Crassostrea gigas OX=29159 GN=EGFR PE=2 SV=1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 444/1304 (34.05%), Postives = 660/1304 (50.61%), Query Frame = 2
Query:  545 LYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNS----YESLKRNFDKNCSYIIGDVVIAHITNEN----ISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSM----LENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTY-CWGNSSSACQK-INDCANRTCYDSTKCY---INEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPP--EFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGN--CVTQCSAEKTYAVNQTCVPCPNGKCPKIC---RARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCF------SNTLTNKSILHKGRFLRAL-----NGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVI-RESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKF-----GESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKN--SDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGST----------------QFFCNSTCG--------DRIQLFQTSEIICTDHL---IYSRFN-------------MYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKK--FKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQD-------EDSNEPLYVE 4174
            +    +K T   +  +  Y   +VC+ +   +  S       Y  LK+ + +NC+Y+ G++ I  +   N    +SFL+ IE++SGY++I S   E+I L  LK+IRG      K   +SL VG N+     L+ +L  NL  I R +V+F NN  LCY    I W  +    +  V   +       +     C   C  +  K Y CWG+  + CQK I +  +++C   T C+   I+E   S+             P  S C+ACKNF N G CV  CP   ++  + M    NP GK AF  +C+ KCP     +  N  CV +C  E  Y VN TCVPC +G CPK C   +  D L S+ I         + ENCTV DGN+ I + + +GDN+ +L    +G++++ L   + ++EI GYL +    N   +D L FL NL+II    +    +     + N  L  L L +L+ ++NG I +F N +LCF      +  LT +    +G  ++       N   E+C +    CH  C    GCWG     C+ C+SF I   S  C+  C+  P   YN+      N+ C  C  ECL   ++C+G     C L CK+          +C+ +CP  ++ +    C PC   C E        C GP D +G  GC+ C+  I +              I +CL +  ++ CP  +Y + I          + ++++ +L   I +G+       S C  C   C  C  GS+ HC  CKY + D+ C   C    +   N+  +      +CHEEC  GC G +   C  C + K+Y++ ++                QF C  TC         D +   +T+  +C D     + +R               +   IGG   +  + V    C+   +K QEK      K+    D  P    T +   P+M+++ LI +S+L R  IIGSGAFG VYKG W P                    QD ++K+ VA+K+L+D + P  N+E+LEEA+VMASV++PCC+RILAVC+TA   LITQ MPLG LL++V++++  I S  LL W  QIA GM YLE +GI+H DLAARNVL+QSP Q+KITDFGLAK+LD ++ +Y   GG+MPIKWLA+ECI+ RIF+ KSDVWS+GVT+WE+F+YG++P+ +++A D+ + LEKG+RL QP IC+ID Y I+++CW++D D+RPSF EL + F  M+ +P RYL++         ++SN P  +E
Sbjct:   12 VLLTGLKLTISEFAGNANYEEPEVCRGSSEGVSTSGADDLARYTKLKKRY-QNCTYVDGNLEIKFLEQGNETFDLSFLSKIEEVSGYVLITSVVAETIPLTSLKIIRGNQLFNYKNHSYSLFVGVNNQETRGLKELLLTNLSEITRGDVYFVNNDWLCYHD-TILWKDIKFNPEYKVRFTSTNSSKTASQLCPPCAPECFKNETKNYHCWGSGPNKCQKLIREICHKSC--ETGCFGYAISECCHSQCAGGCTG------PRSSDCVACKNFYNEGTCVSECPKPRKYNRNTMVSEDNPYGKYAFKSLCLKKCPDYMLVDEQNALCVRKC-PENYYPVNNTCVPC-DGACPKWCSGIKQDDFLSSRNID--------QFENCTVIDGNLKIVQTTFDGDNYTHL----EGLKREQLNVFKTVKEITGYLMVQ-GGNQAMSD-LSFLSNLQIIHGRELDIALNAFSAFMTN--LNSLELISLRSIKNGKISLFGNKELCFIEGTDFTQLLTVQKNQDQGFKIKDYVQSRDNRPPEDCKRDGDVCHQSCSDE-GCWGKGANKCLNCRSFKIDNSSNICIEDCTRAP-MLYNAG-----NKLCKFCDEECL---DSCYGEGPGNCTL-CKHVTIRGKDNSTTCLNQCPEMFFANENNICLPCSDKCAEG-------CTGPLDIVGIGGCNTCDLAIETKYERNK-------TIFRCLSDGTANRCPYNYYVTYI----------SKETSIHLLGSEILMGS-------SACFHCDEMCDGCFQGSNVHCIKCKYVKQDSACRLSCLNMLYPDENKECQ------QCHEECRGGCYGPSETQCNACNNFKVYLDKASWTDNHNNCTDPGVSCRQFNCTKTCPSDMTYTIKDPLSDGETT-TLCVDESHPEVAARLAQQEDDNKKKTSIILGSVIGGVVLLAAALVLFGYCWCQRAKAQEKTAILTAKMTGYEDEQPL---TPTNAKPDMSSIRLIKQSELRRGGIIGSGAFGTVYKGFWIP--------------------QDENVKIPVAIKVLSDSTSPCQNKELLEEARVMASVENPCCIRILAVCMTAQMMLITQLMPLGCLLDYVRKHKDNIGSKVLLNWCTQIAKGMAYLEERGIVHRDLAARNVLVQSPGQIKITDFGLAKLLDINEDEYHAAGGKMPIKWLALECIQQRIFTHKSDVWSFGVTVWELFTYGQRPYENVRARDVPDLLEKGERLPQPSICTIDVYMIMIKCWMLDADSRPSFFELTEEFAKMARDPGRYLVISGDVLKKIPDESNTPSAIE 1215          
BLAST of EGFR-5 vs. TrEMBL
Match: A0A1S3HC10 (Receptor protein-tyrosine kinase OS=Lingula unguis OX=7574 GN=LOC106153603 PE=3 SV=1)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 425/1238 (34.33%), Postives = 627/1238 (50.65%), Query Frame = 2
Query:  578 LYNQDKRYRHGKVCKSTQTQIDVSKNSYE--SLKRNFDKNCSYIIGDVVIAHITNE------NISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSM--------LENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLM---RRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCA---NRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHD--GMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIE-NCSK--KKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVD-SMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSD----ICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFR----SDNKCIQKCPKEYFITVNE-TAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAK----IYVNGSTQFFCNSTCGDRI---QLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEK----KFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDE 4147
            L N    +  G+ C  T+ ++ +  ++    +L R    NC+Y+ G++ I  + N       ++SFL  I +++GY++I S     + L  L+VIRG+         +SL V  NS         L+ + F NL  I+  +V+F+ NP LCY +  + WN  +     SQ  V  +   + CG      SCH SC+ H     CWG   + CQ+I  CA   + +CY S            ECCH +C GGCTGP    C AC++F ++G CV  CP    +D     ++ NP  K  +  +CV +CP     +   CV +C  E   A N+ C PC  G CPK C      +    +Y+  + +     CT+ +GN+ I   +++GD F+N+      +    L+ L  + E+  Y+ I    NS    SL FL+NL II    +  H    +++     + YLG  +LK V  G I I  N+ LC+  T+  +++            KIE  C +  + C +EC  R GCWGP    CVKC +   R    CL+ C    G +         N +C  CH EC     TC G    +C+  CKNYK G  C+K+CP   Y D + K C  CH NC      +ES C GP + +G  GCS C   I               N+ +CL  SD     CP G+Y        G +V +              + T + L     C  C+P C  C G     C+ C +F+    S + C+  C +  +   N+ T KP +   +          G  +  C  C + K    I VNG   F C+S C   +   +     E+  T  +I         I G + +      I++ F+   + + K    K  +K++  GD  P    T +  +P+++ L LI E ++ +  IIGSGAFG VYKG+W P+                      ++K+ VA+K+L + + P++NRE+LEEA+VM SV+H CC+RILAVC+TA   LITQ MPLG LL++V++N+  I S  LL W  QIA GM YLE +GI+H DLAARNVL+QSP  VKITDFGLAK+LDY++ +Y   GG+MPIKWLA+ECI++RIF+ K+DVWSYGVT+WE+ +YG +P+ +++A DI + LEKG+RL QP I +ID Y I+++CW++D ++RPSF EL + F  M+ +P RYL++  +
Sbjct:   25 LLNIGNVFVEGRTCIGTKYELSMQGDAIYRYNLYRERYMNCTYVQGNLEITFLDNPQLDHPYDLSFLKHIREVTGYVLIVSVFANYVPLENLRVIRGKTLYYQNNRGYSLYVALNSKPSNSDMFGLKELRFVNLHEIMAGDVYFSKNPLLCYENTVV-WNGKIVTGEGSQVFVDDDAKGRSCG------SCHRSCEGH-----CWGAGPNMCQRIIKCAPQCDGSCYGS---------GPVECCHYQCAGGCTGPTNKNCTACRHFLDDGACVPYCPQRQIYDEKTFTFVDNPKFKYTYGSLCVKECPDHLLMDQSGCVKKC-PEGKVANNRKCEPC-KGPCPKSC------NGTGDTYITSQNINSFNGCTIIEGNLKILSPTIDGDMFNNIPP----MSPSQLEALSQVREVTHYVLIQS--NSPNLTSLAFLRNLEIIHGREL--HTGSALDVYSQ-TVTYLGFSSLKRVNGGEIRITHNSALCYWYTIKWETLTGPKSLHFVEQNKIEAECEREGRVCSAEC--RDGCWGPGDDKCVKCAN--KRLGNKCLATCDPSLGIYTKDD-----NVTCDYCHPEC---ARTCTGPEAKDCD-SCKNYKNGPYCVKECPESMYGDNTTKECKKCHENCL--LLQEESGCSGPGNFVGPGGCSKCKMFIYDKRTK---------NVTECLPTSDKGQPQCPAGYY--------GHRVTSHEH-----------LNTAYGLQGMQSCELCNPLCKTCFGALPTECNECTFFKDISMSVHFCVVSCTERNYEDHNDKTCKPCNSECRKGCT------GPNSTQCNFCSNVKVPLGITVNGVDMFNCSSECPSHLPHKRREAGDEVCSTPPVIGLATGQIAGIAGGSVVFGLICIILLAFLCYKRQKAKETTIKLTSKMIGYGDDEPL---TPTDAVPDLSKLRLIKECEIRKGGIIGSGAFGTVYKGVWIPD--------------------GENVKIPVAIKVLQEGTSPNHNRELLEEARVMCSVEHQCCVRILAVCMTAQMMLITQLMPLGCLLDYVRKNKQNIGSKVLLNWCAQIAKGMSYLEERGIVHRDLAARNVLVQSPSYVKITDFGLAKLLDYNEAEYHAAGGKMPIKWLALECIQHRIFTHKTDVWSYGVTVWELLTYGLRPYENVRARDIPDLLEKGERLPQPSIATIDVYMIMIKCWMLDAESRPSFKELHEEFSKMARDPGRYLVIHGD 1152          
BLAST of EGFR-5 vs. Ensembl Cavefish
Match: ENSAMXT00000016431.2 (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103032492])

HSP 1 Score: 326.25 bits (835), Expect = 5.490e-93
Identity = 152/335 (45.37%), Postives = 221/335 (65.97%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            T SG  PN A L ++ E++  + +++GSGAFG VYKG+W P                    +   +K+ VA+K+L +++ P  N+EIL+EA VMASVDHP   R+L +CLT+  +LITQ MP G LL++++ N+  I S  LL W  QIA GM YLE   ++H DLAARNVL+++P  VKITDFGLAK+L+ ++++Y   GG++PIKW+A+E I +  ++ +SDVWSYGVT+WE+ ++G KP+  I A +I   LEKG+RL QP IC+ID Y I+V+CW++DPD+RP F EL   F  M+ +P RYL++Q    +E L++    D + Y     +
Sbjct:  637 TPSGAAPNQALLRILKETEFKKVKVLGSGAFGTVYKGLWIP--------------------EGEDVKIPVAIKVLREVTSPKANKEILDEAYVMASVDHPHICRLLGICLTSTVQLITQLMPFGCLLDYIRENQDNIGSQNLLNWCVQIAKGMNYLEEHRLVHRDLAARNVLVKTPNHVKITDFGLAKLLNANEKEYHSDGGKVPIKWMALESILHWTYTHQSDVWSYGVTVWELMTFGAKPYDGIPAQEISGLLEKGERLPQPSICTIDVYMIMVKCWMIDPDSRPRFRELSSEFTKMARDPTRYLVIQ---GDEQLHLSGSTDRRVYRSMFSS 948          

HSP 2 Score: 184.111 bits (466), Expect = 1.379e-46
Identity = 170/633 (26.86%), Postives = 284/633 (44.87%), Query Frame = 2
Query:  614 VCKSTQTQIDV---SKNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIV--GYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQ--KINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDG--MKYIQNPLGKLAFYYICVDKCPKKFF-NEHGNCVTQCSAEKTYAVNQT----CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG-RFLRALNGKIENCSK-----KKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQ 2419
            VC+ T  ++++   + + Y +L + +  NC+ ++ ++ I H+  N ++SFL SIE++ GY++I  N V  I L  L++IRG +  L +G KF+L V   Y++   +    ++   LR     N   K C                        +K C   +      E+CQ  L +  C    S  C+   I DC N  C  +  C                    TGP  + CLAC+ F ++G+C + CP    +D    + + NP GK +F   CV  CP  +   +HG CV  C  +KT+ V +     C  C NG CPK+C      +   I  V+   +   +NCT  +G+I I   +L GD +    K    +    L   + ++EI G+L I   +  N T SL   +NL +IR    + H       +    ++YLGLR+LKE+ +G+++I +N +LC++N    + +     + ++  +   ++C+      + C   C +  GCWGP    C  C+   +     C+  C+   G       ++  N  C +C  EC     T +G+  ++C + C ++K G +C+ +C              +VD  + C PCH NCT  SQ
Sbjct:   26 VCQGTSNKLNLLSQADDHYRALMKMY-SNCTVVLENLEITHVGENYDLSFLRSIEEVGGYVLIAINDVNVIPLENLRLIRGHS--LYEG-KFALAVMANYHTANSSSAESSIPTGLRELPLRNLRGKPC------------------------DKSCYNGSCWAPGPENCQ-KLTRLICAEQCSHRCKGPAIADCCNEHC--AAGC--------------------TGPLATDCLACREFKDDGMCKDACPRLMLYDPNLHQLVVNPNGKFSFGATCVKNCPHNYVVTDHGACVRTC-GDKTHEVEENGIRKCKNC-NGPCPKVCNGLGNGELAGIMTVNASNIDTFQNCTKINGDISIFATTLRGDPYTKTPK----LDPAKLDYFKTVKEITGFLLIQA-WPENLT-SLSPFENLEVIRGR-TQQHGRVSFAALNIAHIEYLGLRSLKEISDGDVVIKNNPRLCYTNANYWRKLFRSDTQTIKTRDNLGDSCNSAEVQNRMCDGMCTEE-GCWGPGPSMCFSCRH--VSRQGQCVDSCNILEGM----PREYISNNMCLECDQEC----RTLNGTPTDQC-VECAHFKDGSNCVSQCANGVPGMNNRLIWTFVDKNRQCQPCHPNCTHGSQ 586          
BLAST of EGFR-5 vs. Ensembl Cavefish
Match: erbb4b (erb-b2 receptor tyrosine kinase 4b [Source:ZFIN;Acc:ZDB-GENE-030918-5])

HSP 1 Score: 329.717 bits (844), Expect = 1.118e-92
Identity = 186/491 (37.88%), Postives = 269/491 (54.79%), Query Frame = 2
Query: 2702 ASVCLPCHPYCSE-------CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKF-KTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
             SVCL C   C +       C G    HC  C +F+    C++KCP     T +   K                    N +C  C HA       TQ        D I +   + +I    +I   F + I   G A         +    +  K   ++F +T+LV        +  T SG  PN A L ++ E++L R +I+G+GAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++LD  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  498 GSVCLECDAQCQKADDDGLTCTGPGPDHCVKCLHFKDGPNCVEKCPDGLQGTNSFIFK----------------YAEANNECHPC-HAN-----CTQGCTGPRLQDCIGMIDRTPLIAAG-VIGGLFVVVIIALGVA-------VSVRRKSIKKKRALRRFLETELV--------EPLTPSGTAPNQAQLRILKETELKRVKILGAGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNEATGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFCRMARDPQRYLVIQGDD 930          

HSP 2 Score: 202.601 bits (514), Expect = 5.019e-52
Identity = 168/637 (26.37%), Postives = 281/637 (44.11%), Query Frame = 2
Query:  650 KNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMR--RSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRAL---NGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPG---YFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            +  Y +L++ ++ NC  ++G++ I  I  + ++SFL SI +++GY+++  N  + + L  L++IRG   L       ++ + Y    N  L  +   NL  IL   V+ + N  LC+A   I+W  +++  RS  +V+   +   C        CH +C        CWG   + CQ +    CA +        Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    NP  K  +   CV KCP  F  +H +CV  C + K        + C+PC +  CPK C        Q    V    + +  NCT  +GN++     ++GD +HN+    + +  + L     + EI G  R  + F+           +L +++ + + S                L L++++E+  GN+ I +N+QLC+ NT+ N + L +    +AL   N   + C  +K  C   C    GCWGP    C+ C+ F     +TC+  C+   G    F N S   E +  C K   + L    TC G   + C + C ++K G +C++KCP            Y ++   C+PCH NCT+        C GP  +D +G
Sbjct:   12 EQQYRTLRKYYE-NCEVVMGNLEITSIDRSRDLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGTR-LYEDRYALAIFLNYRRDGNFGLRQLGLKNLTEILHGGVYVDQNKFLCHAD-TIHWQDIVKNARSDHLVVPSNSSSSCQ------RCHRACNGR-----CWGPKENQCQSLTKTVCAEQCDGRCFGPYVSDCCHRECAGGCSG------PKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPRAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENKIKMCIPCTD-ICPKACDGIGTASLQTAQTVDSSNIDKFINCTKINGNLVFLITGIKGDVYHNI----EALDPEKLNVFRTVREITGKTRSILTFSGRGI-------SLLVLKQQWITS----------------LQLQSMREISAGNVYITNNSQLCYYNTI-NWTSLFRIPTQKALIRNNRDPKECIMEKMICDPLCSDG-GCWGPGPDQCLSCRFF--SRGRTCVESCNLHQGDVREFANGSVCLECDAQCQKADDDGL----TCTGPGPDHC-VKCLHFKDGPNCVEKCPDGLQGTNSFIFKYAEANNECHPCHANCTQG-------CTGPRLQDCIG 584          
BLAST of EGFR-5 vs. Ensembl Cavefish
Match: ENSAMXT00000047506.1 (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103032492])

HSP 1 Score: 326.635 bits (836), Expect = 4.078e-92
Identity = 152/335 (45.37%), Postives = 221/335 (65.97%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            T SG  PN A L ++ E++  + +++GSGAFG VYKG+W P                    +   +K+ VA+K+L +++ P  N+EIL+EA VMASVDHP   R+L +CLT+  +LITQ MP G LL++++ N+  I S  LL W  QIA GM YLE   ++H DLAARNVL+++P  VKITDFGLAK+L+ ++++Y   GG++PIKW+A+E I +  ++ +SDVWSYGVT+WE+ ++G KP+  I A +I   LEKG+RL QP IC+ID Y I+V+CW++DPD+RP F EL   F  M+ +P RYL++Q    +E L++    D + Y     +
Sbjct:  688 TPSGAAPNQALLRILKETEFKKVKVLGSGAFGTVYKGLWIP--------------------EGEDVKIPVAIKVLREVTSPKANKEILDEAYVMASVDHPHICRLLGICLTSTVQLITQLMPFGCLLDYIRENQDNIGSQNLLNWCVQIAKGMNYLEEHRLVHRDLAARNVLVKTPNHVKITDFGLAKLLNANEKEYHSDGGKVPIKWMALESILHWTYTHQSDVWSYGVTVWELMTFGAKPYDGIPAQEISGLLEKGERLPQPSICTIDVYMIMVKCWMIDPDSRPRFRELSSEFTKMARDPTRYLVIQ---GDEQLHLSGSTDRRVYRSMFSS 999          

HSP 2 Score: 213.386 bits (542), Expect = 1.397e-55
Identity = 190/672 (28.27%), Postives = 303/672 (45.09%), Query Frame = 2
Query:  614 VCKSTQTQIDV---SKNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN--------------SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCH---------ESCQAHLNKTYCWGNSSSACQ--KINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDG--MKYIQNPLGKLAFYYICVDKCPKKFF-NEHGNCVTQCSAEKTYAVNQT----CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENC--SKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSEC--LPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGC 2473
            VC+ T  ++++   + + Y +L + +  NC+ ++ ++ I H+  N ++SFL SIE++ GY++I  N V  I L  L++IRG +  L +G KF+L V  N              + L  +   NL+ ILR  V    NP+LC     I W+ ++ +     ++ +   D      + SC+         E+CQ  L +  C    S  C+   I DC N  C  +  C                    TGP  + CLAC+ F ++G+C + CP    +D    + + NP GK +F   CV  CP  +   +HG CV  C  +KT+ V +     C  C NG CPK+C      +   I  V+   +   +NCT  +G+I I   +L GD +    K    +    L   + ++EI G+L I   +  N T SL   +NL +IR    + H       +    ++YLGLR+LKE+ +G+++I +N +LC++N    + +            N   E C    + C   C +  GCWGP    C  C+  V R+ + C+  C+   G       ++  N  C +C  EC  L G  +CHG   ++C + C ++K G +C+ +C              +VD  + C PCH NCT         C GP    G K C
Sbjct:   16 VCQGTSNKLNLLSQADDHYRALMKMY-SNCTVVLENLEITHVGENYDLSFLRSIEEVGGYVLIAINDVNVIPLENLRLIRGHS--LYEG-KFALAVMANYHTANSSSAESSIPTGLRELPLRNLREILRGGVRIARNPRLCNI-ETIKWHDIVSKESTNAVITSESTDSTCKPCDKSCYNGSCWAPGPENCQ-KLTRLICAEQCSHRCKGPAIADCCNEHC--AAGC--------------------TGPLATDCLACREFKDDGMCKDACPRLMLYDPNLHQLVVNPNGKFSFGATCVKNCPHNYVVTDHGACVRTC-GDKTHEVEENGIRKCKNC-NGPCPKVCNGLGNGELAGIMTVNASNIDTFQNCTKINGDISIFATTLRGDPYTKTPK----LDPAKLDYFKTVKEITGFLLIQA-WPENLT-SLSPFENLEVIRGR-TQQHGRVSFAALNIAHIEYLGLRSLKEISDGDVVIKNNPRLCYTNANYWRKLFRSDTQTIKTRDNLAPEACEVQNRMCDGMCTEE-GCWGPGPSMCFSCR-HVSRQGQ-CVDSCNILEGM----PREYISNNMCLECDQECRTLNGTPSCHGPGADQC-VECAHFKDGSNCVSQCANGVPGMNNRLIWTFVDKNRQCQPCHPNCTHG-------CTGP----GLKSC 631          
BLAST of EGFR-5 vs. Ensembl Cavefish
Match: ENSAMXT00000002946.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:28119056:28308465:-1 gene:ENSAMXG00000002862.2 transcript:ENSAMXT00000002946.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 327.791 bits (839), Expect = 4.504e-92
Identity = 158/369 (42.82%), Postives = 237/369 (64.23%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNE---PLYVEWEEDAQKYDEFLQALVTVSH-INSSYESAATKPIDRKHIKSVRDR 4306
            T SG  PN A L ++ E++L R +I+G+GAFG VYKGIW P                    +  S+K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++LD  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D  +   P + ++ +   + D+    +    + +  S+ ++AT    R H+ S R++
Sbjct:  643 TPSGTAPNQAQLRILKETELKRVKILGTGAFGTVYKGIWVP--------------------EGESVKIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVRSPNHIKITDFGLARLLDADEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFCRMARDPQRYLVIQGDDCMKLPSPNHSKFFQSLLEEDDLGDLMDADEYLVPQSFNASATSYPSRPHLDSNRNQ 991          

HSP 2 Score: 199.519 bits (506), Expect = 4.193e-51
Identity = 180/649 (27.73%), Postives = 292/649 (44.99%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVP----CPNGKCPKICRARDILDS--QEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPG---YFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            VC  T  ++    +    Y +L R F +NC  ++G++ I  I  N N++FL SI +++GY+++  N  + + L  L++IRG    L +G +++L+             NL  IL   V+ + N  LC+A   I+W  +++  + E+++V +N            CH SC        CWG+    CQ +    CA +        Y+++          EC GGC+GP  + C AC NFN++G CV  CP  F ++   +    NP  K  +   CV KCP  F  +H +CV +          + C+P    CP GK P       +L      +S + +K L      +    ++   +FS   D +H +      +  + L     ++EI G+L I   +  N TD L    NL  I   ++ S  S  + I+    +  L  ++LKE+  GN+ I +N+QLC+ NT+    +   G  R L   N     C++++  C   C +  GCWGP    C+ C+ +     +TC+  C+   G    F N S   E +  C K   + +    TCHG   ++C   C + K G +C++KCP            Y +S   C+PCH NCT+        C GP  +D +G
Sbjct:    2 VCPGTDNKLSTLSDLDQQYHTL-RKFYENCEVVMGNLEITSIERNRNLNFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK--LYEG-RYALLG----------LKNLTEILNGGVYVDQNKFLCHAD-TIHWQDILKNPRAELLVVPSNNSGSTCRR----CHRSCNGR-----CWGHQEDQCQTLTKTVCAEQCDGRCFGPYVSDCCHR------ECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPKAKYTYGAFCVKKCPHNFVVDHSSCVRENRI-------KMCIPCTDICPKGKDPSSFHCHTLLKPFLSPLSLISKKTLNSF-FLSFLSSDLFPAQFSPNRDMYHGIG----ALDPERLNVFRTVKEITGFLNIQS-WPENMTD-LGVFSNLATIGGRSLYSGIS--LLILKQRWITALQFQSLKEISAGNVYITNNSQLCYYNTVNWTGLFRTGGQRALIKSNKDPRECTQERMVCDKLCSED-GCWGPGPDQCLSCRFY--SRGRTCVRSCNLYRGDIREFANGSVCMECDSQCEKAGDKTM----TCHGPGPDQCT-KCLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQG-------CTGPRIQDCIG 589          
BLAST of EGFR-5 vs. Ensembl Cavefish
Match: ENSAMXT00000051131.1 (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103032492])

HSP 1 Score: 326.635 bits (836), Expect = 5.085e-92
Identity = 152/335 (45.37%), Postives = 221/335 (65.97%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQA 4216
            T SG  PN A L ++ E++  + +++GSGAFG VYKG+W P                    +   +K+ VA+K+L +++ P  N+EIL+EA VMASVDHP   R+L +CLT+  +LITQ MP G LL++++ N+  I S  LL W  QIA GM YLE   ++H DLAARNVL+++P  VKITDFGLAK+L+ ++++Y   GG++PIKW+A+E I +  ++ +SDVWSYGVT+WE+ ++G KP+  I A +I   LEKG+RL QP IC+ID Y I+V+CW++DPD+RP F EL   F  M+ +P RYL++Q    +E L++    D + Y     +
Sbjct:  698 TPSGAAPNQALLRILKETEFKKVKVLGSGAFGTVYKGLWIP--------------------EGEDVKIPVAIKVLREVTSPKANKEILDEAYVMASVDHPHICRLLGICLTSTVQLITQLMPFGCLLDYIRENQDNIGSQNLLNWCVQIAKGMNYLEEHRLVHRDLAARNVLVKTPNHVKITDFGLAKLLNANEKEYHSDGGKVPIKWMALESILHWTYTHQSDVWSYGVTVWELMTFGAKPYDGIPAQEISGLLEKGERLPQPSICTIDVYMIMVKCWMIDPDSRPRFRELSSEFTKMARDPTRYLVIQ---GDEQLHLSGSTDRRVYRSMFSS 1009          

HSP 2 Score: 215.312 bits (547), Expect = 3.488e-56
Identity = 191/673 (28.38%), Postives = 304/673 (45.17%), Query Frame = 2
Query:  611 KVCKSTQTQIDV---SKNSYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYN--------------SMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCH---------ESCQAHLNKTYCWGNSSSACQ--KINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDG--MKYIQNPLGKLAFYYICVDKCPKKFF-NEHGNCVTQCSAEKTYAVNQT----CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENC--SKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSEC--LPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGC 2473
            KVC+ T  ++++   + + Y +L + +  NC+ ++ ++ I H+  N ++SFL SIE++ GY++I  N V  I L  L++IRG +  L +G KF+L V  N              + L  +   NL+ ILR  V    NP+LC     I W+ ++ +     ++ +   D      + SC+         E+CQ  L +  C    S  C+   I DC N  C  +  C                    TGP  + CLAC+ F ++G+C + CP    +D    + + NP GK +F   CV  CP  +   +HG CV  C  +KT+ V +     C  C NG CPK+C      +   I  V+   +   +NCT  +G+I I   +L GD +    K    +    L   + ++EI G+L I   +  N T SL   +NL +IR    + H       +    ++YLGLR+LKE+ +G+++I +N +LC++N    + +            N   E C    + C   C +  GCWGP    C  C+  V R+ + C+  C+   G       ++  N  C +C  EC  L G  +CHG   ++C + C ++K G +C+ +C              +VD  + C PCH NCT         C GP    G K C
Sbjct:   25 KVCQGTSNKLNLLSQADDHYRALMKMY-SNCTVVLENLEITHVGENYDLSFLRSIEEVGGYVLIAINDVNVIPLENLRLIRGHS--LYEG-KFALAVMANYHTANSSSAESSIPTGLRELPLRNLREILRGGVRIARNPRLCNI-ETIKWHDIVSKESTNAVITSESTDSTCKPCDKSCYNGSCWAPGPENCQ-KLTRLICAEQCSHRCKGPAIADCCNEHC--AAGC--------------------TGPLATDCLACREFKDDGMCKDACPRLMLYDPNLHQLVVNPNGKFSFGATCVKNCPHNYVVTDHGACVRTC-GDKTHEVEENGIRKCKNC-NGPCPKVCNGLGNGELAGIMTVNASNIDTFQNCTKINGDISIFATTLRGDPYTKTPK----LDPAKLDYFKTVKEITGFLLIQA-WPENLT-SLSPFENLEVIRGR-TQQHGRVSFAALNIAHIEYLGLRSLKEISDGDVVIKNNPRLCYTNANYWRKLFRSDTQTIKTRDNLAPEACEVQNRMCDGMCTEE-GCWGPGPSMCFSCR-HVSRQGQ-CVDSCNILEGM----PREYISNNMCLECDQECRTLNGTPSCHGPGADQC-VECAHFKDGSNCVSQCANGVPGMNNRLIWTFVDKNRQCQPCHPNCTHG-------CTGP----GLKSC 641          
BLAST of EGFR-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003172.1 (pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 gene:ENSPMAG00000002842.1 transcript:ENSPMAT00000003172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 332.798 bits (852), Expect = 7.553e-97
Identity = 153/313 (48.88%), Postives = 216/313 (69.01%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L + +++GSGAFG V+KGIW P                    +   +K+ VA+K+L + + P  N+EIL+EA +MASV HP  +R+L +CLT   +L+TQ MPLG LLE+ + ++  I S  LL WA QIA GM YLE + ++H DLAARNVL+++P+ VKITDFGLA++LD ++ +Y   GG+MPIKWLA+E I+ R F+ +SDVWSYGVT+WE+ ++G KP+  I A DI E LEKG+RL QP IC+ID Y I+V+CW++D ++RP F EL   F  M+ +P RYL++Q +D
Sbjct:  555 TPSGAAPNQAQLRILKETELRKGKMLGSGAFGTVHKGIWTP--------------------EGEDVKIPVAIKVLREATSPKANKEILDEAYIMASVSHPHLVRLLGICLTPSVQLVTQLMPLGCLLEYTREHKEHIGSQLLLNWAVQIAKGMMYLEEQRLVHRDLAARNVLVRTPQHVKITDFGLARLLDINEIEYHADGGKMPIKWLALESIQYRTFTHQSDVWSYGVTIWELMTFGGKPYEGIPARDIPELLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFKELAVEFSKMARDPQRYLVIQGDD 847          

HSP 2 Score: 184.111 bits (466), Expect = 1.393e-47
Identity = 151/521 (28.98%), Postives = 230/521 (44.15%), Query Frame = 2
Query:  929 LQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQ--NPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYA---VNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRS-HKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSI-LHKGRFLRALNGKIE---NCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGIN---TCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQN 2422
            L  IL   V+   N  LCY +  ++W  +++    V I   N   C       SCH+ C  H     CWGN    CQK   C   TC        +    SE C  +   G    P  + C ACKNFN++G CV +CPP   ++ + + Q  NP  K ++  ICV +CP  F  ++ +CV  C A K        + C  C +  CPK C      +      V    +   ENCT  +GNI      ++GD++  +      +    L    +++EI G+L I   +  N TD   F +NL  IR   ++S  ++  + +   P +  LGL +L+EV  GN+ + +N +LC+ NT+   ++ + + +     + K E   N     C   C +  GCWGP    C+ C+ F  R +++C+  C    G +     +H  +  C+ C  ECLP +N   TC G   N C + C +YK G  C+  CP             Y D    C PCH NC+   + 
Sbjct:    1 LSEILHGGVYIKENKHLCYHN-TVDWWDIVKEGSIVNIDMDNSTTC------TSCHKGCHKH-----CWGNGMKYCQK---CTKLTCARQCDGRCHGPTPSECCHSQCAAGCDG-PRDTHCFACKNFNDSGSCVSHCPPPTIYNPVTFAQGENPDVKYSYGAICVKECPHNFVVDYNSCVRACPAGKHEVEKFGKKKCETCTD-VCPKACDGIGTGNLSRSQTVDATNIDTFENCTKINGNIAFLTTGIKGDDYMKIPP----LDPDKLNVFRSIKEITGHLMIQA-WPENMTDFAVF-ENLTTIRGRVLQSVGRTFSLLVARIPNITALGLASLQEVSAGNVYLKNNERLCYYNTIKWPAVFVSEQQTSYVHDNKPEADCNADGAVCDLLCSEH-GCWGPGPDQCISCRFF--RRARSCVESCYITEGPY----REHMQDAVCAPCDPECLP-VNDSVTCFGPGSNSC-VRCAHYKDGPHCVSACPVGAQGENDEIISKYPDKNNTCQPCHPNCSHGCKG 489          

HSP 3 Score: 59.3066 bits (142), Expect = 6.554e-9
Identity = 54/223 (24.22%), Postives = 89/223 (39.91%), Query Frame = 2
Query:  719 IAHITNENISFLNSIEDISGYLMIFS---NAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSAC------QKINDCANRTCYDSTKCYINEILKSXXXX------XXXXXXXXXXPARSQCLACKNFNNNGICVENCP 1342
            I  +  + ++   SI++I+G+LMI +   N  +      L  IRG   L   G  FSL+V     +  +   +LQ +   NV+  NN +LCY +  I W ++    Q+   V  N+ +   N +   C   C  H     CWG     C      ++   C   +CY +   Y   +  +                 C GP  + C+ C ++ +   CV  CP
Sbjct:  240 IPPLDPDKLNVFRSIKEITGHLMIQAWPENMTDFAVFENLTTIRGRV-LQSVGRTFSLLVARIPNITALGLASLQEVSAGNVYLKNNERLCYYN-TIKWPAVFVSEQQTSYVHDNKPEADCNADGAVCDLLCSEH----GCWGPGPDQCISCRFFRRARSCV-ESCYITEGPYREHMQDAVCAPCDPECLPVNDSVTCFGPGSNSCVRCAHYKDGPHCVSACP 455          
BLAST of EGFR-5 vs. Ensembl Sea Lamprey
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 270.396 bits (690), Expect = 3.771e-75
Identity = 131/334 (39.22%), Postives = 208/334 (62.28%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQ 4213
            T SG  PN A L ++ E++L + +++GSGAFG VYKGIW P                    +  S+K+ VAVK+L D +    N++IL+EA +MASVDHP  +R+L +C+++  +L+TQ MP G LLE+V+ +R  + S  +L W  QIA     +++  ++  DL    + +++P ++ +    L + +D ++  +      MPIKW+A+E I+ R F+ +SDVWSYGVT+WE+ ++G KP+  I A DI   LEKG+RL QP +C+ID Y I+V+CW++D ++RP F+EL   F  M+ +P+RYL++Q    +EP+ +    D++ Y  FLQ
Sbjct:  667 TPSGAQPNQAQLRILKETELKKGKVLGSGAFGTVYKGIWVP--------------------EGESVKIAVAVKVLRDSASSKANKDILDEAYLMASVDHPHLVRLLGICMSSTTQLVTQLMPHGCLLEYVREHRGRVGSQLILNWCVQIAKNASEIQALQMVCDDLVRLVMSLRTPPRITLASANLFQSIDDAKHWHDRD---MPIKWMALESIQYRKFTHQSDVWSYGVTVWELMTFGGKPYDGISARDIPGLLEKGERLPQPPVCTIDVYMIMVKCWMIDAESRPRFSELATDFSKMARDPSRYLVIQ---GDEPMALPSPTDSKFYKSFLQ 974          

HSP 2 Score: 157.147 bits (396), Expect = 6.619e-39
Identity = 171/642 (26.64%), Postives = 278/642 (43.30%), Query Frame = 2
Query:  617 CKSTQTQIDV---SKNSYESLKRNFDKNCSYIIGDVVIAHITN-ENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSM-------LENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQE----VVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVEN--CPPEFKHDGMKYIQNPLGKLAFYYICVDKCPK-KFFNEHGNCVTQCSAEKTYAVNQT----CVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGD-NFHNLSKQNDGIRKQDLKKLENLEEIYGYLRI-HVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHK---GRFLRALN--GKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECL--PGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTEN 2413
            C  T+ ++ +   ++  Y +L R+   NC  ++G++ I +I N  ++SFL +I ++SGY++I  N V+ + L  L+V+RG   L  +    ++++ YN         L+ +    L  ILR  V+    P L       +W+ +  R+ +    + +V  +     L+ +   CH SC     K +CWG+    CQ      CA +      +CY    L   +CCH+ C  GCTGP  + C    ++ +     +N  C   F     ++   P G LA     V   P   F  ++ +CV  C   KT   + +    C PCP+  CPK+C        +E   V  K +    NCT   GN++  R   +G+ +F N      GI  +  +  ++L+++ G L + H P    W   L FL +L + +    R    R   ++ + +L ++ +R    V++  +    +   CF +TL   S+      GR   A +  GK        C +E     GCWGP    C+ CK    +  KTC+  CS   G       +      C  CH+EC+   G  TCHG   + C   C+NY+ G  C+  CP             Y D    C+PCH NCT+ 
Sbjct:    1 CVGTENKMSLLGSAEKQYNTL-RSMYTNCEVVMGNLEITYIRNGSDLSFLRTIREVSGYVLIALNEVDHVPLENLRVVRGTR-LYDQRYALTVLLNYNDSVPEERLGLKELRLTRLTEILRGGVYVRKEPGL------PSWDDIRNRNSKENFFLPVVACDFSSVSLSGQ--PCHPSC-----KNFCWGSGPQYCQTFTSTICAKQC---DGRCYG---LDPNQCCHKHCASGCTGPRETDCFPASSWRSRASIQDNVLCGLFFSVTIYQFDNPPRGNLALRQALVADFPAGNFVVDYNSCVRSCPVNKTEVEDGSGVKHCKPCPDNLCPKVCDGIGSGKLKEAQTVDAKNIHFFSNCTTISGNLIFLRNGFDGNCHFQN------GIHVKP-RCCQSLQQLTGSLLLNHYPV--RW-QVLPFLLHLDLSKPS--RKQFWRLHVLLVHKSLLFMLMRYCTYVKSFQVTATVHPIFCFVSTLFGSSLYSTKSNGRHCCACDRPGKEGYVCDALCSAE-----GCWGPGPMQCLSCKFH--KRGKTCVESCSVLDG----DEREFVSGALCIACHAECMLINGSLTCHGPGPDNCTR-CRNYREGPHCVGFCPEGVPGESGELIYKYPDEDGVCHPCHYNCTQG 597          
BLAST of EGFR-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005822.1 (pep scaffold:Pmarinus_7.0:GL476959:64997:68848:-1 gene:ENSPMAG00000005273.1 transcript:ENSPMAT00000005822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.772 bits (543), Expect = 1.435e-63
Identity = 90/162 (55.56%), Postives = 126/162 (77.78%), Query Frame = 2
Query: 3665 GMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            GM YLE + ++H DLAARNVL+++P  VKITDFGLAK+LD ++ +Y  +GG++PIKWLA+E I+ RIF+ +SDVWSYGVTLWE+ ++G KP+  + A DI E LEKG+RL QP IC+ID Y I+V+CW++D ++RP F EL   F  M+ +P RYL++Q ++
Sbjct:    1 GMNYLEDRRLVHRDLAARNVLVKAPNHVKITDFGLAKLLDLNETEYHSEGGKLPIKWLALESIQQRIFTHQSDVWSYGVTLWELMTFGGKPYDGVPARDIPELLEKGERLTQPPICTIDVYMIMVKCWMIDAESRPKFRELAAEFSKMARDPTRYLVIQGDE 162          
BLAST of EGFR-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010487.1 (pep scaffold:Pmarinus_7.0:GL501102:818:30108:-1 gene:ENSPMAG00000009497.1 transcript:ENSPMAT00000010487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.32 bits (560), Expect = 1.323e-60
Identity = 190/657 (28.92%), Postives = 307/657 (46.73%), Query Frame = 2
Query:  614 VCKSTQTQID--VSKNS-YESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIV------GYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLM-RRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQ--NPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGK-CPKIC----RARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIEN--------CSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPG---YFYNSSSDHEVNRSCSKCHSECLP--GINTCHGSNENECNLGCKNYKFGESCIKKCPAKY----------YVDSMKNCYPCHTNCTENSQNKESTCHGP 2446
            VC  T+ +++  VSK   YESLK  + + C  ++G++ I H++  +++SFL  + ++ GY+++  N  E + L  L+++RG   + +   KF+L +      G  + L  +L  +L  IL   V   +NP LC+A   I W  ++ +++    ++     DC        C + C      ++CW   ++ CQK+    CA      + +CY      + +CCH+ C  GCTGP  + CLACK FN+ G+CV +CPP   ++   Y+Q  NP  K +   ICV +CP+ F  +  +C   C  EK        + C  C   + CPK+      + ++ D++ +S ++   +     CT  +GN++     L+ D   +  K         +K   ++ EI GYL I   +  N TD L   +NL I+R  N+RS     + +   P L+ LGLR L EV  G+++  +  +LC+  T+    +L   R    L G   +           + CH  C    GCWGP    C++CK F  +  +TC+  C+   G    F N +        C+ CHSECLP  G  +C G   + C   C+++K G  C+ KCP             + D+   C PCH NCT         C GP
Sbjct:   26 VCVGTEHRLELLVSKTQHYESLKILY-QGCEVVLGNLEITHLSRGDDLSFLKDVREVMGYVLVALNDFEELPLESLRIVRG---MKLYDDKFALAIVDNGQRGLGTGLRALLLRSLTEILSGGVNITDNPFLCHAD-TIKWEDILEQKNLNQSVLPYGRPDCESPASRPPCPQGC------SHCWSADTNYCQKLTRTICAKEC---TLRCYGT---NTNQCCHKHCASGCTGPRDTDCLACKTFNDTGVCVMHCPPTHIYNRDTYLQEPNPDVKYSHGAICVKRCPQNFLIDENSCARSCPHEKMEVEENGVKMCKACSEKQGCPKVVCHGIGSGNLKDAKSVSSLN---VDTFSECTTINGNLVFLESGLDSDLLAHPEK---------MKVFRSVREITGYLHIEA-WLPNMTD-LSVFENLEIVRGRNIRS-VGYSVLVRNLPHLEVLGLRALSEVTEGSVLAQNVPRLCYVLTVNWTRLLRSPRQKADLEGVPSSSVCVFACRAGSEACHPLCSSD-GCWGPGPEQCMQCKLF--KRGRTCVESCNQNDGEVREFINGT-------LCTPCHSECLPTNGTLSCKGPTSDMCTR-CRHFKDGPYCVDKCPLGQNTEHGALIFKFPDAHNACMPCHANCTHG-------CDGP 632          
BLAST of EGFR-5 vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 176.022 bits (445), Expect = 2.104e-47
Identity = 105/314 (33.44%), Postives = 170/314 (54.14%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHP-KLITQFMPLGSLLEFVQRNRS-LINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYS-QQQYQFKGG-RMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQ 4141
            T  G+  N      I  + +  Q+ +G+G FG V++G+W         +NS L                VAVK L          E + EA++M  + H   +++ AVC    P  +IT+ M  GSLL++++      + +  L+  A+QIA+GM YLES+  IH DLAARN+L+   +  K+ DFGLA+++    + +Y+ K G ++PIKW A E +    FS KSDVWS+G+ L+E+ +YG  P+ ++   ++L+ L++G R+ QP  C    Y+I+++CW    + RP+F  L+   +   S+PN Y   Q
Sbjct:  170 TTIGLSYNTVDKWEIPRASIQLQKRLGAGMFGEVWQGLW---------NNSTL----------------VAVKTLK--PGAMKKEEFIGEAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECWNKKEEERPTFETLQWRLDYFDSDPNNYTDAQ 456          
BLAST of EGFR-5 vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 97.8265 bits (242), Expect = 8.133e-21
Identity = 58/207 (28.02%), Postives = 117/207 (56.52%), Query Frame = 2
Query: 3455 SNNREILEEAKVMASVDHPCCLRILAVC-LTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKS-DVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDAR 4069
            + ++  + EA +   + HP   R+  +C ++ H  ++ +++  G LL+++ ++ SL        +A+ IAS ++YL +  I+H DL   N++I S  ++KI DFGL+ + DY +Q + F G    + + A E ++ + ++    D+WS+G+ L+ +   G+ PF D  +  + E ++KG +++ P   SI+  ++L +  +VDP  R
Sbjct:  165 ARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSL-KEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQLHTFCGS---LYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVC-GKVPFDDENSSILHEKIKKG-KVDYPSHLSIEVISLLTRMIVVDPLRR 365          
BLAST of EGFR-5 vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 93.9745 bits (232), Expect = 1.286e-19
Identity = 59/213 (27.70%), Postives = 116/213 (54.46%), Query Frame = 2
Query: 3455 SNNREILEEAKVMASVDHPCCLRILAVC-LTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKS-DVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTEL 4087
            S ++  + EA +   + HP   R+  +C L+ H  ++ +++  G LL+++ ++ S I       +A+ IAS + YL +  I+H DL   N++I    ++KI DFGL+ + D  +Q + F G    + + A E ++   ++    DVWS+GV L+ +   G+ PF D  +  + E +++G ++  P+  SI+  ++L +  +VDP  R +  ++
Sbjct:  186 SRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQHGS-IREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQLHTFCGS---LYFAAPELLKANPYTGPEVDVWSFGVVLFVLVC-GKVPFDDENSSVLHEKIKQG-KVEYPQHLSIEVISLLSKMLVVDPKRRATLKQV 392          
BLAST of EGFR-5 vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 81.2629 bits (199), Expect = 7.429e-16
Identity = 74/298 (24.83%), Postives = 131/298 (43.96%), Query Frame = 2
Query: 3287 IGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLN-----------VAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLIT---------------QFMPLGSLLEFVQR----NRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLD-YSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTEL 4087
            IGSG+FG VY G+     + +      +K N   +  D++ + N             ++ +  +S P  N+ I    K++ ++ H   L    +    H  ++T               +++P GS+   +        SLI + T     +QI  G+ YL  K IIH D+   N+LI     VKITDFG++K L   +++Q +    +  + W++ E ++    ++K+D+WS G  + EMF+ G+ PF D      +  +        P   + +    L + + +D   RPS  EL
Sbjct:  421 IGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNI--HRKMVDALQHEMNL----LKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFT-----RQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFT-GKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALEL 706          
BLAST of EGFR-5 vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 81.2629 bits (199), Expect = 9.451e-16
Identity = 67/250 (26.80%), Postives = 119/250 (47.60%), Query Frame = 2
Query: 3377 NISKISQDSSIKLNVAVKILTDIS--------DPSNNRE-ILEEAKVMASVDHPCCLRIL-AVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGL-AKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKG--QRLNQPKICSIDAYTILVQCWLVDPDARPSFTEL 4087
            N+ KI Q +S  +  A +I T++S        +    +E I+ E  VM    HP  +  + +  L     +I ++M  GSL + V     ++    +    ++  SG+E+L SKG++H D+ + N+L+     +K+TDFG  A++ + + ++    G      W+A E +  + +  K D+WS G+ + EM   GE P+ +      L  +      +L +P+  S      L  C  V+P+ R S TEL
Sbjct:  622 NLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVV--THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPY---WMAPEVVSRKEYGPKVDIWSLGIMIIEMIE-GEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATEL 865          
BLAST of EGFR-5 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 80.4925 bits (197), Expect = 1.761e-15
Identity = 59/223 (26.46%), Postives = 114/223 (51.12%), Query Frame = 2
Query: 3578 LGSLLEFVQR-NRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLD--YSQQQYQFKGGRMPIKWLAVECIRNRI-FSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQ--------CWLVDPDARPS--------FTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEED 4186
            +GSL+    R +  LI  +T      Q+  G+ YL SKGI+H D+ A N+L+      KI+DFG+++     YS      +G    + W+A E +  +  +S+K D+WS G  + EMF+ G++P+++++   +    + G+  + P I   D   ++ Q        C+ ++P+ RP+        F+E+ +TF   S+   +++   D+ ++  L +  +E+
Sbjct: 1265 VGSLIRMYGRFDEPLIKHLTT-----QVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGT---VFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNLEV--VAAMFKIGKSKSAPPIPE-DTLPLISQIGRNFLDACFEINPEKRPTANELLSHPFSEVNETFNFKSTRLAKFIKSNDKLNSSKLRITSQEN 1475          
BLAST of EGFR-5 vs. Ensembl Nematostella
Match: EDO35594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL46])

HSP 1 Score: 194.512 bits (493), Expect = 7.215e-56
Identity = 101/249 (40.56%), Postives = 143/249 (57.43%), Query Frame = 2
Query: 3431 ILTDISDPSNNREILEEAKVMASV-DHPCCLRILAVCLTAHP-KLITQFMPLGSLLEFVQRNRS------------LINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGR-MPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYL 4132
            +L D + P    E L+E  +M  +  H   +  L       P  L+ +F+P G LL++++RNRS            +I    LL ++ QIA+GMEYL  KG +H DLAARNVL+   +QVK+ DFGL + L Y +  YQ    R +PIKW++ E I ++IF+++SDVWSYGV LWE+ + G  P+  I   D+   L  G R+ +P ICS + YTI+  CW   P  RP+F++LR  FE M    N YL
Sbjct:    1 VLVDTAGPEQGEEFLKEISLMKKLGSHKNIVNFLCCSTVKEPFMLVVEFLPKGDLLDYLRRNRSKQNDETGEQEDEMITPQDLLSFSYQIAAGMEYLSKKGFVHRDLAARNVLVADNKQVKVADFGLTRDL-YEESAYQGHSNRKLPIKWMSPEAIYDQIFTTESDVWSYGVVLWEIATLGGAPYPTISTRDVFVMLRSGYRMEKPDICSDEVYTIMKHCWEDQPKKRPTFSDLRMKFEYMLEADNPYL 248          
BLAST of EGFR-5 vs. Ensembl Nematostella
Match: EDO47802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL50])

HSP 1 Score: 194.126 bits (492), Expect = 1.727e-53
Identity = 120/318 (37.74%), Postives = 169/318 (53.14%), Query Frame = 2
Query: 3251 LITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPS---NNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFK-GGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKG--QRLNQPKICSIDAYTILVQ-CWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEE 4183
            LITES L   E+IG GAFG V KG W                     + D+  K++VAVK L   +D +      + ++EA  MA +DHP  +R+  + L+    L+T+  PLG LL  ++ NR      TL  +  Q+ASGM YLESK  IH DLAARNVL++S  +VKI DFGL + L      Y     G++P  W   E ++ R FS  SDVWS+G+ + E+FSYGE+P+  +    IL  ++    +R  +P  C    Y++LV  CW  DP  R  F+EL+K+ E +   P+    V   DS  P  + +EE
Sbjct:  110 LITESSLVLYEMIGDGAFGYVRKGQW---------------------TTDTGTKVDVAVKCLKFSADAAFIQMQTDFIKEANSMALLDHPHIIRLFGIVLSTPMMLVTELAPLGCLLTALRNNRQRFMVSTLCDFMIQVASGMAYLESKRFIHRDLAARNVLLESNEKVKIGDFGLMRALSVEDDYYTMNPKGKVPFAWCPPEALKYRKFSHASDVWSFGICVIELFSYGEEPWPGLNGAQILAKVDMPLCERPLKPSHCPSLIYSLLVSLCWAHDPSNRAGFSELKKSLEQV--RPHDVRAVHGYDSKSPQNLCFEE 404          
BLAST of EGFR-5 vs. Ensembl Nematostella
Match: EDO47094 (Predicted protein; Vascular endothelial growth factor receptor-like protein [Source:UniProtKB/TrEMBL;Acc:A7RN88])

HSP 1 Score: 188.734 bits (478), Expect = 3.652e-53
Identity = 108/295 (36.61%), Postives = 166/295 (56.27%), Query Frame = 2
Query: 3284 IIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASV-DHPCCLRILAVCLTAHPK----LITQFMPLGSLLEFVQRNRSL---------------INSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMM 4108
            ++GSGAFG VY G  +  ID          R  S IS   +IK  VA+K L   +  S  +++L E K++  V  H   + +L  C T  P+    +I +F   G LL ++++ R +                  + L+  A Q+A GME+L S+  IH DLAARNVLI     +K+ DFGLA+ +  +++  +   G +PIKW+A+E + ++I+S KSDVWSYGV LWE+F+ G  P+ D+   D+ E+L  G+R+ +P  C+ + Y I+  CW++ P+ RP+FTEL K  + M
Sbjct:   21 LLGSGAFGQVYLGETEGGIDY---------RRPSAISMRGNIK--VAIKTLKGGATESEQKDLLSELKILIHVGSHKNIVNLLGAC-TKGPQRDLWIILEFCANGDLLSYLKKKRDIYDPAWCAPSEDHDVQFTQMELVSAAYQVARGMEFLASRRCIHRDLAARNVLIADDYVLKVADFGLARDVYKNEEYVKHTPGLVPIKWIAIESLTDKIYSQKSDVWSYGVLLWEIFTLGGNPYPDLHPSDVFEYLLDGKRMEKPVDCAQEIYNIMTDCWVLSPEDRPTFTELVKKLDKM 303          
BLAST of EGFR-5 vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 191.045 bits (484), Expect = 5.715e-53
Identity = 104/315 (33.02%), Postives = 166/315 (52.70%), Query Frame = 2
Query: 3197 PSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLI-TQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYS----QQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNR 4126
            PS+ G     L  M+    I +  L  + IIG G F  VY+G+                     ++ +   +  VAVKIL   S   N  +   EA +M   DHP  + +  V     P +I T+F+  GSL  F++ N   + ++ L+   + +A+GM YL     IH DLAARN+L+      K++DFGL++ LD S    Q +YQ +GG++P++W A E IR R FSS SDVWSYG+ LWE+ S+GE+P+     + +++ +E G RL  P  C    + +++ CW  +  +RP F ++ + F+ +  +P++
Sbjct:    5 PSNYGDPMEAL--MSVAKEINKDDLKLEIIIGGGEFADVYRGV---------------------LTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDEVIRSPDK 296          
BLAST of EGFR-5 vs. Ensembl Nematostella
Match: EDO31298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYB5])

HSP 1 Score: 182.956 bits (463), Expect = 1.573e-51
Identity = 107/273 (39.19%), Postives = 153/273 (56.04%), Query Frame = 2
Query: 3287 IGSGAFGIVYKGIWQ-PNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILT--DISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRS--LINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQF-KGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTEL 4087
            +G G FG V KG ++ PN + I                       VAVK L   DI++P +  EIL EA+VM  +DHP  +RI+ +C      L+ +    G L +++++N+   L+N + L++   Q+A GM+YLES   +H DLAARNVL+ +   VKI+DFG+++ +      Y+    GR P+KW A ECI  R FSSKSDVWSYG+TLWE  SYG +P+  +    ILE +E G RL  P       Y ++  CW  + D RPSF ++
Sbjct:   32 LGHGNFGSVLKGTYKMPNGERIP----------------------VAVKSLKSDDINNPKS--EILHEARVMMELDHPYIVRIIGMCQGPSMMLVMELAGEGPLNKYLKKNKGMPLLNILVLML---QVAEGMQYLESLQFVHRDLAARNVLVVNDSFVKISDFGMSRAMGAGSDYYKAGTAGRWPLKWYAPECIYFRKFSSKSDVWSYGITLWEATSYGARPYQSLSGQAILEKIESGYRLPAPAKLPSCVYQLMKDCWQWEQDDRPSFMQI 277          
BLAST of EGFR-5 vs. Ensembl Medaka
Match: erbb4b (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:101165111])

HSP 1 Score: 331.257 bits (848), Expect = 1.122e-92
Identity = 192/506 (37.94%), Postives = 277/506 (54.74%), Query Frame = 2
Query: 2720 CHPYCSE--CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXX-----XXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQ-----LFQTSEII---------CTDHLIYSRFN--------MYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            C P CS+  C G     C  CK+F     CI+ C   Y   + E A            +  ++ +  C GS    C++C H K   N      C   C D +Q     +F+ +E           CT   I  R            +   G  G +   V + +   +S + +  K K  L    +    +  T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++LD ++++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   DI + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  498 CDPLCSDDGCWGSGPDQCLSCKFFSRGRSCIKSC-NLYQGEIREYANGSVCVECDSQCEQGDDNTLTCHGSGPEHCVKCLHFKDGPN------CVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQGCIGPRLQDCIGWMDRTPLIAAGVIGGLFMVVIMALSVAVSVRRKNIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWIP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLDVNEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGISTRDIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFTRMARDPQRYLVIQGDD 976          

HSP 2 Score: 212.231 bits (539), Expect = 5.037e-55
Identity = 181/657 (27.55%), Postives = 294/657 (44.75%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEK-DCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKIND--CANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKI---ENCSKKKC---HSECEQRL---GCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRS-CSKCHSECLPGIN---TCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  + N++FL SI +++GY+++  N  + + L  L++IRG   L       ++ + Y    N  L ++   NL  IL   V+ + N  LC+A   I+W  +++      V+V TN    C        CH SC        CWG   + CQ +    CA +     +  Y+++    E             P  + C AC NFN++G CV  CP  F ++   +    NP  +  +   CV KCP  F  +H +CV  C   K    +   + C+PC +  CPK C        Q    V    + +  NCT  +GN++     ++GD +HN+    + +  + L    ++ EI GYL I   +  N TD + F  NL  I    + S  S  + ++    +    L++LKE+  GN+ I  N QLC+ NT      ++  R  R+ N K+    N +  +C   H  C+      GCWG     C+ CK F     ++C+  C+      Y        N S C +C S+C  G +   TCHGS    C + C ++K G +C++KCP            Y ++   C+PCH NCT+        C GP  +D +G
Sbjct:   24 VCTGTENKLSTLSDLEQQYRTLRKYYE-NCEVVMGNLEITSIDRSRNLTFLRSIREVTGYVLVALNQFDHLPLENLRIIRGTK-LYEDRYSLAIFLNYRRDGNFGLRHLGLINLAEILYGGVYVDQNKFLCHAD-TIHWQDIVKNPGFHPVVVPTNSSVTCP------KCHRSCNGR-----CWGPKDNQCQSLTKTVCAEQCDGRCSGPYVSDCCHRECAGGCFG------PKDTDCFACTNFNDSGACVTQCPQPFFYNPTTFQLEHNPSARYTYGAFCVKKCPHNFVVDHNSCVRACPTNKMEVEDNHIKMCIPCTD-ICPKACDGIGTGTLQAAQTVDSSNIDKFVNCTKINGNLVFLITGIKGDVYHNI----EALDPEKLNVFRSVREITGYLNIQS-WPDNMTDLIVF-SNLATIGGRALYSGIS--LLVLKQQGISSFLLQSLKEISAGNVHIAENKQLCYYNT------VNWTRLFRSPNQKVLVRNNRNPLECARGHMVCDPLCSDDGCWGSGPDQCLSCKFF--SRGRSCIKSCN-----LYQGEIREYANGSVCVECDSQCEQGDDNTLTCHGSGPEHC-VKCLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQG-------CIGPRLQDCIG 630          
BLAST of EGFR-5 vs. Ensembl Medaka
Match: erbb4b (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:101165111])

HSP 1 Score: 330.487 bits (846), Expect = 1.240e-92
Identity = 192/506 (37.94%), Postives = 277/506 (54.74%), Query Frame = 2
Query: 2720 CHPYCSE--CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXX-----XXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQ-----LFQTSEII---------CTDHLIYSRFN--------MYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            C P CS+  C G     C  CK+F     CI+ C   Y   + E A            +  ++ +  C GS    C++C H K   N      C   C D +Q     +F+ +E           CT   I  R            +   G  G +   V + +   +S + +  K K  L    +    +  T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++LD ++++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   DI + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  460 CDPLCSDDGCWGSGPDQCLSCKFFSRGRSCIKSC-NLYQGEIREYANGSVCVECDSQCEQGDDNTLTCHGSGPEHCVKCLHFKDGPN------CVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQGCIGPRLQDCIGWMDRTPLIAAGVIGGLFMVVIMALSVAVSVRRKNIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWIP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLDVNEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGISTRDIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFTRMARDPQRYLVIQGDD 938          

HSP 2 Score: 178.333 bits (451), Expect = 1.549e-44
Identity = 174/670 (25.97%), Postives = 282/670 (42.09%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEK-DCGLNNEELSCHESCQAHLNKTYCWGNSSSACQK------------------INDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKI---ENCSKKKC---HSECEQRL---GCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRS-CSKCHSECLPGIN---TCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  + N++FL SI +++GY+++  N  + + L  L++IRG   L       ++ + Y    N  L ++   NL  IL   V+ + N  LC+A   I+W  +++      V+V TN    C        CH SC        CWG   + CQ                   ++DC +R C  +  C+                    GP  + C AC NFN++G CV  CP  F ++   +    NP  +  +   CV K                           C PC +G      +A   +DS  I         +  NCT  +GN++     ++GD +HN+    + +  + L    ++ EI GYL I   +  N TD + F  NL  I    + S  S  + ++    +    L++LKE+  GN+ I  N QLC+ NT      ++  R  R+ N K+    N +  +C   H  C+      GCWG     C+ CK F     ++C+  C+      Y        N S C +C S+C  G +   TCHGS    C + C ++K G +C++KCP            Y ++   C+PCH NCT+        C GP  +D +G
Sbjct:   24 VCTGTENKLSTLSDLEQQYRTLRKYYE-NCEVVMGNLEITSIDRSRNLTFLRSIREVTGYVLVALNQFDHLPLENLRIIRGTK-LYEDRYSLAIFLNYRRDGNFGLRHLGLINLAEILYGGVYVDQNKFLCHAD-TIHWQDIVKNPGFHPVVVPTNSSVTCP------KCHRSCNGR-----CWGPKDNQCQSLTKTVCAEQCDGRCSGPYVSDCCHREC--AGGCF--------------------GPKDTDCFACTNFNDSGACVTQCPQPFFYNPTTFQLEHNPSARYTYGAFCVKK---------------------------CPPC-DGIGTGTLQAAQTVDSSNID--------KFVNCTKINGNLVFLITGIKGDVYHNI----EALDPEKLNVFRSVREITGYLNIQS-WPDNMTDLIVF-SNLATIGGRALYSGIS--LLVLKQQGISSFLLQSLKEISAGNVHIAENKQLCYYNT------VNWTRLFRSPNQKVLVRNNRNPLECARGHMVCDPLCSDDGCWGSGPDQCLSCKFF--SRGRSCIKSCN-----LYQGEIREYANGSVCVECDSQCEQGDDNTLTCHGSGPEHC-VKCLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQG-------CIGPRLQDCIG 592          
BLAST of EGFR-5 vs. Ensembl Medaka
Match: erbb4b (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:101165111])

HSP 1 Score: 330.872 bits (847), Expect = 1.474e-92
Identity = 192/506 (37.94%), Postives = 277/506 (54.74%), Query Frame = 2
Query: 2720 CHPYCSE--CHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXX-----XXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQ-----LFQTSEII---------CTDHLIYSRFN--------MYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            C P CS+  C G     C  CK+F     CI+ C   Y   + E A            +  ++ +  C GS    C++C H K   N      C   C D +Q     +F+ +E           CT   I  R            +   G  G +   V + +   +S + +  K K  L    +    +  T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MAS++HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  VKITDFGLA++LD ++++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   DI + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  498 CDPLCSDDGCWGSGPDQCLSCKFFSRGRSCIKSC-NLYQGEIREYANGSVCVECDSQCEQGDDNTLTCHGSGPEHCVKCLHFKDGPN------CVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQGCIGPRLQDCIGWMDRTPLIAAGVIGGLFMVVIMALSVAVSVRRKNIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRIKILGSGAFGTVYKGIWIP--------------------EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLDVNEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGISTRDIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFTRMARDPQRYLVIQGDD 976          

HSP 2 Score: 212.616 bits (540), Expect = 5.129e-55
Identity = 183/673 (27.19%), Postives = 295/673 (43.83%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEK-DCGLNNEELSCHESCQAHLNKTYCWGNSSSACQK------------------INDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKI---ENCSKKKC---HSECEQRL---GCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRS-CSKCHSECLPGIN---TCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            VC  T+ ++    +    Y +L++ ++ NC  ++G++ I  I  + N++FL SI +++GY+++  N  + + L  L++IRG   L       ++ + Y    N  L ++   NL  IL   V+ + N  LC+A   I+W  +++      V+V TN    C        CH SC        CWG   + CQ                   ++DC +R C  +  C+                    GP  + C AC NFN++G CV  CP  F ++   +    NP  +  +   CV KCP  F  +H +CV  C   K    +   + C+PC +  CPK C        Q    V    + +  NCT  +GN++     ++GD +HN+    + +  + L    ++ EI GYL I   +  N TD + F  NL  I    + S  S  + ++    +    L++LKE+  GN+ I  N QLC+ NT      ++  R  R+ N K+    N +  +C   H  C+      GCWG     C+ CK F     ++C+  C+      Y        N S C +C S+C  G +   TCHGS    C + C ++K G +C++KCP            Y ++   C+PCH NCT+        C GP  +D +G
Sbjct:   24 VCTGTENKLSTLSDLEQQYRTLRKYYE-NCEVVMGNLEITSIDRSRNLTFLRSIREVTGYVLVALNQFDHLPLENLRIIRGTK-LYEDRYSLAIFLNYRRDGNFGLRHLGLINLAEILYGGVYVDQNKFLCHAD-TIHWQDIVKNPGFHPVVVPTNSSVTCP------KCHRSCNGR-----CWGPKDNQCQSLTKTVCAEQCDGRCSGPYVSDCCHREC--AGGCF--------------------GPKDTDCFACTNFNDSGACVTQCPQPFFYNPTTFQLEHNPSARYTYGAFCVKKCPHNFVVDHNSCVRACPTNKMEVEDNHIKMCIPCTD-ICPKACDGIGTGTLQAAQTVDSSNIDKFVNCTKINGNLVFLITGIKGDVYHNI----EALDPEKLNVFRSVREITGYLNIQS-WPDNMTDLIVF-SNLATIGGRALYSGIS--LLVLKQQGISSFLLQSLKEISAGNVHIAENKQLCYYNT------VNWTRLFRSPNQKVLVRNNRNPLECARGHMVCDPLCSDDGCWGSGPDQCLSCKFF--SRGRSCIKSCN-----LYQGEIREYANGSVCVECDSQCEQGDDNTLTCHGSGPEHC-VKCLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQG-------CIGPRLQDCIG 630          
BLAST of EGFR-5 vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 327.405 bits (838), Expect = 1.941e-91
Identity = 150/313 (47.92%), Postives = 212/313 (67.73%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MASV+HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++LD  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  632 TPSGTAPNQAQLRILKETELKRVKILGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDADEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFCRMARDPQRYLVIQGDD 924          

HSP 2 Score: 216.083 bits (549), Expect = 3.578e-56
Identity = 175/634 (27.60%), Postives = 281/634 (44.32%), Query Frame = 2
Query:  704 IGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKG-LKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQK------------------INDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKC---SNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            +G++ I  I  N N+SFL SI +++GY+++  N  E + L  L++IRG    L +G    ++ + Y    N  L+ +   +L  IL   V+ + N  LC+A   I+W  +++  Q E+++V +N      NN    CH SC        CWG+    CQ                   ++DC +R C  +  C+                    GP  + C AC NFN++G CV  CP  F ++   +    NP  K  +   CV +CP  F  +H +CV  C + K        + C+PC +  CPK+C        Q    V    + +  NCT  +GN++     ++GD +H +      +  + L     ++EI G+L I   +  N TD L    NL  I   ++ S     + I+    +     ++L E+  GN+ IF+N++LCF NT+   S+      + L   N +   C +++  C   C +  GCWGP    C+ C+ F  +  +TC+  C   + E   F N S   E +  C K     L    TC G   ++C + C N+K G +C++KCP            Y  +   C+PCH NCT+        C GP  +D +G
Sbjct:    1 MGNLEITSIDRNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGTT--LYEGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQNKFLCHAD-TIHWQDVIKNPQAELLVVPSNNS----NNGCRRCHRSCNGR-----CWGHQEDQCQTLTKTVCAEQCDGRCFGPYVSDCCHREC--AGGCF--------------------GPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECPHNFVVDHSSCVRACPSNKMEVEENRIKMCIPCTD-ICPKVCDGIGTGSLQTAQTVDASNIDKFVNCTKINGNLIFLITGIKGDMYHGIGP----LDPERLNVFRTVKEITGFLNIQS-WPENMTD-LSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMCSED-GCWGPGPDQCLSCRYF--KRGRTCVESCNLFNGEVREFANGSVCLECDSQCEKMDGNSL----TCLGQGPDQC-VKCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQG-------CIGPRIQDCVG 578          
BLAST of EGFR-5 vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 326.635 bits (836), Expect = 7.553e-91
Identity = 150/313 (47.92%), Postives = 212/313 (67.73%), Query Frame = 2
Query: 3212 TNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDED 4150
            T SG  PN A L ++ E++L R +I+GSGAFG VYKGIW P                    +  ++K+ VA+KIL + + P  N E ++EA +MASV+HP  +R+L VCL+   +L+TQ MP G LL++V  ++  I S  LL W  QIA GM YLE + ++H DLAARNVL++SP  +KITDFGLA++LD  +++Y   GG+MPIKW+A+ECI  R F+ +SDVWSYGVT+WE+ ++G KP+  I   +I + LEKG+RL QP IC+ID Y ++V+CW++D D+RP F EL   F  M+ +P RYL++Q +D
Sbjct:  781 TPSGTAPNQAQLRILKETELKRVKILGSGAFGTVYKGIWVP--------------------EGETVKIPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDADEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFCRMARDPQRYLVIQGDD 1073          

HSP 2 Score: 225.328 bits (573), Expect = 5.495e-59
Identity = 182/667 (27.29%), Postives = 297/667 (44.53%), Query Frame = 2
Query:  614 VCKSTQTQIDVSKN---SYESLKRNFDKNCSYIIGDVVIAHIT-NENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKG-LKFSLIVGY----NSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQK------------------INDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYI--QNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVN---QTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG--RFLRALNGKIENCSKKK--CHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKC---SNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKY---------YVDSMKNCYPCHTNCTENSQNKESTCHGP--EDSLG 2461
            VC  T  ++    +    Y +L++ ++ NC  ++G++ I  I  N N+SFL SI +++GY+++  N  E + L  L++IRG    L +G    ++ + Y    N  L+ +   +L  IL   V+ + N  LC+A   I+W  +++  Q E+++V +N      NN    CH SC        CWG+    CQ                   ++DC +R C  +  C+                    GP  + C AC NFN++G CV  CP  F ++   +    NP  K  +   CV +CP  F  +H +CV  C + K        + C+PC +  CPK+C        Q    V    + +  NCT  +GN++     ++GD +H +      +  + L     ++EI G+L I   +  N TD L    NL  I   ++ S     + I+    +     ++L E+  GN+ IF+N++LCF NT+   S+      + L   N +   C +++  C   C +  GCWGP    C+ C+ F  +  +TC+  C   + E   F N S   E +  C K     L    TC G   ++C + C N+K G +C++KCP            Y  +   C+PCH NCT+        C GP  +D +G
Sbjct:  118 VCPGTDNKLSTLSDLDQQYRTLRKLYE-NCEVVMGNLEITSIDRNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGTT--LYEGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQNKFLCHAD-TIHWQDVIKNPQAELLVVPSNNS----NNGCRRCHRSCNGR-----CWGHQEDQCQTLTKTVCAEQCDGRCFGPYVSDCCHREC--AGGCF--------------------GPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECPHNFVVDHSSCVRACPSNKMEVEENRIKMCIPCTD-ICPKVCDGIGTGSLQTAQTVDASNIDKFVNCTKINGNLIFLITGIKGDMYHGIGP----LDPERLNVFRTVKEITGFLNIQS-WPENMTD-LSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMCSED-GCWGPGPDQCLSCRYF--KRGRTCVESCNLFNGEVREFANGSVCLECDSQCEKMDGNSL----TCLGQGPDQC-VKCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQG-------CIGPRIQDCVG 727          
BLAST of EGFR-5 vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 2815.02 bits (7296), Expect = 0.000e+0
Identity = 1441/1451 (99.31%), Postives = 1444/1451 (99.52%), Query Frame = 2
Query:  347 MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 4699
            MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILK+EECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG FLRALNGK  NCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCS+CHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKES CHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVC PCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVI FVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKP+DRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQ KNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE
Sbjct:    1 MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPLDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQAKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 1451          
BLAST of EGFR-5 vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 2809.63 bits (7282), Expect = 0.000e+0
Identity = 1440/1454 (99.04%), Postives = 1444/1454 (99.31%), Query Frame = 2
Query:  347 MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLN---NEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 4699
            MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLN   +EELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILK+EECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG FLRALNGK  NCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCS+CHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKES CHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVC PCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVI FVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKP+DRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQ KNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE
Sbjct:    1 MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPLDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQAKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 1454          
BLAST of EGFR-5 vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 2791.14 bits (7234), Expect = 0.000e+0
Identity = 1429/1439 (99.31%), Postives = 1432/1439 (99.51%), Query Frame = 2
Query:  383 MRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 4699
            MRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILK+EECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG FLRALNGK  NCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCS+CHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKES CHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVC PCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVI FVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKP+DRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQ KNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE
Sbjct:    1 MRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPLDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQAKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 1439          
BLAST of EGFR-5 vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 2785.36 bits (7219), Expect = 0.000e+0
Identity = 1426/1436 (99.30%), Postives = 1429/1436 (99.51%), Query Frame = 2
Query:  392 MLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 4699
            MLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILK+EECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG FLRALNGK  NCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCS+CHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKES CHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVC PCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVI FVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKP+DRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQ KNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE
Sbjct:    1 MLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPLDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQAKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 1436          
BLAST of EGFR-5 vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 2782.67 bits (7212), Expect = 0.000e+0
Identity = 1428/1442 (99.03%), Postives = 1432/1442 (99.31%), Query Frame = 2
Query:  383 MRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLN---NEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSXXXXXXXXXXXXXXPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGPEDSLGQKGCSICNHIIVXXXXXXXXXXXXXFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPXXXXXXXXXXXXXXXLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGXXXXXXXXXXXXXXXXKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSXXXXXXXXXXQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 4699
            MRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLN   +EELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILK+EECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKG FLRALNGK  NCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCS+CHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKES CHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVC PCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVI FVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKP+DRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQ KNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE
Sbjct:    1 MRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQSYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDVSKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNSKIDEELSCHESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQNDGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHLIYSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSSYESAATKPLDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNSTNPDYTALLLQAKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCLKKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINHE 1442          
The following BLAST results are available for this feature:
BLAST of EGFR-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERBB43.039e-9538.23erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
ERBB45.119e-9538.23erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
ERBB46.537e-9538.23erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
ERBB21.322e-8946.96erb-b2 receptor tyrosine kinase 2 [Source:HGNC Sym... [more]
EGFR2.795e-8947.28epidermal growth factor receptor [Source:HGNC Symb... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-231.828e-11328.27Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-235.128e-11328.27Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-237.707e-11328.27Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-238.859e-11328.27Receptor tyrosine-protein kinase let-23 [Source:U... [more]
kin-233.587e-4736.00pep chromosome:WBcel235:I:11640687:11642206:-1 gen... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egfr4.692e-17230.54gene:FBgn0003731 transcript:FBtr0071654[more]
Egfr7.178e-17131.00gene:FBgn0003731 transcript:FBtr0071653[more]
Shark7.869e-5437.33gene:FBgn0015295 transcript:FBtr0087244[more]
Csk6.049e-4835.76gene:FBgn0262081 transcript:FBtr0300549[more]
Csk6.049e-4835.76gene:FBgn0262081 transcript:FBtr0300547[more]
back to top
BLAST of EGFR-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erbb4a6.290e-9437.90erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
si:ch73-383l1.11.462e-9346.65si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-6... [more]
erbb4a5.318e-9337.90erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
erbb4a7.045e-9337.62erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
egfra1.197e-9044.18epidermal growth factor receptor a (erythroblastic... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGFR3.200e-9830.43epidermal growth factor receptor [Source:NCBI gene... [more]
ERBB44.016e-9147.28erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB41.104e-9047.28erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB42.307e-9047.28erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB42.333e-9047.28erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erbb42.457e-9147.60erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Erbb42.644e-9147.60erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Egfr4.201e-8947.60epidermal growth factor receptor [Source:MGI Symbo... [more]
Erbb21.766e-8746.65erb-b2 receptor tyrosine kinase 2 [Source:MGI Symb... [more]
Erbb31.418e-7030.55erb-b2 receptor tyrosine kinase 3 [Source:MGI Symb... [more]
back to top
BLAST of EGFR-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04412|EGFR_DROME1.178e-16730.40Epidermal growth factor receptor OS=Drosophila mel... [more]
sp|P0CY46|EGFR_APIME1.830e-16133.21Epidermal growth factor receptor OS=Apis mellifera... [more]
sp|P24348|LET23_CAEEL9.804e-11228.27Receptor tyrosine-protein kinase let-23 OS=Caenorh... [more]
sp|Q15303|ERBB4_HUMAN3.139e-9438.23Receptor tyrosine-protein kinase erbB-4 OS=Homo sa... [more]
sp|P00535|ERBB_AVIER2.928e-9244.61Tyrosine-protein kinase transforming protein erbB ... [more]
back to top
BLAST of EGFR-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B1ACY90.000e+099.59Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
L0H9P90.000e+099.81EGFR-5 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A1B1ACY80.000e+040.37Epidermal growth factor receptor Smed-egfr-6 OS=Sc... [more]
A0A059PB470.000e+034.05Receptor protein-tyrosine kinase OS=Crassostrea gi... [more]
A0A1S3HC100.000e+034.33Receptor protein-tyrosine kinase OS=Lingula unguis... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016431.25.490e-9345.37epidermal growth factor receptor-like [Source:NCBI... [more]
erbb4b1.118e-9237.88erb-b2 receptor tyrosine kinase 4b [Source:ZFIN;Ac... [more]
ENSAMXT00000047506.14.078e-9245.37epidermal growth factor receptor-like [Source:NCBI... [more]
ENSAMXT00000002946.24.504e-9242.82pep primary_assembly:Astyanax_mexicanus-2.0:12:281... [more]
ENSAMXT00000051131.15.085e-9245.37epidermal growth factor receptor-like [Source:NCBI... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003172.17.553e-9748.88pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 ge... [more]
EGFR3.771e-7539.22epidermal growth factor receptor [Source:HGNC Symb... [more]
ENSPMAT00000005822.11.435e-6355.56pep scaffold:Pmarinus_7.0:GL476959:64997:68848:-1 ... [more]
ENSPMAT00000010487.11.323e-6028.92pep scaffold:Pmarinus_7.0:GL501102:818:30108:-1 ge... [more]
frk2.104e-4733.44fyn-related Src family tyrosine kinase [Source:ZFI... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN28.133e-2128.02Serine/threonine protein kinase involved in regula... [more]
KIN11.286e-1927.70Serine/threonine protein kinase involved in regula... [more]
STE117.429e-1624.83Signal transducing MEK kinase; involved in pheromo... [more]
STE209.451e-1626.80Cdc42p-activated signal transducing kinase; involv... [more]
BCK11.761e-1526.46MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355947.215e-5640.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478021.727e-5337.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470943.652e-5336.61Predicted protein; Vascular endothelial growth fac... [more]
EDO337365.715e-5333.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312981.573e-5139.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EGFR-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erbb4b1.122e-9237.94erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
erbb4b1.240e-9237.94erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
erbb4b1.474e-9237.94erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
erbb4a1.941e-9147.92receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
erbb4a7.553e-9147.92receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
back to top
BLAST of EGFR-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044603.10.000e+099.31SMESG000044603.1[more]
SMESG000044603.10.000e+099.04SMESG000044603.1[more]
SMESG000044603.10.000e+099.31SMESG000044603.1[more]
SMESG000044603.10.000e+099.30SMESG000044603.1[more]
SMESG000044603.10.000e+099.03SMESG000044603.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000756
GenBankAGA95411.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000756 ID=SMED30000756|Name=EGFR-5|organism=Schmidtea mediterranea sexual|type=transcript|length=4812bp
TCCGATCTTATAAAACAAACGTGAAACACAGTAGAAATTCGAATTAGTGA
TCAACTTTTGTGATCAGATTATTCATTCGTTCTTATTAAGTAGGAAATGA
ACGAGAAAAAAAAACTTTTTTCAAAGGTTTTATCTCTCATCACTGATGCT
GTTCATAGCAAACGCCATGATTAATTCCAATTCTATGAAACCCGATAACC
GAATGCCTTGTTATTTCATTGTCCATTGTGAAGCATAATTTGCATATTTG
TTACGATCGATTTGCACATTTGTCTCTCATCAATTTCATAGATTTATTCT
TTCTGAAAACCGATTTCAGTGCCTGCAAATTCCTGTGACGATTTTCATGG
TTTTCAGTTGTTGCCATCTCTCTTTCAAACCGATGAGGTCTATGTTGAGC
GGTTTGAGTACTGTCATTTTGTTATCTTTTCTGATTCTTGCTGTCGAATC
CATGTATAACAATCAAGATATTATGTTTAAATTCTTCGATTTCCAGAGCT
ATCTAAAAAACAAAGAAAGGACCGAAAACCACCAAGACATGGAACTATAT
TTCGAGGCAATCAAGGAGACGTTCGAACTCTACAATCAAGACAAAAGATA
CAGGCATGGAAAAGTTTGCAAAAGTACACAAACTCAAATTGACGTGAGCA
AGAATTCATACGAAAGTCTTAAACGAAACTTTGATAAAAATTGTTCCTAT
ATTATCGGAGATGTCGTAATCGCACATATAACAAATGAAAATATTTCATT
TTTGAATTCAATAGAAGATATTTCGGGATATTTGATGATCTTTTCTAATG
CTGTTGAATCCATTTCTTTGATTAAATTGAAGGTCATTCGAGGGGAAAAT
CCTCTTTTAATAAAGGGGTTAAAATTTAGTTTAATTGTTGGATACAATTC
AATGTTGGAAAATATTCTATTTCCTAATTTACAAGTTATTCTTCGGCACA
ACGTATTCTTCAATAATAATCCTAAATTATGCTATGCATCTAGGAAAATT
AATTGGAATTCCTTAATGAGAAGAAGCCAGGAAGTAGTAATTGTTGAAAC
CAACGAAAAAGATTGTGGACTCAACAATGAAGAACTCAGTTGCCATGAAT
CATGTCAAGCGCATTTAAACAAGACGTATTGTTGGGGCAATTCCAGTTCG
GCTTGCCAGAAAATCAACGATTGTGCCAACCGAACCTGCTATGACTCTAC
CAAGTGCTATATAAATGAAATTTTGAAAAGTGAAGAATGTTGCCATGAAG
AATGTGTGGGGGGTTGTACAGGGCCTGCTAGGTCACAATGCCTGGCATGT
AAAAATTTCAATAACAATGGTATTTGTGTTGAAAATTGCCCTCCAGAATT
CAAACATGATGGGATGAAATATATACAAAATCCTCTTGGAAAACTGGCAT
TTTACTACATTTGTGTGGATAAATGTCCTAAGAAGTTTTTTAATGAACAT
GGTAATTGTGTCACTCAGTGCTCAGCTGAGAAGACGTACGCAGTGAACCA
AACTTGTGTCCCGTGCCCAAATGGAAAATGTCCAAAAATTTGTCGTGCTC
GGGATATTCTCGATTCACAAGAAATCTCATACGTTCACAGGAAGGTGCTT
GGTCGCTTGGAAAACTGCACAGTTTATGATGGGAATATCTTGATCAACAG
ATTCTCATTAGAAGGAGACAATTTTCACAATTTATCCAAGCAAAACGATG
GAATAAGAAAACAGGATCTTAAAAAGCTTGAGAACTTAGAGGAAATTTAT
GGATATCTGAGAATTCATGTTCCATTCAATTCAAATTGGACGGATTCTTT
GGAGTTTCTGAAAAATTTAAGAATTATACGTGCAGAAAATGTCCGTTCAC
ATAAATCCAGGGGCATTGAGATCGTAGGCAATCCAGCATTGAAATATCTT
GGATTAAGAAACTTGAAGGAGGTCCGCAACGGGAATATCATCATCTTCTC
GAACAACCAATTGTGCTTTTCGAACACCTTGACCAATAAAAGCATCCTTC
ACAAAGGGAGATTTCTCAGAGCGCTAAATGGAAAAATAGAAAATTGCAGC
AAAAAAAAGTGCCACAGTGAGTGTGAACAACGATTAGGATGTTGGGGCCC
AGAAAAATACCATTGTGTCAAGTGCAAAAGTTTCGTAATTCGCGAAAGCA
AAACTTGTCTTTCTAAATGTTCAAATGAGCCTGGATATTTTTATAACTCA
TCAAGTGATCATGAAGTCAATAGAAGCTGTTCGAAATGTCACTCAGAATG
TTTACCTGGAATAAACACATGTCATGGGTCGAATGAAAATGAGTGTAACT
TAGGATGCAAAAACTATAAATTTGGAGAAAGTTGCATTAAAAAATGCCCT
GCAAAATATTACGTAGACAGTATGAAAAATTGTTATCCCTGTCATACGAA
TTGCACTGAGAATTCACAAAATAAAGAATCAACGTGCCACGGTCCGGAGG
ACTCACTTGGCCAAAAAGGATGCTCGATATGCAACCATATCATAGTGAGC
TCCAACCATTCGACATCTTACAAAAACTCTAGCAATTTTAATATACTAAA
ATGTTTGAAAAATTCTGATATTTGTCCCAAGGGGTTTTACAAATCCATCA
TTGACTTCAGATCAGGCATGAAAGTCAATGCAGCAATGCAATCAACAATG
AAAATTCTCGAAAAATGGATAGAAATCGGCACGAATCATGATTTGCCTAT
TGCTTCCGTTTGTCTCCCATGTCATCCATATTGCTCCGAATGTCACGGAG
GATCAAGTTGGCACTGCAGCTTATGCAAATATTTCAGATCAGACAATAAA
TGTATACAGAAATGTCCCAAAGAATATTTCATAACTGTCAATGAGACAGC
GAAACCTGAAAGCGAGTGTAAGAAATGTCACGAAGAGTGCAGTGAAGGAT
GCCTGGGGTCAACGAATTACGACTGCCTAAGATGCAAACACGCCAAGATT
TATGTCAATGGCTCCACACAATTCTTCTGTAACTCGACTTGTGGAGACAG
AATACAATTGTTTCAAACTTCAGAAATCATTTGCACGGATCATTTAATTT
ATTCTCGATTTAATATGTATATTTATATTGGAGGACCAGCCGGAATTGTC
ATTAGTTTTGTGTTCATTATCGTGTGCTTCATATTATCATCGAAAAACCA
GGAAAAAAAGTTTAAAACGAAATTGGTTAACCAAGGAGATTTTTATCCTT
CTGACACAGGGACAAATTCTGGAGTGTTGCCAAATATGGCAACATTGTTG
CTGATCACAGAAAGTCAATTAACCCGGCAAGAAATCATAGGTTCAGGAGC
GTTTGGAATCGTTTACAAAGGGATCTGGCAACCGAACATAGATGCGATTG
ATAAAAGCAATTCATTTTTGAAACGAAATATATCAAAAATATCGCAAGAC
TCTTCAATCAAATTGAATGTGGCGGTGAAAATACTCACTGATATTTCAGA
TCCTTCTAACAACAGGGAGATTTTGGAGGAAGCAAAGGTAATGGCGTCGG
TTGACCATCCGTGTTGCTTGCGGATTCTCGCAGTCTGCTTGACAGCACAT
CCGAAATTGATAACTCAATTTATGCCTTTGGGAAGTTTGTTGGAGTTTGT
ACAACGAAACCGGAGTCTGATCAACAGCATTACCCTGTTGATTTGGGCCA
AACAGATCGCTAGTGGCATGGAATATTTGGAATCTAAAGGAATCATCCAC
TGTGACCTTGCAGCTAGGAATGTTTTGATACAGTCTCCTCGACAAGTTAA
AATAACTGATTTTGGATTAGCAAAAATGCTTGATTATAGCCAACAACAAT
ATCAGTTCAAGGGGGGTAGAATGCCTATTAAATGGCTGGCTGTTGAATGC
ATTCGTAACCGAATATTTTCTTCGAAATCAGATGTTTGGTCATATGGTGT
AACCTTATGGGAAATGTTTTCGTATGGCGAAAAACCATTTGCTGACATAA
AAGCCTACGATATACTCGAACATCTTGAAAAAGGTCAAAGGTTGAATCAA
CCCAAGATTTGCAGTATTGATGCCTATACAATTCTTGTTCAATGTTGGTT
AGTTGATCCAGATGCCAGACCGTCTTTTACGGAATTGAGGAAGACCTTTG
AAATGATGTCAAGCAATCCAAATCGGTATTTATTAGTTCAGGATGAAGAC
TCCAATGAACCACTCTACGTAGAATGGGAGGAGGACGCTCAGAAATATGA
CGAGTTCCTGCAAGCACTAGTTACGGTGTCCCATATTAATTCCTCATACG
AATCCGCTGCCACTAAGCCCATTGATAGGAAACACATTAAGTCCGTCAGA
GACCGGTATCACGAAATGCGTGCCTATAAAAATTGCTTCATTAATAATGA
GAATTATTGTGAAACAGATGGGAAAAAACATAATACTAATTCTACTAATC
CTGATTACACAGCCCTTTTGCTTCAGGGGAAAAACAACTCCAATCAAACT
GGGAGCACATGGTCAGATTATTTTGATAGCAAAAAGAAACGCACTTCTAA
TTGTACTACGTTGACCAACCTCAATTTACAGAGGGAAGATTGCTTGAAAA
AAGAGATACTCGAAACTGATTTAAGTGAAGATGGTTATTTAATACCAATT
TCAGCCTATAGAAAAGAATCAGCAATTGGAAATCCCATTGAAAAATTCGT
CTACGTATGTGAGAAACCTGCTGAAAAGGAAATGTTGATAAATCATGAGA
GCTCGATATAAATATCATTATTTTTTATATAACGCAATAATGTATATACA
TTTGATTGAGACATTTCTTGCCAAATTATTTTCACTTCATTTTAATAAAT
TTATTGGCAGCG
back to top

protein sequence of SMED30000756-orf-1

>SMED30000756-orf-1 ID=SMED30000756-orf-1|Name=SMED30000756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1455bp
MVFSCCHLSFKPMRSMLSGLSTVILLSFLILAVESMYNNQDIMFKFFDFQ
SYLKNKERTENHQDMELYFEAIKETFELYNQDKRYRHGKVCKSTQTQIDV
SKNSYESLKRNFDKNCSYIIGDVVIAHITNENISFLNSIEDISGYLMIFS
NAVESISLIKLKVIRGENPLLIKGLKFSLIVGYNSMLENILFPNLQVILR
HNVFFNNNPKLCYASRKINWNSLMRRSQEVVIVETNEKDCGLNNEELSCH
ESCQAHLNKTYCWGNSSSACQKINDCANRTCYDSTKCYINEILKSEECCH
EECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKL
AFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPKICR
ARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNFHNLSKQN
DGIRKQDLKKLENLEEIYGYLRIHVPFNSNWTDSLEFLKNLRIIRAENVR
SHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSI
LHKGRFLRALNGKIENCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRE
SKTCLSKCSNEPGYFYNSSSDHEVNRSCSKCHSECLPGINTCHGSNENEC
NLGCKNYKFGESCIKKCPAKYYVDSMKNCYPCHTNCTENSQNKESTCHGP
EDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKS
IIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCLPCHPYCSECH
GGSSWHCSLCKYFRSDNKCIQKCPKEYFITVNETAKPESECKKCHEECSE
GCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQTSEIICTDHL
IYSRFNMYIYIGGPAGIVISFVFIIVCFILSSKNQEKKFKTKLVNQGDFY
PSDTGTNSGVLPNMATLLLITESQLTRQEIIGSGAFGIVYKGIWQPNIDA
IDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMA
SVDHPCCLRILAVCLTAHPKLITQFMPLGSLLEFVQRNRSLINSITLLIW
AKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQQ
QYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFAD
IKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKT
FEMMSSNPNRYLLVQDEDSNEPLYVEWEEDAQKYDEFLQALVTVSHINSS
YESAATKPIDRKHIKSVRDRYHEMRAYKNCFINNENYCETDGKKHNTNST
NPDYTALLLQGKNNSNQTGSTWSDYFDSKKKRTSNCTTLTNLNLQREDCL
KKEILETDLSEDGYLIPISAYRKESAIGNPIEKFVYVCEKPAEKEMLINH
ESSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000011protonephridial progenitor cell
PLANA:0000020protonephridia
PLANA:0000065flame cell
PLANA:0000087proximal tubule
PLANA:0000099neuron
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036941Rcpt_L-dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR006212Furin_repeat
IPR000494Rcpt_L-dom
IPR032778GF_recep_IV
IPR006211Furin-like_Cys-rich_dom
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR009030Growth_fac_rcpt_cys_sf
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004713protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 1159..1169
score: 48.17
coord: 1178..1200
score: 53.55
coord: 1222..1244
score: 36.93
coord: 1110..1128
score: 58.15
coord: 1073..1086
score: 36.7
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 976..1250
e-value: 2.6E-80
score: 269.5
IPR006212Furin-like repeatSMARTSM00261furin_3coord: 786..829
e-value: 3.6E-6
score: 36.5
coord: 625..673
e-value: 1.5E-4
score: 31.1
coord: 676..749
e-value: 26.0
score: 5.6
coord: 295..337
e-value: 7.6E-10
score: 48.7
coord: 838..888
e-value: 0.0079
score: 25.4
coord: 564..616
e-value: 1.1E-6
score: 38.2
IPR006212Furin-like repeatCDDcd00064FUcoord: 571..622
e-value: 3.59476E-6
score: 43.2764
IPR006212Furin-like repeatCDDcd00064FUcoord: 791..828
e-value: 3.95683E-5
score: 40.58
IPR006212Furin-like repeatCDDcd00064FUcoord: 631..678
e-value: 0.00339981
score: 34.802
IPR006212Furin-like repeatCDDcd00064FUcoord: 298..338
e-value: 9.80253E-8
score: 47.8988
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 396..596
e-value: 5.5E-43
score: 149.0
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 83..272
e-value: 9.0E-41
score: 141.5
IPR006211Furin-like cysteine-rich domainPFAMPF00757Furin-likecoord: 247..399
e-value: 1.3E-20
score: 73.8
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 838..908
e-value: 4.5E-5
score: 25.8
coord: 785..837
e-value: 9.7E-6
score: 27.9
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 615..707
e-value: 2.4E-10
score: 41.9
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 1076..1274
e-value: 2.3E-56
score: 192.2
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 273..395
e-value: 3.7E-25
score: 90.1
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 930..1075
e-value: 2.5E-28
score: 100.5
NoneNo IPR availablePANTHERPTHR24416:SF95EPIDERMAL GROWTH FACTOR RECEPTORcoord: 97..570
coord: 565..1306
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 565..1306
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 97..570
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 394..585
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 88..265
NoneNo IPR availableTMHMMTMhelixcoord: 16..38
NoneNo IPR availableTMHMMTMhelixcoord: 908..930
IPR000494Receptor L-domainPFAMPF01030Recep_L_domaincoord: 423..548
e-value: 1.3E-18
score: 67.1
coord: 115..223
e-value: 1.7E-19
score: 69.9
IPR032778Growth factor receptor domain 4PFAMPF14843GF_recep_IVcoord: 572..694
e-value: 1.7E-14
score: 53.8
coord: 786..860
e-value: 1.8E-8
score: 34.3
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 1116..1128
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 975..1262
score: 37.347
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 571..697
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 243..399
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 707..890
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 968..1283