Cell wall integrity and stress response component 1

Overview
NameCell wall integrity and stress response component 1
Smed IDSMED30000749
Length (bp)998
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell wall integrity and stress response component 1 (SMED30000749) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell wall integrity and stress response component 1 (SMED30000749) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell wall integrity and stress response component 1 (SMED30000749) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell wall integrity and stress response component 1 (SMED30000749) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000749

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30000749h1SMcG0020064 Contig50648newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000749h1SMcG0020064 Contig50648uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30000749h1SMcG0020064 dd_Smed_v4_5024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000749h1SMcG0020064 dd_Smed_v4_5024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000749h1SMcG0020064 dd_Smed_v4_5024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000749h1SMcG0020064 dd_Smed_v4_5024_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell wall integrity and stress response component 1 vs. TrEMBL
Match: A0A5P8I4L8 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.657e-67
Identity = 110/245 (44.90%), Postives = 169/245 (68.98%), Query Frame = 1
Query:  208 KTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKD-LRTEEN-MAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAKXXXXXXXXXXIRVLSKPG---ALVLFALAMLI 927
            K E+LVIGAGQMRTGTFSLK+ALE+LY   CYHM  ++N HKDH++ W++  + G ++++TA  +F+ Y + +D+PS+A Y+DL+ IYPNAKV+LTTR++  W++SVK TT++ +       ++   FN   +F  M +KM+ + +    D LRT++  +   YE +NEEVRK VPKERLLEF  + GWEPLC FL +  +P+EP+P++NT K+F+   R   ++ + + G   +L +  L+++I
Sbjct:    5 KNEILVIGAGQMRTGTFSLKFALEKLYNRPCYHMAEILNHHKDHVKLWISVFDSGKMNEKTAGKIFSDYSATVDFPSAAVYKDLMEIYPNAKVVLTTRNSDDWVKSVKSTTLRNNMKTSFVHKILFYFNLGTEFPVMLDKMYLKAYKEPFDALRTDDELLKQCYEEFNEEVRKYVPKERLLEFNAKEGWEPLCRFLNL-PVPNEPYPFVNTTKDFQRNVRGMMLKSVIRSGLVLSLTIGCLSLII 248          
BLAST of Cell wall integrity and stress response component 1 vs. TrEMBL
Match: A0A267EUL9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019766g2 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 8.831e-50
Identity = 93/224 (41.52%), Postives = 129/224 (57.59%), Query Frame = 1
Query:  175 CEKMSVLQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDH--KDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAK 840
            C K      +    L+VIGAG  RTGT S K ALE L G  CYHM   +  H  + HI  W+ A+  G L K  AD +   Y + +DYP+++FY++L+  YPNAKVIL+ R T SW+ES++ + +K       F R      G+ +  +M + +F R F  + +L   E MA  +E  N+ +R+VVP ERLLEF V  GW PLC FL +  +PD+PFP +N  K
Sbjct:    4 CTKYQTKMPQKTHSLVVIGAGAPRTGTVSQKVALELLLGQPCYHMGEALGPHNSRRHIPMWIQAVESG-LSKSLADEILGNYAACVDYPTASFYKELMQHYPNAKVILSVRDTSSWVESMQSSILKAMHTMERFPRPLKWLLGIGQADKMIDAVFRREFGDNYNLADSEFMARRFEERNDSIRRVVPSERLLEFRVSDGWAPLCQFLNL-PVPDKPFPRLNDRK 225          
BLAST of Cell wall integrity and stress response component 1 vs. TrEMBL
Match: A0A267FWT0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019766g4 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.032e-49
Identity = 93/224 (41.52%), Postives = 129/224 (57.59%), Query Frame = 1
Query:  175 CEKMSVLQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVN--DHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAK 840
            C K      +    L+VIGAG  RTGT S K ALE L G  CYHM   +   + + HI  W+ A+  G L K  AD +   Y + +DYP+++FYQ+L+  YPNAKVIL+ R T SW+ES++ + +K       F R      G+ +  +M + +F R F  + +L   E MA  +E  N+ +R+VVP ERLLEF V  GW PLC FL +  +PD+PFP +N  K
Sbjct:    5 CTKYQTKMPQKTHSLVVIGAGAPRTGTVSQKVALELLLGQPCYHMGEALGPQNSRRHIPMWIQAVESG-LSKSLADEILGNYSACVDYPTASFYQELMQHYPNAKVILSVRDTSSWVESMQTSILKAMHTMERFPRPLKWLLGIGQADKMIDAVFRREFGDNYNLADSEFMARRFEERNDSIRRVVPSERLLEFRVSDGWAPLCQFLNL-PVPDKPFPRLNDRK 226          
BLAST of Cell wall integrity and stress response component 1 vs. TrEMBL
Match: A0A267EKC2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019766g3 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.121e-49
Identity = 95/225 (42.22%), Postives = 130/225 (57.78%), Query Frame = 1
Query:  175 CEKMSVLQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHM---LALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAK 840
            C K      +    L+VIGAG  RTGT S K ALE L G  CYHM   L L N  + HI  W+ A+  G L K  AD +   Y + +DYP+++FY++L+  YPNAKVIL+ R T SW+ES++ + +K       F R      G+ +  +M + +F R F  + +L   E MA  +E  N+ +R+VVP ERLLEF V  GW PLC FL +  +PD+PFP +N  K
Sbjct:    5 CTKYQTKMPQKTHSLVVIGAGAPRTGTVSQKVALELLLGQPCYHMGEALGLHNSRR-HIPMWIQAVESG-LSKSLADEILGNYSACVDYPTASFYKELMQHYPNAKVILSVRDTNSWVESMQSSILKAMHTMERFPRPLKWLLGIGQADKMIDAVFRREFGDNYNLADSEFMARQFEERNDSIRRVVPSERLLEFRVSDGWAPLCQFLNL-PVPDKPFPRLNDRK 226          
BLAST of Cell wall integrity and stress response component 1 vs. TrEMBL
Match: A0A1I8I195 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.908e-49
Identity = 91/210 (43.33%), Postives = 126/210 (60.00%), Query Frame = 1
Query:  217 LLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDH--KDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAK 840
            L+VIGAG  RTGT S K ALE L G  CYHM   +  H  + HI  W+ A+  G L K  AD +   Y + +DYP+++FY++L+  YPNAKVIL+ R T SW+ES++ + +K       F R      G+ +  +M + +F R F  + +L   E MA  +E  N+ +R+VVP ERLLEF V  GW PLC FL +  +PD+PFP +N  K
Sbjct:    8 LVVIGAGAPRTGTVSQKVALELLLGQPCYHMGEALGPHNSRRHIPMWIQAVESG-LSKSLADEILGNYAACVDYPTASFYKELMQHYPNAKVILSVRDTSSWVESMQSSILKAMHTMERFPRPLKWLLGIGQADKMIDAVFRREFGDNYNLADSEFMARRFEERNDSIRRVVPSERLLEFRVSDGWAPLCQFLNL-PVPDKPFPRLNDRK 215          
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Nematostella
Match: EDO49231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU4])

HSP 1 Score: 93.2041 bits (230), Expect = 3.101e-22
Identity = 72/208 (34.62%), Postives = 102/208 (49.04%), Query Frame = 1
Query:  223 VIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVK-QTTMKKDFFY-LIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEEN--MAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNT 834
            VI AG  +T T S+  AL R+ G   Y +   + +  D    WL+ +  G L    A  +F    +  D P + F+++++   P+AKVILT R  ++W+ S K Q  M +  F  L FL LS I+ G+ K           V  L   +  E    +A A E +N+ VR  VP  +LLE+ V  GW PLC FLG    P E FP+ N 
Sbjct:    3 VICAGICKTATKSMAKAL-RILGYNVYDVEEQICELFDD---WLDLIEHGRLPDFEA--MFENVDAITDLPGNFFFEEILKASPDAKVILTVREQEAWLRSSKKQLKMVQGLFSKLWFLSLSPIYLGIRKITN------GMVAALYGTINAESTWIIAKALEMHNQRVRSTVPPGQLLEYSVTEGWGPLCDFLG-HATPKEKFPHENV 197          
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Nematostella
Match: EDO41210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4T7])

HSP 1 Score: 88.9669 bits (219), Expect = 1.717e-20
Identity = 76/223 (34.08%), Postives = 106/223 (47.53%), Query Frame = 1
Query:  196 QTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDH-KDHIECWLNALNRGYLDKETADF--LFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTR-STKSWIESV--KQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAI----AYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNT 834
            + E K  + VI AG  +TGT SL  AL R+ G K Y      ++H   H+E W+ A     +     D   ++    +  D P   +Y++L   +P AKVIL+ R +T  W ES+   Q  +K+     + L   +   G  K   M   M    F       T  N AI    AY  +NE V+ V+PK++LL F+V  GW PLC FL I E P+  FPY N 
Sbjct:   16 KEEKKCVMKVICAGMPKTGTKSLAKAL-RILGLKVYD----ADEHCIYHMEEWIQAFETSKM----PDLYRMYKDVDAVTDVPPMFWYEELHYAFPEAKVILSVRDNTDVWYESLLWNQKVLKEAMSLRVMLGFLLTPTGW-KMSRMMSDMMNAAFK-----STNPNAAILNKKAYREHNERVKNVIPKDKLLVFKVEQGWPPLCRFLEIAE-PEIFFPYENV 222          
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Nematostella
Match: EDO48575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIV5])

HSP 1 Score: 86.6557 bits (213), Expect = 5.654e-20
Identity = 61/206 (29.61%), Postives = 104/206 (50.49%), Query Frame = 1
Query:  223 VIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADF--LFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNT 834
            +IGAG  +TGT SL  AL         H+   V+DH++  +   +     + + +  +F  ++    +  D P+  FY+++   +P AKVIL+ R  +   ES +++ MK + F   F +   I  G+   L    + + R+ H   +L+   N  + Y  +N++V   +P ++LL F  + GWEPLC FLG  E+P  P+P  N 
Sbjct:    3 IIGAGLSKTGTKSLASALR--------HLGYNVHDHQEQAQFHCDEYIAAF-EGQMPNFEEMYANVDATTDAPACFFYKEIFRAFPYAKVILSVRDDE---ESWRRSLMKTNNFTSSFFKNPFIILGM--ILTPSGRKYSRLGH---NLKMYLNNELDYTKHNDDVLANIPAKQLLVFNPKDGWEPLCAFLG-AEVPAIPYPRENV 190          
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Nematostella
Match: EDO38503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW7])

HSP 1 Score: 85.5001 bits (210), Expect = 1.570e-19
Identity = 66/207 (31.88%), Postives = 105/207 (50.72%), Query Frame = 1
Query:  226 IGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTR-STKSWIESVKQTTMKKDFFYLIF----LRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMN 831
            I AG  +TGT SL  AL  L     Y +  +  + + H++ W+ A  +G     TA  ++    +AID P   F +D++   P  KVILT R + + W+ S+ ++    D ++ ++    L+L+ +     +      K    + H +  L+T     + Y  + EEV+ +VP +RLL F V+ GWEPLC FLG  E P  PFP+ N
Sbjct:    4 ICAGLSKTGTKSLVAALRYL----GYTVYDIEENWRYHMDEWIKAF-QGTNPDFTA--MYASVDTAIDLPPYLFVRDILVALPELKVILTVRENAEEWLTSLTRSL---DIWWSVYNQRWLKLARVLTPTGR------KWATLIRHQTAALKT-----LDYTRHIEEVKAIVPADRLLVFNVKEGWEPLCAFLG-HEAPSIPFPHRN 188          
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Nematostella
Match: EDO38865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBL0])

HSP 1 Score: 85.8853 bits (211), Expect = 1.078e-18
Identity = 61/205 (29.76%), Postives = 100/205 (48.78%), Query Frame = 1
Query:  223 VIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADF--LFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMN 831
            VIGAG  +TGT SL  AL         H+   V+D ++H   + +  N  + +    DF  ++    +  D P+  FY+++ N +P++KVIL+ R  +   E+ K++ +K D      L   ++  G         K    V  +   L+ E    + Y  +N++V   +P  +LL F  R GW PLC FL + ++PD PFP +N
Sbjct:    3 VIGAGLPKTGTKSLAAALR--------HLGCTVHDVEEHWRFYCDEYNAAF-EGNIPDFKKMYKDVDATTDSPACYFYKEIFNAFPDSKVILSVRENE---ETWKKSLIKTDEIMWSVLESPVVKLGQ-HVTPTGRKCIRLVQRVGIHLQNE----VDYRKHNDDVIASIPANQLLVFNPREGWGPLCAFLEV-KVPDIPFPQIN 189          

HSP 2 Score: 82.0333 bits (201), Expect = 2.171e-17
Identity = 62/209 (29.67%), Postives = 104/209 (49.76%), Query Frame = 1
Query:  223 VIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADF--LFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTK-SWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERV-FHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTA 837
            VIGAG  +TGT SL  AL         H+   V+D ++H   + +  N  + +    DF  ++    +  D P+  FY+++   +P++KVIL+ R  + +W +S+ +T    D   L    + +  +  P   E   ++ +RV  HL  +        + Y  +N++V   +P  +LL F  R GW PLC FL + E+PD PFP +N +
Sbjct:  194 VIGAGLPKTGTKSLAAALR--------HLGCTVHDVEEHWRYYSDKYNAAF-EGNIPDFKKMYKDVDATTDSPACFFYKEIFEAFPDSKVILSVRENEETWQKSLLKTKEVIDSV-LDSPVIKLCQHVTPTGREWS-RLVQRVGIHLQNE--------VDYRKHNDDVIASIPTNQLLVFNPREGWVPLCAFLEV-EVPDIPFPQINVS 382          
BLAST of Cell wall integrity and stress response component 1 vs. Planmine SMEST
Match: SMESG000035060.1 (SMESG000035060.1)

HSP 1 Score: 490.345 bits (1261), Expect = 6.182e-177
Identity = 248/248 (100.00%), Postives = 248/248 (100.00%), Query Frame = 1
Query:  184 MSVLQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAKXXXXXXXXXXIRVLSKPGALVLFALAMLI 927
            MSVLQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAKEFRERQRQRFIRVLSKPGALVLFALAMLI
Sbjct:    1 MSVLQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAKEFRERQRQRFIRVLSKPGALVLFALAMLI 248          
BLAST of Cell wall integrity and stress response component 1 vs. Planmine SMEST
Match: SMESG000035068.1 (SMESG000035068.1)

HSP 1 Score: 239.965 bits (611), Expect = 1.436e-78
Identity = 110/216 (50.93%), Postives = 154/216 (71.30%), Query Frame = 1
Query:  193 LQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAK 840
            ++ EN  +LLVIG GQMRTGT+SLK ALERL+  KCYHM+ L+N+H+DH++ W+NA++   +DKET+D +F  Y +  DYP + FY+DLI IYPN KVILTTR+++ W+ SV+ T M +      F+   ++   +P+F E+  KM    F   K+L  +E +  AYETYNE+VR  +PKERLLEF+V  GW+PLC FL I+EIP+E FP++N+ K
Sbjct:    1 MKNENH-QLLVIGVGQMRTGTYSLKLALERLFDKKCYHMIELINNHQDHVDLWINAIDNRSIDKETSDRIFCNYFATTDYPGAIFYKDLIQIYPNVKVILTTRNSEDWLTSVRNTIMPRVHANGSFISHPILVKKMPRFEELHIKMIRHAFQPFKELENDEILKRAYETYNEKVRSSIPKERLLEFKVNDGWKPLCRFLDIKEIPNEEFPFVNSTK 215          
BLAST of Cell wall integrity and stress response component 1 vs. Planmine SMEST
Match: SMESG000035037.1 (SMESG000035037.1)

HSP 1 Score: 224.172 bits (570), Expect = 4.535e-72
Identity = 111/245 (45.31%), Postives = 170/245 (69.39%), Query Frame = 1
Query:  208 KTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKD-LRTEEN-MAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAKXXXXXXXXXXIRVLSKPG---ALVLFALAMLI 927
            K E+LVIGAGQMRTGTFSLK+ALE+LY   CYHM  ++N HKDH++ W++  + G ++++TA  +F+ Y + +D+PS+A Y+DL+ IYPNAKV+LTTR++  W++SVK TT++ +       ++   FN   +F  M +KMF + +    D LRT++  +   YE +NEEVRK VPKERLLEF  + GWEPLC FL + ++P+EP+P++NT K+F+   R   ++ + + G   +L +  L+++I
Sbjct:    5 KNEILVIGAGQMRTGTFSLKFALEKLYNCPCYHMAEILNHHKDHVKLWISVFDSGKMNEKTAGKIFSDYSATVDFPSAAVYKDLMEIYPNAKVVLTTRNSDDWVKSVKSTTLRNNMKTSFVHKILFYFNLGTEFPVMLDKMFLKAYKEPFDALRTDDELLKQCYEDFNEEVRKYVPKERLLEFNAKEGWEPLCRFLNL-QVPNEPYPFVNTTKDFQRNVRGMMLKSVIRSGLVLSLTIGCLSLII 248          
BLAST of Cell wall integrity and stress response component 1 vs. Planmine SMEST
Match: SMESG000035040.1 (SMESG000035040.1)

HSP 1 Score: 223.787 bits (569), Expect = 7.333e-72
Identity = 103/211 (48.82%), Postives = 148/211 (70.14%), Query Frame = 1
Query:  214 ELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKDLRTEENMAI--AYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAK 840
            EL VIGAGQMRTGT SLK ALE+LY GKCYHM  +  +H++HI  W++  ++  LDK TA+ L + YC+ +D+PS+A Y+DL+ +YPNAKVILTTR++  W++SV+ TT+KK        ++  +F+GL +F E  EK+    +  S +    ++  +   YE +N+EVR+ VPKERLLEF  + GWEPLCTFL +  IPDEP+P++N+ +
Sbjct:    7 ELSVIGAGQMRTGTKSLKMALEKLYNGKCYHMAEIFENHRNHISLWISVFDKNGLDKSTAESLLSDYCATVDFPSTAVYKDLMKLYPNAKVILTTRNSDDWLKSVRNTTLKKGSDVTFLSKIFFMFSGLGRFPEFSEKLINHAYKNSYETLINDDAILKQCYEDFNQEVRETVPKERLLEFNSKQGWEPLCTFLNL-PIPDEPYPFVNSTE 216          
BLAST of Cell wall integrity and stress response component 1 vs. Planmine SMEST
Match: SMESG000035036.1 (SMESG000035036.1)

HSP 1 Score: 221.476 bits (563), Expect = 5.911e-71
Identity = 108/241 (44.81%), Postives = 165/241 (68.46%), Query Frame = 1
Query:  208 KTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHKDHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAKVILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMFERVFHLSKD-LRTEEN-MAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCTFLGIEEIPDEPFPYMNTAKXXXXXXXXXXIRVLSKPGALVLFALAML 924
            K ELLVIGAGQMRTGTFSLK+ALE+LY   CYHM  ++N HKDH++ W++  + G ++++TA  +F+ Y + +D+PS+A Y+DL+ IYPNAKV+LTTR++  W++SVK TT++ +       ++   FN   +F  M +KM+ + +    D LRT++  +   YE +NEEVRK VP+ERLLEF  + GWEPLC FL +  +P+EP+P++NT K+F+   R   ++ + + G ++   +  L
Sbjct:    5 KNELLVIGAGQMRTGTFSLKFALEKLYNCPCYHMAEILNHHKDHVKLWISVFDSGKMNEKTAGKIFSDYSATVDFPSAAVYKDLMEIYPNAKVVLTTRNSDDWVKSVKSTTLRNNMKTSFVHKILFYFNLGTEFPVMLDKMYLKAYKEPFDALRTDDELLKQCYEDFNEEVRKYVPRERLLEFNAKEGWEPLCRFLNL-PVPNEPYPFVNTTKDFQLTIRGMMLKSVIRSGLVLSLTIGCL 244          
The following BLAST results are available for this feature:
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4L81.657e-6744.90Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A267EUL98.831e-5041.52Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FWT02.032e-4941.52Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EKC22.121e-4942.22Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8I1955.908e-4943.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492313.101e-2234.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412101.717e-2034.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485755.654e-2029.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385031.570e-1931.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388651.078e-1829.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell wall integrity and stress response component 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035060.16.182e-177100.00SMESG000035060.1[more]
SMESG000035068.11.436e-7850.93SMESG000035068.1[more]
SMESG000035037.14.535e-7245.31SMESG000035037.1[more]
SMESG000035040.17.333e-7248.82SMESG000035040.1[more]
SMESG000035036.15.911e-7144.81SMESG000035036.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000749 ID=SMED30000749|Name=Cell wall integrity and stress response component 1|organism=Schmidtea mediterranea sexual|type=transcript|length=998bp
TTATTATTATTATTATTATATCATTTATCTTGACTCAATTGACAAAATTT
TAATCTTGCTTAAACATCTAGTGTTTAGCATAATGATAAGAGTAACGTAC
ACGTTTTAATAAAATGTGAGTTAGTGTAGTGTGACTTTCTATAAATTTTA
TATATTTATATTAGTGAATTAGTATGTGAAAAGATGAGCGTACTGCAAAC
GGAAAACAAAACTGAATTGCTGGTAATTGGTGCAGGCCAAATGAGAACCG
GCACTTTTTCTCTGAAATATGCTCTTGAGAGATTATACGGTGGGAAATGT
TACCATATGCTTGCACTAGTAAACGACCATAAAGATCATATAGAATGTTG
GCTGAATGCTTTGAATCGTGGCTATTTAGATAAAGAAACGGCTGACTTTC
TATTCAACGGCTACTGTTCCGCTATTGACTATCCCTCCTCAGCTTTCTAT
CAAGATCTGATAAACATATATCCCAACGCCAAAGTCATATTAACTACAAG
AAGTACCAAAAGTTGGATAGAAAGTGTAAAACAAACAACAATGAAAAAGG
ATTTTTTCTATCTAATCTTTCTCAGATTGTCTATGATATTCAACGGATTG
CCGAAGTTTTTGGAAATGAAGGAGAAAATGTTTGAACGAGTGTTTCATTT
GTCGAAAGATCTACGAACAGAAGAAAACATGGCGATTGCATATGAAACTT
ATAATGAAGAAGTGAGGAAAGTTGTTCCAAAAGAAAGACTATTAGAATTC
GAAGTAAGATCGGGTTGGGAACCACTTTGTACATTTCTAGGAATAGAGGA
GATTCCCGATGAACCGTTTCCTTATATGAATACGGCAAAAGAATTTCGAG
AAAGACAACGACAAAGATTTATCAGAGTTTTATCTAAACCTGGAGCACTT
GTTTTATTTGCGTTGGCAATGTTAATTTTAACATTATATGGAAATTATTA
ATTCTACGGTTTATTATTAATTAAAATAATAATAAATTAAATTTGTTT
back to top

protein sequence of SMED30000749-orf-1

>SMED30000749-orf-1 ID=SMED30000749-orf-1|Name=SMED30000749-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=256bp
MSVLQTENKTELLVIGAGQMRTGTFSLKYALERLYGGKCYHMLALVNDHK
DHIECWLNALNRGYLDKETADFLFNGYCSAIDYPSSAFYQDLINIYPNAK
VILTTRSTKSWIESVKQTTMKKDFFYLIFLRLSMIFNGLPKFLEMKEKMF
ERVFHLSKDLRTEENMAIAYETYNEEVRKVVPKERLLEFEVRSGWEPLCT
FLGIEEIPDEPFPYMNTAKEFRERQRQRFIRVLSKPGALVLFALAMLILT
LYGNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040632Sulfotransfer_4
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 4..235
e-value: 1.3E-64
score: 220.3
NoneNo IPR availablePANTHERPTHR36978FAMILY NOT NAMEDcoord: 7..230
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
IPR040632Sulfotransferase, S. mansonii-typePFAMPF17784Sulfotransfer_4coord: 14..221
e-value: 2.0E-60
score: 204.3
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 13..228