Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30000735
Length (bp)669
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30000735) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30000735) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30000735) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30000735) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000735

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000735h1SMcG0008726 Contig59uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30000735h1SMcG0008726 Contig59newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30000735h1SMcG0008726 Contig59uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30000735h1SMcG0008726 Contig59newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000735h1SMcG0008726 Contig59uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000735h1SMcG0008726 Contig59newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30000735h1SMcG0011163 Contig59uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30000735h1SMcG0011163 Contig59newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30000735h1SMcG0011163 Contig59uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30000735h1SMcG0011163 Contig59newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000735h1SMcG0011163 Contig59uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000735h1SMcG0011163 Contig59newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
tail regionSMED30000735h1SMcG0008726 SmedASXL_018196SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30000735h1SMcG0008726 SmedASXL_079221SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30000735h1SMcG0008726 dd_Smed_v4_4314_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000735h1SMcG0008726 dd_Smed_v4_4314_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30000735h1SMcG0008726 dd_Smed_v6_4314_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30000735h1SMcG0008726 dd_Smed_v6_4314_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000735h1SMcG0008726 HO005517smed_ncbi_20240424PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30000735h1SMcG0008726 HO005517smed_ncbi_20240424PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 122.865 bits (307), Expect = 6.166e-34
Identity = 65/174 (37.36%), Postives = 96/174 (55.17%), Query Frame = 3
Query:  138 DALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKY---GDFEWVGQNVAKFAGKKID--RGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKC-SIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTE 641
            D  +  HN +R  V        P A +MK+M+W K  A  A+ +A++C F H+   D+ Y     FE+VG+N+     K       +  WYNE   + F++ +CS + CGHYTQLVWANS  VGC ++ C ++ G   ++ VCNYGP GN+    PY  G++CS C   + C +
Sbjct:   35 DNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS-RVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVK 200          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 122.865 bits (307), Expect = 7.385e-34
Identity = 65/174 (37.36%), Postives = 96/174 (55.17%), Query Frame = 3
Query:  138 DALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKY---GDFEWVGQNVAKFAGKKID--RGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKC-SIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTE 641
            D  +  HN +R  V        P A +MK+M+W K  A  A+ +A++C F H+   D+ Y     FE+VG+N+     K       +  WYNE   + F++ +CS + CGHYTQLVWANS  VGC ++ C ++ G   ++ VCNYGP GN+    PY  G++CS C   + C +
Sbjct:   35 DNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS-RVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVK 200          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 124.02 bits (310), Expect = 1.541e-32
Identity = 63/181 (34.81%), Postives = 99/181 (54.70%), Query Frame = 3
Query:  114 GDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFA--GKKIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCS----IDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC 635
            G L++++K  ++  HN YR  V        PTA++M HM W +E A+ A+ YA +C++ H+    R+       G+N+      G  +   +E W++E   +    + CS  + CGHYTQ+VWA +  +GCG   C     ++  ++ LLVCNY P GN  G++PY+ G  CS+C SG  C
Sbjct:   26 GALTDEEKRLMVELHNLYRAQV-------SPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHC 192          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 124.02 bits (310), Expect = 1.541e-32
Identity = 63/181 (34.81%), Postives = 99/181 (54.70%), Query Frame = 3
Query:  114 GDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFA--GKKIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCS----IDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC 635
            G L++++K  ++  HN YR  V        PTA++M HM W +E A+ A+ YA +C++ H+    R+       G+N+      G  +   +E W++E   +    + CS  + CGHYTQ+VWA +  +GCG   C     ++  ++ LLVCNY P GN  G++PY+ G  CS+C SG  C
Sbjct:   26 GALTDEEKRLMVELHNLYRAQV-------SPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHC 192          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 124.02 bits (310), Expect = 1.541e-32
Identity = 63/181 (34.81%), Postives = 99/181 (54.70%), Query Frame = 3
Query:  114 GDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFA--GKKIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCS----IDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC 635
            G L++++K  ++  HN YR  V        PTA++M HM W +E A+ A+ YA +C++ H+    R+       G+N+      G  +   +E W++E   +    + CS  + CGHYTQ+VWA +  +GCG   C     ++  ++ LLVCNY P GN  G++PY+ G  CS+C SG  C
Sbjct:   26 GALTDEEKRLMVELHNLYRAQV-------SPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHC 192          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 99.3673 bits (246), Expect = 1.220e-25
Identity = 63/210 (30.00%), Postives = 99/210 (47.14%), Query Frame = 3
Query:   75 IQITPIVVLEFCSG--DLSNDDKDALLRFHNNYRRDVVYGSVTG----QPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEW-----VGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKT----CGHYTQLVWANSTEVGCGLSKCSIDGIDLS-LLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC-TEYGLC 653
             ++  +++  FC    + S   K+ +L  HN  R  +  G        +P+A+NM  ++W     + AQ Y+  C   H         +  W     V Q  A+  G   +R   LW +E   F +  +  + +      GH TQ+ WA + ++GCG+SKCS D      ++VC Y P GNY+G   YK+G+TCS C  G +C +  GLC
Sbjct:    5 FRLICLLIFSFCETLCEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRANIGENMYWWTSPVVTQTDAELLG---NRSANLWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNCESSTGLC 211          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 94.7449 bits (234), Expect = 6.455e-24
Identity = 63/214 (29.44%), Postives = 99/214 (46.26%), Query Frame = 3
Query:   75 IQITPIVVLEFCSG---DLSNDDKDALLRFHNNYRRDVVYGSV----TGQPTATNMKHMVWSKESASKAQIYADKCIFAHDT---IDDRKYGDFEWVGQNVAKFAGKKIDR----GLELWYNEASGFTFENSACSLKT----CGHYTQLVWANSTEVGCGLSKCSID--GIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC-TEYGLC 653
            +  + +++   C+G     S + + A+L  HN  R  +  G+     T +P A++M  M W    A+ AQ YA+KC   H     + +  Y  + W    +       ID+    G   W  E   + + ++  S+       GH TQ+ WA +  +GCG+  C  D  G +   +VC Y P GNY+ +  Y +G TCS+C SG SC    GLC
Sbjct:    1 MHTSILLLTALCAGAYAQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAGLGENLY--WYWTSATI-----TNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLC 207          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 89.3521 bits (220), Expect = 9.483e-22
Identity = 57/208 (27.40%), Postives = 100/208 (48.08%), Query Frame = 3
Query:   90 IVVLEFCSG---DLSNDDKDALLRFHNNYRRDVVYGSVTGQPT----ATNMKHMVWSKESASKAQIYADKCIFAHDT---IDDRKYGDFEWVG---QNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKT----CGHYTQLVWANSTEVGCGLSKCSID--GIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC-TEYGLC 653
            +++   C+G     + + + A+L  HN  R  +  G+   + T    A++M  M W +  A+ +QIYA++C   H     + +  Y  + W      N+ +F           W  E   + + ++  ++       GH TQ+ WA +  +GCG+  C +D  G++   +VC+Y P GNY+ +  Y +G TCS+C +G SC    GLC
Sbjct:    6 LLLTVLCAGAYTQFTANGQAAILNVHNTLRSRIAKGTYVARGTVKHAASDMLKMKWLRSLATSSQIYANRCPTGHSNMIGVGENLY--WYWTSGTITNIDQFGA----MASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSCEAATGLC 207          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 84.3445 bits (207), Expect = 6.315e-20
Identity = 59/203 (29.06%), Postives = 93/203 (45.81%), Query Frame = 3
Query:   90 IVVLEF-CSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPT----ATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGD---FEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKT----CGHYTQLVWANSTEVGCGLSKCSID--GIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC-TEYGLC 653
            +V L   CS D  +  ++ ++  HN  R  +  G+   + T     TN+  M W    A+ AQ YA+ C   H    D   G+   + W   ++     +        W  E   + ++++  ++       GH TQ+ WA S  +GCG+  C  D  G++   +VC Y P GN++ +  Y +G TCS C SG SC T  GLC
Sbjct:    7 VVALAVGCSADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHS--GDAGLGENLYWYWTSGSLGDL-NQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTGLC 206          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 84.3445 bits (207), Expect = 6.315e-20
Identity = 59/203 (29.06%), Postives = 93/203 (45.81%), Query Frame = 3
Query:   90 IVVLEF-CSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPT----ATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGD---FEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKT----CGHYTQLVWANSTEVGCGLSKCSID--GIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC-TEYGLC 653
            +V L   CS D  +  ++ ++  HN  R  +  G+   + T     TN+  M W    A+ AQ YA+ C   H    D   G+   + W   ++     +        W  E   + ++++  ++       GH TQ+ WA S  +GCG+  C  D  G++   +VC Y P GN++ +  Y +G TCS C SG SC T  GLC
Sbjct:    7 VVALAVGCSADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHS--GDAGLGENLYWYWTSGSLGDL-NQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTGLC 206          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 117.087 bits (292), Expect = 9.724e-31
Identity = 74/187 (39.57%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKF---AGKKIDRG-----LELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGK-TCSECKSGQSCTEYGLC 653
            ++ +++  +L+ HN  R+ V  G   GQP A NM+ +VW  E A++AQ +AD C F HD    R    F  +GQN+A     A    D G     ++ W+NE   ++F + A S KT GHY+QLVW  ++ VGCG ++         L VCNYGPGGN VG  PY+ GK +CS      S    GLC
Sbjct:   32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHD--PHRTINRFT-MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGD-AWSPKT-GHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLC 213          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 80.4925 bits (197), Expect = 4.574e-18
Identity = 56/195 (28.72%), Postives = 88/195 (45.13%), Query Frame = 3
Query:  108 CSGDLSNDDK--DALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLEL------WYNE----ASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCS-IDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            CSG+    D     +L+ HN  R  +  G V+G P+A  M  M W    A  A   A +C  AHD  + R    + + GQN++    + +D  + L      W++E     SG   +         GH+T +V   +  VGC +++ +  + +  +LL CNY    N V    Y+AG   SEC +G++     LC
Sbjct:   50 CSGEFVQVDAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHD--ECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAV-TNVVNNPVYRAGTAASECTTGRNSNYPNLC 241          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 66.6254 bits (161), Expect = 5.441e-13
Identity = 58/193 (30.05%), Postives = 85/193 (44.04%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKF-------AGKKIDRGLELWYNEA-----SGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLS--LLVCNYGPGGNYVGEKPYKA-GKTCSECKSGQSCTEYGLC 653
            LS+ +KDAL+   N YR  +  G       A  M  + W+ E A  A +    C   HD   +     F+W GQN+A             ++ G+++WY+EA     +      S  +    GH+T LV   +TEVGC  +  S+ G      LL CNY    N +G K Y +  K  S+C +G +     LC
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYA-ATNVLGIKMYSSCSKAASKCTTGTNPKYKYLC 243          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0073937)

HSP 1 Score: 66.6254 bits (161), Expect = 5.441e-13
Identity = 58/193 (30.05%), Postives = 85/193 (44.04%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKF-------AGKKIDRGLELWYNEA-----SGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLS--LLVCNYGPGGNYVGEKPYKA-GKTCSECKSGQSCTEYGLC 653
            LS+ +KDAL+   N YR  +  G       A  M  + W+ E A  A +    C   HD   +     F+W GQN+A             ++ G+++WY+EA     +      S  +    GH+T LV   +TEVGC  +  S+ G      LL CNY    N +G K Y +  K  S+C +G +     LC
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYA-ATNVLGIKMYSSCSKAASKCTTGTNPKYKYLC 243          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0305582)

HSP 1 Score: 66.6254 bits (161), Expect = 5.441e-13
Identity = 58/193 (30.05%), Postives = 85/193 (44.04%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKF-------AGKKIDRGLELWYNEA-----SGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLS--LLVCNYGPGGNYVGEKPYKA-GKTCSECKSGQSCTEYGLC 653
            LS+ +KDAL+   N YR  +  G       A  M  + W+ E A  A +    C   HD   +     F+W GQN+A             ++ G+++WY+EA     +      S  +    GH+T LV   +TEVGC  +  S+ G      LL CNY    N +G K Y +  K  S+C +G +     LC
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYA-ATNVLGIKMYSSCSKAASKCTTGTNPKYKYLC 243          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 122.094 bits (305), Expect = 1.043e-33
Identity = 71/184 (38.59%), Postives = 100/184 (54.35%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG--KKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCTE 641
            +S  D  ALL +HN  R  V        P A NM++MVW +  A  A+ +A +CI+ H       +   + +GQN++  +G  K I   ++ WY+E   F++  S CS   C HYTQ+VWA S ++GC + KCS   +        +LLVCNY   GN+VGE PYK G+ CS C S  G SC +
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGP-----HHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYP-SRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNK 231          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 122.094 bits (305), Expect = 1.043e-33
Identity = 71/184 (38.59%), Postives = 100/184 (54.35%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG--KKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCTE 641
            +S  D  ALL +HN  R  V        P A NM++MVW +  A  A+ +A +CI+ H       +   + +GQN++  +G  K I   ++ WY+E   F++  S CS   C HYTQ+VWA S ++GC + KCS   +        +LLVCNY   GN+VGE PYK G+ CS C S  G SC +
Sbjct:   61 ISGKDMTALLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGP-----HHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYP-SRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNK 231          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 109.383 bits (272), Expect = 1.143e-28
Identity = 66/192 (34.38%), Postives = 99/192 (51.56%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK--KIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCT 638
            +S +D  A+L +HN  R  V        P A+NM++MVW    A  A+ +A  CI+ H   +  ++     +GQN++   G+   I + ++ W++E   ++F      N  C LK     C HYTQ+VWA S +VGC ++ C    +        + LVCNY P GN++GE PYK G  CS C    G SC+
Sbjct:   64 ISQNDMLAILDYHNKVRGKVF-------PPASNMEYMVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCS 243          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 107.457 bits (267), Expect = 3.543e-28
Identity = 64/192 (33.33%), Postives = 96/192 (50.00%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG--KKIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCT 638
            +S  D  A+L +HN  R +V        P A NM++M+W    A  A+ +A  CI+ H      +Y     +GQN++   G  + I + ++ WY+E   + F      N  C ++     C HYTQ+VWA+S  VGC +  C    +      + + LVCNY P GN++GE PY+ G  CS C    G SC+
Sbjct:   46 ISQSDMIAILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCS 225          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 107.842 bits (268), Expect = 3.974e-28
Identity = 64/192 (33.33%), Postives = 96/192 (50.00%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG--KKIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCT 638
            +S  D  A+L +HN  R +V        P A NM++M+W    A  A+ +A  CI+ H      +Y     +GQN++   G  + I + ++ WY+E   + F      N  C ++     C HYTQ+VWA+S  VGC +  C    +      + + LVCNY P GN++GE PY+ G  CS C    G SC+
Sbjct:   61 ISQSDMIAILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCS 240          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 4.151e-31
Identity = 66/179 (36.87%), Postives = 99/179 (55.31%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKID--RGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCS-IDGID---LSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSC 635
            L+ ++K  +L  HN YR          +P+A++M  + W     + A+ YA+KCI+ H+   DR +     +G+N+   +G  +D   GL+ W+ E   + F    C   + CGHYTQ+VWA +  VGCG + C  ++G+D   + LLVCNY P GN+ GE PYK G  C+EC S   C
Sbjct:   30 LNYEEKRIILDKHNFYRSQT-------EPSASDMIKLTWDSALEAMAKSYAEKCIWEHN--KDRGF-----IGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVC 194          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 106.301 bits (264), Expect = 2.052e-27
Identity = 63/184 (34.24%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK--KIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECK 620
            +S  D  ALL +HN  R  V        P A NM++MVW +  A  A+ +A++C + H      +Y     +GQN++  +G+   I   ++ WY+E   ++F      N +C  K     C HYTQ+VWA+S  +GC ++ C+   +        S LVCNY   GN++GE PYK G+ CS C 
Sbjct:   58 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACP 229          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 105.916 bits (263), Expect = 2.253e-27
Identity = 63/184 (34.24%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK--KIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECK 620
            +S  D  ALL +HN  R  V        P A NM++MVW +  A  A+ +A++C + H      +Y     +GQN++  +G+   I   ++ WY+E   ++F      N +C  K     C HYTQ+VWA+S  +GC ++ C+   +        S LVCNY   GN++GE PYK G+ CS C 
Sbjct:   53 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACP 224          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: pi15 (peptidase inhibitor 15 [Source:NCBI gene;Acc:100489915])

HSP 1 Score: 105.145 bits (261), Expect = 5.467e-27
Identity = 64/193 (33.16%), Postives = 94/193 (48.70%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG--KKIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCTE 641
            +S +D  A++ +HN  R  V        P A NM++MVW +  A  A+ +A  CI+ H      K+     +GQN++   G  K I + ++ WY+E   + F      N  C L+     C HYTQ+VWA +  +GC +  C    +          LVCNY P GN++GE PY  G  CS C    G SC++
Sbjct:   62 ISQNDMIAIVEYHNQVRGKVF-------PPAANMEYMVWDENLAKLAEAWAATCIWDHGPSYLLKF-----LGQNLSVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACPPSYGGSCSD 242          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 108.227 bits (269), Expect = 7.838e-27
Identity = 60/179 (33.52%), Postives = 91/179 (50.84%), Query Frame = 3
Query:  132 DKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRG--LELWYNEASGFTFE---------NSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSEC 617
            DK+ +++ HN  R  V        P+A+NM++M W  E    A+ +A++CI+ H             +GQN+A   G+       ++ WY+E   +T+             CS   C HYTQ+VWA +T+VGC ++ C    +      +   LVCNY P GN++GE PYK G+ CSEC
Sbjct:   56 DKEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGPT-----ALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSEC 222          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 124.02 bits (310), Expect = 1.634e-34
Identity = 65/178 (36.52%), Postives = 99/178 (55.62%), Query Frame = 3
Query:  138 DALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYG---DFEWVGQNV--AKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKC-SIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            DA L  HN  RR V       QP A +M  + W ++ A  A+ +  +C  AH+    ++Y    D++++G+N+   +   +  D  +  WYNE+  F F+ + CS + CGHYTQ+VWA + ++GC +S C ++ G    L VCNY P GN++G +PY  G +CS C  GQ   E  LC
Sbjct:   43 DAFLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVIN-WYNESKYFNFDFNTCS-EMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMC--GQKTCENSLC 209          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 118.627 bits (296), Expect = 3.764e-32
Identity = 65/189 (34.39%), Postives = 98/189 (51.85%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLEL--WYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCS----IDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN*LK 665
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+    R+       G+N+     + +D  L +  W+ E   + F  + C   + CGHYTQ+VW+ +  +GCG   C     ++  ++ LLVCNY P GN  G KPY+ G  CS+C  G SC E  LC  ++
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSC-ENSLCEPMR 203          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 118.627 bits (296), Expect = 3.764e-32
Identity = 65/189 (34.39%), Postives = 98/189 (51.85%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLEL--WYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCS----IDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN*LK 665
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+    R+       G+N+     + +D  L +  W+ E   + F  + C   + CGHYTQ+VW+ +  +GCG   C     ++  ++ LLVCNY P GN  G KPY+ G  CS+C  G SC E  LC  ++
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSC-ENSLCEPMR 203          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 117.472 bits (293), Expect = 5.635e-32
Identity = 65/185 (35.14%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLEL--WYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCS----IDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+    R+       G+N+     + +D  L +  W+ E   + F  + C   + CGHYTQ+VW+ +  +GCG   C     ++  ++ LLVCNY P GN  G KPY+ G  CS+C  G SC E  LC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSC-ENSLC 199          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 119.398 bits (298), Expect = 6.471e-31
Identity = 66/189 (34.92%), Postives = 100/189 (52.91%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLEL--WYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKC-SIDGID---LSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN*LK 665
            L+ D+K  ++  HN YR  V        P A++M  M W  E A+ A+ YA KC++ H+    R+       G+N+     + +D  L +  W+ E   + F  + C   + CGHYTQ+VW+ +  +GCG   C ++ G++   + LLVCNY P GN  G KPY+ G  CS+C  G SC E  LC  ++
Sbjct:   30 LTEDEKQTMVDLHNQYRAQV-------SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSC-ENSLCEPMR 203          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.693e-36
Identity = 71/183 (38.80%), Postives = 99/183 (54.10%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFA-GKKIDRGLELWYNEASGFT---FENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN 656
            L  + K  +L  HN  R+ V  G  +GQP+A NMK + W+ E A+ AQ  A+ C+F H     RK   + ++G+N+ K +    I R +  WY+E    T    ++ +      GHYTQ+VWAN+  +GCGL   S      S L C YGPGGNY  +  YK G   S+CK+G+S    GLCN
Sbjct:   31 LDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALGCGLVTASDRN---SYLFCQYGPGGNYRSQPIYKQGPPASDCKNGKSSKYPGLCN 210          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPU0|VA552_SCODE (Scoloptoxin SSD552 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.468e-35
Identity = 74/183 (40.44%), Postives = 98/183 (53.55%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFA-GKKIDRGLELWYNEASGFT---FENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN 656
            L  + K  +L  HN  R+ V  G  +GQP A NMK + W  E  + AQ  A+ C+F H     RK   + ++G+NV K      I R +  WY+E    T    ++ +      GHYTQ+VWAN+  +GCGL   S DG   S L C YGPGGNY G++ YK G   S CK+G+S    GLCN
Sbjct:   31 LDANMKKMILDLHNKKRQIVANGQQSGQPLAANMKELHWDDEIEAIAQRSAETCVFKHTAKSLRKSSKYSYLGENVYKGGYPDPIPRSVNKWYDEVKDVTPAVVKSFSDDGPMIGHYTQMVWANTEALGCGLVTAS-DGT--SYLFCQYGPGGNYPGQQIYKQGPPGSGCKNGKSSKYPGLCN 210          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPV2|VA558_SCODE (Scoloptoxin SSD558 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 4.840e-35
Identity = 70/183 (38.25%), Postives = 98/183 (53.55%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFA-GKKIDRGLELWYNEASGFT---FENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN 656
            L  + K  +L  HN  R+ V  G  +GQP+A NMK + W+ E A+ AQ  A+ C+F H     RK   + ++G+N+ K +    I R +  WY+E    T    ++ +      GHYTQ+VWAN+  + CGL   S      S L C YGPGGNY  +  YK G   S+CK+G+S    GLCN
Sbjct:   31 LDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALDCGLVTASDRN---SYLFCQYGPGGNYRSQPIYKQGPPASDCKNGKSSKYPGLCN 210          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q9DAG6|GPRL1_MOUSE (GLIPR1-like protein 1 OS=Mus musculus OX=10090 GN=Glipr1l1 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.143e-33
Identity = 65/178 (36.52%), Postives = 99/178 (55.62%), Query Frame = 3
Query:  138 DALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYG---DFEWVGQNV--AKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKC-SIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            DA L  HN  RR V       QP A +M  + W ++ A  A+ +  +C  AH+    ++Y    D++++G+N+   +   +  D  +  WYNE+  F F+ + CS + CGHYTQ+VWA + ++GC +S C ++ G    L VCNY P GN++G +PY  G +CS C  GQ   E  LC
Sbjct:   43 DAFLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVIN-WYNESKYFNFDFNTCS-EMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMC--GQKTCENSLC 209          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q6UWM5|GPRL1_HUMAN (GLIPR1-like protein 1 OS=Homo sapiens OX=9606 GN=GLIPR1L1 PE=1 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 3.546e-33
Identity = 65/174 (37.36%), Postives = 96/174 (55.17%), Query Frame = 3
Query:  138 DALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKY---GDFEWVGQNVAKFAGKKID--RGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKC-SIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTE 641
            D  +  HN +R  V        P A +MK+M+W K  A  A+ +A++C F H+   D+ Y     FE+VG+N+     K       +  WYNE   + F++ +CS + CGHYTQLVWANS  VGC ++ C ++ G   ++ VCNYGP GN+    PY  G++CS C   + C +
Sbjct:   35 DNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS-RVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVK 200          
BLAST of Venom allergen 5 vs. TrEMBL
Match: I1ZI85 (GLI pathogenesis related-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.512e-65
Identity = 95/132 (71.97%), Postives = 110/132 (83.33%), Query Frame = 3
Query:   90 IVVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANST 485
            +VVL+FCSGDLS  +K  LL  HN +R ++  G V+GQP ATNM+ MVW+ ESASKAQI ADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG+ I RG+ LWYN+ SGFTFENSACSLKTCGHYTQ+ + + T
Sbjct:    5 LVVLDFCSGDLSEKEKKLLLALHNGFRSNLAQGEVSGQPPATNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDISRGVTLWYNQVSGFTFENSACSLKTCGHYTQVPFLHFT 136          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A564YFQ7 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5585 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.493e-45
Identity = 74/159 (46.54%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  114 GDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPY 590
            G LS  DK  LL   N YRR+V  G V  QP ++ ++ + W+ E  + AQ +AD+C F HD+ DDRK  +F WVGQN+A      I + +++W+ E   + + ++ CS   CGHYTQLVWAN+T+VGCG+SKC+  G +   +VCNYGPGGN+  +KPY
Sbjct:   47 GRLS-KDKQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIA--YSSSIAQNVKMWFEEHKDYNYSHNYCS-GVCGHYTQLVWANTTDVGCGVSKCNFSGFNAVFVVCNYGPGGNFNNQKPY 201          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A5K3ENG8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.390e-43
Identity = 71/153 (46.41%), Postives = 101/153 (66.01%), Query Frame = 3
Query:  132 DKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPY 590
            +K  LL  HN YRR V  G +  QP+++ +  + WS E  + AQ +AD C FAHD+ D R+   ++WVGQN+A      I + +E+W++E   + ++++ CS   CGHYTQLVWAN+T VGCG+SKC+  G +   +VCNYGPGGNY G +PY
Sbjct:   56 EKSELLNLHNKYRRLVSDGQIREQPSSSKIHDLKWSTELEASAQRHADTCRFAHDSADARRTPQWDWVGQNIA--YSSSIAKNVEMWFDEYKEYNYQSNYCS-GVCGHYTQLVWANTTHVGCGVSKCNFRGFNAVYVVCNYGPGGNYNGRRPY 205          
BLAST of Venom allergen 5 vs. TrEMBL
Match: C1LE34 (GLIPR1-like protein 1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.972e-43
Identity = 71/153 (46.41%), Postives = 94/153 (61.44%), Query Frame = 3
Query:  135 KDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYK 593
            K  LL  HN+ R+ VV G + GQP A +M+ + W KE   KAQI AD C FAHD + +R    FE VGQN+A+     +D    LW NE+  F F + +C    C HYTQ+VW N+T +GCG++ C      LS +VCNYGPGGN +G+ PY+
Sbjct:    8 KVRLLTLHNDARKSVVEGKLMGQPMAISMEPLKWDKELERKAQILADNCSFAHDNVTNRSTSSFEHVGQNIAR--ADSVDIAFGLWLNESRNFNFSSQSCLKGQCKHYTQIVWENTTHIGCGVATCKNSPFTLS-IVCNYGPGGNLIGQVPYR 157          
BLAST of Venom allergen 5 vs. TrEMBL
Match: C1LN98 (GLIPR1-like protein 1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 4.985e-43
Identity = 72/169 (42.60%), Postives = 97/169 (57.40%), Query Frame = 3
Query:   90 IVVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKA 596
            ++V  +      N     LL  HNN R+ VVYG + GQP A ++K + W KE   KAQI AD C F HD + +R    F +VGQN+A      +D G  LW NE   + F N +C +  C HYTQ+V  N+T +GCG++ C      +S +VCNYGPGGN+  E PY+A
Sbjct:   17 LLVCTYVHARQDNKSPSRLLALHNNVRKSVVYGKLAGQPMAVSLKSLEWDKELERKAQILADNCSFTHDNVTNRSTSSFAYVGQNIA--GANNVDIGFGLWLNENIYYKFFNRSCLVGKCNHYTQIVSQNTTHIGCGVATCKNSPFKMS-IVCNYGPGGNHTSEFPYRA 182          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: r3hdml (R3H domain containing like [Source:NCBI gene;Acc:103046222])

HSP 1 Score: 120.939 bits (302), Expect = 2.658e-33
Identity = 68/184 (36.96%), Postives = 102/184 (55.43%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK--KIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCTE 641
            +S+ D  ALL +HN  R  V        P A NM++MVW +  A  A+ +A +CI+ H      KY     +GQN++  +G+   +   +  W++E + F++ N  C+   C HYTQ+VWA++  +GC +++CS   +        +LLVCNY   GN+VGE PYK GK CS C S  G SC +
Sbjct:   62 VSSRDMTALLEYHNRVRSQVF-------PPAANMEYMVWDERLAKSAESWASQCIWDHGPSHVMKY-----MGQNLSISSGRYRSVIELVRSWHDEKNSFSYPNR-CTGSVCSHYTQMVWASTNRIGCAINRCSNMYVFGSTWKQATLLVCNYSIKGNWVGEAPYKTGKPCSACPSVYGGSCNK 232          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 120.168 bits (300), Expect = 3.965e-33
Identity = 65/175 (37.14%), Postives = 103/175 (58.86%), Query Frame = 3
Query:  114 GDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK-KIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKC-SIDGI---DLSLLVCNYGPGGNYVGEKPYKAGKTCSECK 620
            G    +D+  ++  HN++R  V       +P A +M HM WS E A  A+ YA KCI+ H+  D +       +G+N+    G   I++ L  W+ E   ++++N+ C+  + CGHYTQ+VWA + EVGCG   C +++ +   + +LLVCNY P GNY+G+KPY+ G+ CS+C 
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNP-DSQNI-----MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCP 184          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 120.553 bits (301), Expect = 4.681e-33
Identity = 65/175 (37.14%), Postives = 103/175 (58.86%), Query Frame = 3
Query:  114 GDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK-KIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKC-SIDGI---DLSLLVCNYGPGGNYVGEKPYKAGKTCSECK 620
            G    +D+  ++  HN++R  V       +P A +M HM WS E A  A+ YA KCI+ H+  D +       +G+N+    G   I++ L  W+ E   ++++N+ C+  + CGHYTQ+VWA + EVGCG   C +++ +   + +LLVCNY P GNY+G+KPY+ G+ CS+C 
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNP-DSQNI-----MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCP 184          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 120.553 bits (301), Expect = 6.194e-33
Identity = 65/175 (37.14%), Postives = 103/175 (58.86%), Query Frame = 3
Query:  114 GDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK-KIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKC-SIDGI---DLSLLVCNYGPGGNYVGEKPYKAGKTCSECK 620
            G    +D+  ++  HN++R  V       +P A +M HM WS E A  A+ YA KCI+ H+  D +       +G+N+    G   I++ L  W+ E   ++++N+ C+  + CGHYTQ+VWA + EVGCG   C +++ +   + +LLVCNY P GNY+G+KPY+ G+ CS+C 
Sbjct:   23 GQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNP-DSQNI-----MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCP 184          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 110.538 bits (275), Expect = 3.549e-29
Identity = 62/185 (33.51%), Postives = 96/185 (51.89%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK--KIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS 623
            +S +D  A+L++HN  R  V        P A+NM++MVW    A +A+ +A  C++ H   +  ++     +GQN++   G+   I + ++ WY+E   ++F      N  C LK     C HYTQ+VWA S ++GC +  C    +        + LVCNY P GN++GE PYK G  CS C  
Sbjct:   63 ISQEDMLAILQYHNKVRGKVF-------PPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRNLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKIGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPP 235          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 9.244e-29
Identity = 68/201 (33.83%), Postives = 100/201 (49.75%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG--KKIDRGLELWYNEASGFTF-ENSACSLK--------TCGHYTQLVWANSTEVGCGLSKCSIDGIDLSL----------LVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCTEYGLC 653
            +++D++ AL  +HN  R  V        P A +M+HM W  E A  A+ +A +C + H   D       + +GQN+A + G  + +   ++ W++E   + + E   CS +         C HYTQLVWA S  VGC +  C    +D+S+          LVCNY P GN++GE PY+ G  CS C    G SC   GLC
Sbjct:    1 IADDERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQ-----LDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTC----LDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSC-RGGLC 184          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 5.335e-23
Identity = 55/179 (30.73%), Postives = 81/179 (45.25%), Query Frame = 3
Query:  153 FHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKY-GDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSC 635
             HN  R +V        P ++NM++M W K+   +A  Y  +C+     +    + G   W+      F        ++ WY+EA  + +      N  C  +     C HYTQLVWA +  VGC ++ C    +          LVCNY P GN++G  PYK+G+ CSEC    G SC
Sbjct:    2 LHNKLRGEV-------HPPSSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHFLGQPHWLSHRPPSFH-------VQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSC 166          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 89.3521 bits (220), Expect = 6.091e-22
Identity = 55/165 (33.33%), Postives = 84/165 (50.91%), Query Frame = 3
Query:  144 LLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNV-AKFAGKKIDRGLELWYNE--ASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSID-GIDLSLLVCNYGPGGNYVGE--KPYKAGKTCSECK 620
            ++  HN+ RR+V        P+A NM  M+W KE+   A  +A+ C F H     RK   +   G+N+    A    +  +  WYNE  + GF ++  + +    GHYTQLVW NS ++GC ++ C  + G+   L VC+Y P GN      +PY  G +C+ C 
Sbjct:   47 IVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWT-CGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCP 203          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 54.6842 bits (130), Expect = 6.885e-10
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 3
Query:  390 WYNEA--SGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGE--KPYKAGKTCSECKS 623
            WYNEA   GF F     +    GHYTQ+VW +S ++GC ++ C  + I   + VC+Y P GN      +PY  G  C  C +
Sbjct:   21 WYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCP-EAIYKYVYVCHYCPAGNLNTRLSRPYNEGSPCRSCPN 101          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 53.9138 bits (128), Expect = 5.582e-9
Identity = 46/186 (24.73%), Postives = 63/186 (33.87%), Query Frame = 3
Query:  102 EFCSGDLSNDDKDA----------LLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESA-------------------SKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGN 569
            E   G L   D DA          L   HN  R        T QP+A NM+ M W    A                   + A+I     I                V  + A          L  W++E   + +    C+  +TC HYTQ+VWA+++ VGC    C   G  +    C Y PG +
Sbjct:   29 EMLPGSLIETDPDAAGSVSKEAFALESLHNKLR-------ATVQPSAANMEKMEWDDSLAQVAHEWAAVACENPRAAEGTSAEIPEKPGIQGTGAGGRGGGQRRLGVNLHRAPHGATSFASVLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAFACVYLPGND 207          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 65.4698 bits (158), Expect = 2.923e-13
Identity = 44/118 (37.29%), Postives = 62/118 (52.54%), Query Frame = 3
Query:  228 MVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGE 581
            + WS   AS AQ YAD     +D      +    + G+N+A   G      ++ WYNE S + F N   S  T GH+TQ+VW ++T+VGCG+  C   G     ++C+Y P GNY GE
Sbjct:  183 LSWSDTLASYAQDYADN----YDCSGTLTHSGGPY-GENLA--LGYDGPAAVDAWYNEISNYDFSNPGFSSNT-GHFTQVVWKSTTQVGCGIKTCG--GAWGDYVICSYDPAGNYEGE 290          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 66.2402 bits (160), Expect = 3.840e-13
Identity = 44/140 (31.43%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  162 NYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGE 581
            N+  DV+      +    +   + WS   A+ AQ YAD+    +D      + D  + G+N+A   G      ++ WY E S + + N   S  T GH+TQ+VW ++ E+GCG   C     +   +VC+Y P GNY+GE
Sbjct:   24 NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQ----YDCSGVLTHSDGPY-GENLA--LGYTDTGAVDAWYGEISKYNYSNPGFSEST-GHFTQVVWKSTAEIGCGYKYCGTTWNN--YIVCSYNPPGNYLGE 153          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 60.077 bits (144), Expect = 2.826e-11
Identity = 39/118 (33.05%), Postives = 64/118 (54.24%), Query Frame = 3
Query:  228 MVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGE 581
            + WS   A+ AQ YAD    ++D   +  +    + G+N+A   G      ++ WYNE + + + N   S ++ GH+TQ+VW  ++EVGCGL  C  +  D   ++C+Y   GN +GE
Sbjct:  213 LTWSDTLATYAQNYAD----SYDCSGNLVHSGGPY-GENLA--LGYGTTGSVDAWYNEITSYDYSNPGFS-ESAGHFTQVVWKGTSEVGCGLKSCGGEWGD--YIICSYKAAGNVIGE 320          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 72.7886 bits (177), Expect = 3.783e-15
Identity = 50/155 (32.26%), Postives = 73/155 (47.10%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCI----FAHDTIDDRKYGDFEWVGQNVAKFAGK-KIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGN 569
            +  D +  +L  HNNYR               N   + WS   A  AQ +A K        H + +DR Y      G+N+ + +    I   L++WYNE+  + ++N   +L T GH+TQ+VW  + EVG G +K S DG  L+  V  Y P GN
Sbjct:  209 VDEDTRSRILDIHNNYR------------AMHNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYYK-----GENICRMSHHFDIGDALQIWYNESESYQYDNPGFAL-TTGHFTQIVWRGTREVGVGFAK-SPDG-RLTYAVARYNPPGN 343          

HSP 2 Score: 55.0694 bits (131), Expect = 4.508e-9
Identity = 42/145 (28.97%), Postives = 59/145 (40.69%), Query Frame = 3
Query:  147 LRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKID----RGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGN 569
            L  HN YR               N+  + WS   A +AQ +A+K       I D+        G+NV   +G   D       E WY E   + F+       T GH+TQ+VW +S E+G   +K     +    +V  Y PGGN
Sbjct:    9 LDAHNRYR------------AMHNVPPLTWSNSIAREAQKWANKLAKEGKLIHDKSRSG---QGENVFMSSGANFDDAGEAACESWYQEVERYNFQRGGHQSGT-GHFTQVVWKSSEELGVARAKSKKGAV---FVVARYSPGGN 134          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 65.0846 bits (157), Expect = 1.364e-13
Identity = 45/153 (29.41%), Postives = 77/153 (50.33%), Query Frame = 3
Query:  135 KDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKID--RGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKP 587
            K+ +L+ HN+YR    +G+          K + W+   AS+AQ +A+  +   + I      ++   G+++A  +G  +   +  ++WY E   + FEN   S  + GH+TQ+VWA STE+G G +  S        +V  Y P GN +G+ P
Sbjct:    3 KNDILKTHNDYR--AQHGT----------KALKWNARLASEAQSWAEN-LAQRNAIQHSSSREY---GESIAYMSGAVLTGRKATDMWYGEVDKYRFENPGFST-SSGHFTQVVWAGSTEMGAGKATSSSGA---HFVVARYTPPGNVMGQFP 135          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 63.5438 bits (153), Expect = 6.902e-13
Identity = 42/119 (35.29%), Postives = 61/119 (51.26%), Query Frame = 3
Query:  228 MVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK---KIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYV 575
            + WS E A +AQ YA+K           K    +  G+N+A F+G+     D   E+WY E+  ++F      + T GH+TQ+VW  S E+G G +K S DG   + +V  Y P GN V
Sbjct:   23 LKWSDELAREAQYYAEKLAQQRSMQHSSKCSRND-AGENLAMFSGRYDTAGDMACEMWYEESKKYSFVRGGSQMGT-GHFTQMVWKGSKELGMGRAKTS-DG-RCTYVVARYQPAGNIV 137          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 63.1586 bits (152), Expect = 8.213e-13
Identity = 49/156 (31.41%), Postives = 75/156 (48.08%), Query Frame = 3
Query:  147 LRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKC----IFAHD--TIDDRKYGDFEWVGQNVAKFAGKK-----IDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGE 581
            L  HN YR+   +G+          K M WS   A+ AQ +ADK      F HD  +I+ +  G      +N+A F  +K     I    + WY+E+S + + N+  S K  GH+TQLVW  + ++G G +K +    D   +V  + P GN  G+
Sbjct:    6 LEAHNEYRK--RHGA----------KEMTWSASLAADAQKWADKLSQTDAFKHDYASINSKSQG------ENLAYFTPQKPNNTAIMDAFDAWYDESSKYDYANAKFS-KETGHFTQLVWKATQKMGIGTAKNAKG--DKEYVVARFSPAGNIKGQ 140          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO40545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z3])

HSP 1 Score: 63.5438 bits (153), Expect = 8.447e-13
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 3
Query:  132 DKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCI----FAHDTIDDRKYGDFEWVGQNVA--------KFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNY 572
            +++ALL  HNN+R+              N   M  ++E + +A+ YA+K        H +  +R     E VG+N+A           GK+    +  WYNE   + F N A +++T GH+TQ+VW +S E+G G +   ++GI    +V  Y P GN+
Sbjct:    7 EEEALLT-HNNFRQ------------VHNAPPMTLNRELSLQAKGYAEKIANLGALQHSSSGERG----EDVGENLAVGCKSFGVPLTGKE---AVTNWYNEVCKYDFNNGAFAMET-GHFTQVVWTDSIELGMGKATGKLNGIPCVFVVGRYRPPGNF 144          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 108.612 bits (270), Expect = 1.776e-28
Identity = 65/192 (33.85%), Postives = 98/192 (51.04%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK--KIDRGLELWYNEASGFTFE-----NSACSLK----TCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS--GQSCT 638
            +S +D  A+L +HN  R  V        P A+NM++MVW +  A  A+ +A  C++ H      ++     +GQN++   G+   I + ++ WY+E   ++F      N  C L+     C HYTQ+VWA S +VGC +  C    +        + LVCNY P GN++GE PYK G  CS C    G SC+
Sbjct:   61 ISQNDMLAILDYHNKVRGKVF-------PPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCS 240          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 109.383 bits (272), Expect = 4.545e-28
Identity = 65/184 (35.33%), Postives = 97/184 (52.72%), Query Frame = 3
Query:  120 LSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGK-KIDRGLELWYNEASGFTFENSACSL-KTCGHYTQLVWANSTEVGCGLSKC-SIDGID---LSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            L++  ++ L+  HN+YR  V        P+A  M  + W       A+ YA KCI+ H+T       + E  G+N+    GK  +   +E W+ E   +++EN++C   K CGHYTQ+VWA++  VGC +  C +I+ +D   +S LVCNY P GNY  E+PY  G  CS C       +  LC
Sbjct:   57 LTDQQEEMLVELHNHYRGQV-------SPSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNT-------ELEDTGENLFAGTGKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLC 226          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 105.145 bits (261), Expect = 8.645e-26
Identity = 60/179 (33.52%), Postives = 86/179 (48.04%), Query Frame = 3
Query:  132 DKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRG--LELWYNEASGFTFENSA---------CSLKTCGHYTQLVWANSTEVGCGLSKCSIDGI------DLSLLVCNYGPGGNYVGEKPYKAGKTCSEC 617
            D++ +L  HN  R  V        P+A NM+HMVW  E    A  +A++C + H   D         +GQN+A   G+       ++ WY+E   +T+   +         CS   C HYTQLVWA +  VGC +  C    +          LVCNY P GN++GE PY+ G+ CS+C
Sbjct:   75 DREEILLLHNKLRSSVY-------PSAANMEHMVWDDELERSATQWAEECRWEHGPQDL-----LMSIGQNLAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQC 241          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 97.8265 bits (242), Expect = 1.312e-24
Identity = 58/178 (32.58%), Postives = 92/178 (51.69%), Query Frame = 3
Query:   93 VVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGL-ELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS 623
            V+ + C  D +   +  ++  HN +RR V       +P A +M  M +S+E A  AQ + DKC+  H     R    +E +G+N+       + + +   WY E S F F N++ + K  GHYTQ+VW +S +VGCG++ CS    ++ L  C+Y   GN+    PYK G  C+ C +
Sbjct:   19 VLADICPEDTAVQAE--IVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCS---NNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPN 183          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 96.6709 bits (239), Expect = 2.845e-24
Identity = 55/161 (34.16%), Postives = 85/161 (52.80%), Query Frame = 3
Query:  144 LLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGL-ELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKS 623
            ++  HN +RR V       +P A +M  M +S+E A  AQ + DKC+  H     R    +E +G+N+       + + +   WY E S F F N++ + K  GHYTQ+VW +S +VGCG++ CS    ++ L  C+Y   GN+    PYK G  C+ C +
Sbjct:   19 IVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCS---NNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPN 168          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017389.1 (SMESG000017389.1)

HSP 1 Score: 317.39 bits (812), Expect = 2.612e-111
Identity = 152/188 (80.85%), Postives = 166/188 (88.30%), Query Frame = 3
Query:   90 IVVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            +VVL+FCSGDLS  +K+ LL  HN YR DV  G V+GQPTA+NM+ MVW+++SASKAQIYADKCIFAHDT DDRKYGDFEWVGQNVAKFAG+ I RG ELW+ + SGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYK G  CSECKSGQSC+  GLC
Sbjct:   11 LVVLDFCSGDLSEKEKNLLLNIHNEYRGDVAIGQVSGQPTASNMQLMVWNEKSASKAQIYADKCIFAHDTKDDRKYGDFEWVGQNVAKFAGEIITRGAELWFIQVSGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKLGPPCSECKSGQSCST-GLC 197          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017389.1 (SMESG000017389.1)

HSP 1 Score: 318.546 bits (815), Expect = 3.328e-111
Identity = 152/188 (80.85%), Postives = 166/188 (88.30%), Query Frame = 3
Query:   90 IVVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            +VVL+FCSGDLS  +K+ LL  HN YR DV  G V+GQPTA+NM+ MVW+++SASKAQIYADKCIFAHDT DDRKYGDFEWVGQNVAKFAG+ I RG ELW+ + SGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYK G  CSECKSGQSC+  GLC
Sbjct:   41 LVVLDFCSGDLSEKEKNLLLNIHNEYRGDVAIGQVSGQPTASNMQLMVWNEKSASKAQIYADKCIFAHDTKDDRKYGDFEWVGQNVAKFAGEIITRGAELWFIQVSGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKLGPPCSECKSGQSCST-GLC 227          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017386.1 (SMESG000017386.1)

HSP 1 Score: 311.612 bits (797), Expect = 6.096e-109
Identity = 148/189 (78.31%), Postives = 164/189 (86.77%), Query Frame = 3
Query:   90 IVVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN 656
            +VVL+FCSGDLS  +K+ LL  HN  R  V  G  +GQP+A+NM+ MVW+ ESASKAQI ADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG+ I RG ELW+N+ SGFTFENSACSLKTCGHYTQ VWA+STE+GCGLSKCSIDGIDL+LLVCNYGPGGNYVGEKPYK GK+CSECKSGQSC   GLCN
Sbjct:   11 LVVLDFCSGDLSEKEKNLLLDVHNERRLAVSIGYASGQPSASNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDIARGAELWFNQVSGFTFENSACSLKTCGHYTQFVWADSTELGCGLSKCSIDGIDLNLLVCNYGPGGNYVGEKPYKLGKSCSECKSGQSCPR-GLCN 198          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000000320.1 (SMESG000000320.1)

HSP 1 Score: 310.071 bits (793), Expect = 3.029e-108
Identity = 144/188 (76.60%), Postives = 168/188 (89.36%), Query Frame = 3
Query:   90 IVVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLC 653
            +VVL+FCSG LS+D++  +L +HN+YR  V  G V+GQP A+NM+ +VW++ESASKAQI ADKCIFAHDTIDDRKYG+FEWVGQNVAKFAG++I RG ELW  + SGFTFE+SACSLKTCGHYTQLVWANSTE+GCGL+KC IDGIDL+LLVCNYGPGGNYVGEKPYK+G+ CSECKSGQSCT YGLC
Sbjct:   17 LVVLDFCSGGLSDDERKEVLNYHNDYRSAVAQGYVSGQPKASNMQKLVWNEESASKAQITADKCIFAHDTIDDRKYGNFEWVGQNVAKFAGERIYRGAELWNIQVSGFTFESSACSLKTCGHYTQLVWANSTELGCGLAKCIIDGIDLNLLVCNYGPGGNYVGEKPYKSGEPCSECKSGQSCTAYGLC 204          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000017377.1 (SMESG000017377.1)

HSP 1 Score: 309.301 bits (791), Expect = 4.887e-108
Identity = 145/189 (76.72%), Postives = 165/189 (87.30%), Query Frame = 3
Query:   90 IVVLEFCSGDLSNDDKDALLRFHNNYRRDVVYGSVTGQPTATNMKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKKIDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN 656
            +VVL+FCSGDLS  +K+ LL  HN +R D+  G V+GQP ATNM+ +VW+ ESASKAQI ADKCIFAHDTIDDRKYGDFEWVGQNVAKFAG+ I RG++LW  +  GFTF +++CSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYV EKPYK GK+CSECKSGQSC++ GLCN
Sbjct:   11 LVVLDFCSGDLSEKEKNLLLSLHNGFRSDIAQGEVSGQPPATNMQRLVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDIARGVDLWSIQVFGFTFADNSCSLKTCGHYTQLVWANSTEVGCGLSKCSIDGIDLSLLVCNYGPGGNYVSEKPYKLGKSCSECKSGQSCSQ-GLCN 198          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR1L16.166e-3437.36GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L17.385e-3437.36GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
PI161.541e-3234.81peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.541e-3234.81peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.541e-3234.81peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-101.220e-2530.00SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-56.455e-2429.44SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-149.483e-2227.40SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-26.315e-2029.06SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-26.315e-2029.06SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84839.724e-3139.57gene:FBgn0038126 transcript:FBtr0082782[more]
CG326794.574e-1828.72gene:FBgn0052679 transcript:FBtr0071469[more]
Ag5r5.441e-1330.05gene:FBgn0015010 transcript:FBtr0333658[more]
Ag5r5.441e-1330.05gene:FBgn0015010 transcript:FBtr0073937[more]
Ag5r5.441e-1330.05gene:FBgn0015010 transcript:FBtr0305582[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml1.043e-3338.59R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml1.043e-3338.59R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
pi15a1.143e-2834.38peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
pi15b3.543e-2833.33peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pi15b3.974e-2833.33peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.14.151e-3136.87pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
R3HDML2.052e-2734.24R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML2.253e-2734.24R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
pi155.467e-2733.16peptidase inhibitor 15 [Source:NCBI gene;Acc:10048... [more]
crispld27.838e-2733.52cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr1l11.634e-3436.52GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
Pi163.764e-3234.39peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.764e-3234.39peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi165.635e-3235.14peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi166.471e-3134.92peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DPU1|VA576_SCODE4.693e-3638.80Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPU0|VA552_SCODE3.468e-3540.44Scoloptoxin SSD552 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPV2|VA558_SCODE4.840e-3538.25Scoloptoxin SSD558 OS=Scolopendra dehaani OX=26097... [more]
sp|Q9DAG6|GPRL1_MOUSE1.143e-3336.52GLIPR1-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q6UWM5|GPRL1_HUMAN3.546e-3337.36GLIPR1-like protein 1 OS=Homo sapiens OX=9606 GN=G... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI854.512e-6571.97GLI pathogenesis related-1 (Fragment) OS=Schmidtea... [more]
A0A564YFQ72.493e-4546.54SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A5K3ENG81.390e-4346.41Uncharacterized protein OS=Mesocestoides corti OX=... [more]
C1LE341.972e-4346.41GLIPR1-like protein 1 OS=Schistosoma japonicum OX=... [more]
C1LN984.985e-4342.60GLIPR1-like protein 1 OS=Schistosoma japonicum OX=... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml2.658e-3336.96R3H domain containing like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000036030.13.965e-3337.14peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.14.681e-3337.14peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.16.194e-3337.14peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
pi15a3.549e-2933.51peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.19.244e-2933.83pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
ENSPMAT00000002250.15.335e-2330.73pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP36.091e-2233.33cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CRISP26.885e-1037.80cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CLEC18A5.582e-924.73C-type lectin domain family 18 member A [Source:HG... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY12.923e-1337.29Sterol binding protein involved in the export of a... [more]
PRY33.840e-1331.43Cell wall-associated protein involved in export of... [more]
PRY22.826e-1133.05Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493103.783e-1532.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488811.364e-1329.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486636.902e-1335.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371148.213e-1331.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405458.447e-1330.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pi15a1.776e-2833.85peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000023160.24.545e-2835.33peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
crispld28.645e-2633.52cysteine rich secretory protein LCCL domain contai... [more]
ENSORLT00000020674.21.312e-2432.58cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020676.22.845e-2434.16cysteine-rich venom protein pseudecin-like [Source... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017389.12.612e-11180.85SMESG000017389.1[more]
SMESG000017389.13.328e-11180.85SMESG000017389.1[more]
SMESG000017386.16.096e-10978.31SMESG000017386.1[more]
SMESG000000320.13.029e-10876.60SMESG000000320.1[more]
SMESG000017377.14.887e-10876.72SMESG000017377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000735 ID=SMED30000735|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=669bp
GTTGACAGTAGACGGCAGGAAATTCGGCCCGATTTTAGTGGTGCTCATCT
AGGAGGGGGTAAAACATCGATTAAATCCAAATTACCCCCATCGTTGTTCT
AGAATTTTGTTCTGGAGATCTTTCTAATGACGATAAAGACGCACTCTTGA
GATTCCACAACAATTACCGAAGAGATGTGGTCTATGGAAGCGTTACAGGG
CAACCCACAGCAACGAACATGAAACACATGGTATGGAGTAAAGAATCCGC
GTCGAAAGCGCAGATCTACGCGGATAAATGCATATTTGCTCACGACACAA
TAGACGACCGTAAATACGGAGATTTTGAATGGGTTGGACAGAATGTTGCT
AAGTTCGCTGGAAAAAAAATTGACAGAGGCTTAGAATTGTGGTATAATGA
GGCTTCCGGATTCACATTTGAAAATAGTGCCTGTTCATTAAAAACCTGCG
GCCATTATACACAACTTGTATGGGCCAACTCTACTGAGGTTGGATGTGGA
CTTTCCAAATGTTCAATTGACGGAATTGATTTGAGTTTGTTAGTTTGCAA
TTACGGTCCAGGAGGCAATTATGTCGGTGAGAAACCCTATAAAGCTGGCA
AGACATGTTCTGAATGCAAATCCGGCCAATCCTGCACTGAATATGGACTT
TGTAATTGATTAAAATAAA
back to top

protein sequence of SMED30000735-orf-1

>SMED30000735-orf-1 ID=SMED30000735-orf-1|Name=SMED30000735-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MKHMVWSKESASKAQIYADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGKK
IDRGLELWYNEASGFTFENSACSLKTCGHYTQLVWANSTEVGCGLSKCSI
DGIDLSLLVCNYGPGGNYVGEKPYKAGKTCSECKSGQSCTEYGLCN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 1..51
e-value: 1.7E-12
score: 49.6
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 13..37
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01010CRISP_2coord: 13..24
NoneNo IPR availableCDDcd05381CAP_PR-1coord: 13..30
e-value: 2.24344E-5
score: 36.4577