SMED30000734
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30000734 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 3
Alignments
SMED30000734 aligns in the following genomic locations:
Homology
BLAST of SMED30000734 vs. TrEMBL
Match: W4YIB3 (TTF-type domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.224e-11 Identity = 43/109 (39.45%), Postives = 59/109 (54.13%), Query Frame = -1 Query: 1070 EVQEEILQLMSHIILRQLADEINKRKYFGILTKQQAAADHMPLF*EQEP*C*RN----------VFGMYILDCCDGSTFFNTIKDALQRLNVKMKNFKAACFDGASAFQ 1366 E+QEE++ LMS ++RQLA ++N K F IL Q + M EQ C R V G++ ++ CD T F TIKD L R N+ + +AA FDGA+ FQ Sbjct: 322 EIQEEMIDLMSKTLMRQLAADMNG-KPFAILADQTSDVSKM----EQLCICIRTATEELAVEERVIGLHAMNKCDSETVFKTIKDVLLRYNLPLTLCRAASFDGAATFQ 425 HSP 2 Score: 33.113 bits (74), Expect = 1.224e-11 Identity = 18/39 (46.15%), Postives = 20/39 (51.28%), Query Frame = -2 Query: 1366 QGLTL*SHEDTESNFKQLLKLRCHDSPEHLL*MTRKTTW 1482 QGL H D SNF LL LRC D + RKT+W Sbjct: 280 QGLPTRGHTDQNSNFVGLLNLRCKDVEGLDKWLARKTSW 318 HSP 3 Score: 46.595 bits (109), Expect = 7.653e-8 Identity = 31/70 (44.29%), Postives = 49/70 (70.00%), Query Frame = -1 Query: 245 PASTATGERSFNHLKLLKTRILSKMFQKRLNHLLIV*IYREEVDQLDLPKLLNEFILQNEMQRK-TFAIL 451 PA+TAT E S + L+ +KT + S M RLN LL++ +YRE+V+ +++ +L+NEFI + +RK T AI+ Sbjct: 704 PATTATAEHSSSTLRRVKTYLRSTMSLARLNSLLLLNVYREQVESMNITELVNEFISCGDSKRKNTLAII 773 HSP 4 Score: 41.5874 bits (96), Expect = 7.653e-8 Identity = 24/87 (27.59%), Postives = 46/87 (52.87%), Query Frame = -3 Query: 453 PIENLLLCSFRRNSIDVDDLDLVCQQYGDKLVKIRLSTQLLGLENFRDNMKD-VELVAIAETIKQIGNSEVMSIIPLRVRLIQFYLM 710 E+LL+ ++ N + ++ ++ V +GD L RL QL LEN ++ + +++ + I I S + +IP V+L + YL+ Sbjct: 616 ATEDLLMSAWSSNEVPLESMECVVNHFGDNLDGPRLEAQLQVLENLKETSGEPGSNLSVDKIISAISRSGMQKMIPQVVKLCKLYLV 702
BLAST of SMED30000734 vs. TrEMBL
Match: A0A151K420 (Dimer_Tnp_hAT domain-containing protein (Fragment) OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_08606 PE=4 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.440e-10 Identity = 32/70 (45.71%), Postives = 50/70 (71.43%), Query Frame = -1 Query: 248 SCPASTATGERSFNHLKLLKTRILSKMFQKRLNHLLIV*IYREEVDQLDLPKLLNEFILQNEMQRKTFAI 457 + P S+ + ERSF+ L+ LKT + + M QKRLN++ I+ IYR+ LDL L+N+FI++N+M+ TFA+ Sbjct: 23 TIPGSSCSNERSFSALRRLKTYLRATMLQKRLNNIAILNIYRDIAQNLDLELLMNDFIIKNKMRTATFAL 92
BLAST of SMED30000734 vs. TrEMBL
Match: H3ANJ3 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 4.828e-9 Identity = 37/110 (33.64%), Postives = 60/110 (54.55%), Query Frame = -1 Query: 1070 LEVQEEILQLMSHIILRQLADEINKRKYFGILTKQQAAADHMPLF*EQEP*C*RNV----------FGMYILDCCDGSTFFNTIKDALQRLNVKMKNFKAACFDGASAFQ 1369 + +QEEI+ L++ I +A EI +RK FG++ + A + EQ R+V G+++LDCC+ T + T+KD L RL + + N +A C +GA+ FQ Sbjct: 111 VPIQEEIIALIASTIQHDIAREIRERKMFGLMADETADVSRI----EQMVITVRSVEDDLEVYEELLGLHLLDCCNSKTIYKTLKDILIRLIIPLGNCRAFCAEGAATFQ 216 HSP 2 Score: 26.9498 bits (58), Expect = 4.828e-9 Identity = 16/39 (41.03%), Postives = 21/39 (53.85%), Query Frame = -2 Query: 1366 QGLTL*SHEDTESNFKQLLKLRCHDSPEHLL*MTRKTTW 1482 +G+ H+D SNFKQLL L + +T KTTW Sbjct: 70 KGIATYGHDDLNSNFKQLLLLMSKNDDVLRDWLTWKTTW 108
BLAST of SMED30000734 vs. TrEMBL
Match: A0A1X7SGE1 (DUF4371 domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1) HSP 1 Score: 63.929 bits (154), Expect = 6.896e-9 Identity = 37/108 (34.26%), Postives = 61/108 (56.48%), Query Frame = -1 Query: 1079 EVQEEILQLMSHIILRQLADEINKRKYFGILTKQQA-AADHMPLF*EQEP*C*RNV-----------FGMYILDCCDGSTFFNTIKDALQRLNVKMKNFKAACFDGAS 1366 E+Q EIL+LM+H ILR+++ ++ ++ ++ + +++H EQ C R V G Y +D ST F+++KD L RLN+ ++N +A CFDGAS Sbjct: 133 EIQNEILRLMAHSILRRISQSVHNNTHYALMADEVTDSSNH-----EQFVICLRWVDSISFAVNKDLVGFYQVDDITASTLFSSLKDVLLRLNINIQNCRAQCFDGAS 235 HSP 2 Score: 27.7202 bits (60), Expect = 6.896e-9 Identity = 14/27 (51.85%), Postives = 14/27 (51.85%), Query Frame = -2 Query: 1402 QGLTL*SHEDTESNFKQLLKLRCHDSP 1482 QGL L H E NF QLLKL P Sbjct: 90 QGLALRGHSSNEGNFIQLLKLLSETEP 116
BLAST of SMED30000734 vs. TrEMBL
Match: A0A232EPV8 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_011167 PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 6.967e-9 Identity = 33/69 (47.83%), Postives = 49/69 (71.01%), Query Frame = -1 Query: 245 PASTATGERSFNHLKLLKTRILSKMFQKRLNHLLIV*IYREEVDQLDLPKLLNEFILQNEMQRKTFAIL 451 P ST T ERSF+ L+ LKT + M Q RLNH I+ +YR+ V+ L++ L+N+FIL+N+ ++ TFAI+ Sbjct: 517 PGSTCTNERSFSTLRFLKTYTRATMGQDRLNHYAILYVYRDRVEALNIGDLMNKFILKNQHRKNTFAII 585 The following BLAST results are available for this feature:
BLAST of SMED30000734 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30000734 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30000734 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30000734 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30000734 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30000734 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 0
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30000734 ID=SMED30000734|Name=SMED30000734|organism=Schmidtea mediterranea sexual|type=transcript|length=2665bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|