Leucine-rich repeat-containing protein 45

Overview
NameLeucine-rich repeat-containing protein 45
Smed IDSMED30000732
Length (bp)2262
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine-rich repeat-containing protein 45 (SMED30000732) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine-rich repeat-containing protein 45 (SMED30000732) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine-rich repeat-containing protein 45 (SMED30000732) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine-rich repeat-containing protein 45 (SMED30000732) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000732

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000732SMESG000060194.1 Contig3762newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000732SMESG000060194.1 Contig3762uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000732SMESG000008737.1 Contig3762newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000732SMESG000008737.1 Contig3762uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30000732SMESG000060194.1 SmedASXL_013987SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000732SMESG000060194.1 dd_Smed_v4_9495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000732SMESG000060194.1 dd_Smed_v4_9495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000732SMESG000060194.1 dd_Smed_v4_9495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000732SMESG000060194.1 dd_Smed_v4_9495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30000732SMESG000060194.1 dd_Smed_v4_9495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000732SMESG000060194.1 dd_Smed_v6_9495_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30000732SMESG000060194.1 Contig29080newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000732SMESG000060194.1 Contig29080uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30000732SMESG000060194.1 dd_Smed_v4_9495_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Human
Match: LRRC45 (leucine rich repeat containing 45 [Source:HGNC Symbol;Acc:HGNC:28302])

HSP 1 Score: 265.388 bits (677), Expect = 7.083e-78
Identity = 199/673 (29.57%), Postives = 361/673 (53.64%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNY---ENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKD----KEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            +E F+  +  LC++    P + ++Q +             L L+ +S++ E C+ L +    +T   E+   DCMLS +   L+L GL  N     L LKGNN++  G E+L +L+ +N +I  L+LEWN +G     F  FC GL  N  LQ LDLRNNQI     + L  AL+ NT L+ LD+R+N++G+ GG+ ++N    NRTL ++ + GNNIP D+++ +E     + +     + + +R+    K   +   E S+  Q LDL++ ID+Q   +  S + S +++ QL++ L+ER      L A L + E+ L + E + ++       + +E+  L ++   +L  E+    E E + L++ S   E+ L LQN+V ELE     Q   +F+ + ++T  ++E K + +  EE++    D  K+   + +E  +    KE+  M      +E+  +E++ + +  R  L +E+S +K    S+R Q +E++ K K +   E+ Q+++ L+++L+ +   +DE +    +Q + +   Q   S+L +++E L+ + E L++ELS K    ++E+ +VR+E   +  +L++E  +Q  L  K    ++Q++ M +  RE    R +E  +L+++L+ +E E+ R  ++E  RAS L NAV+ Y Q S
Sbjct:    1 MEEFRRSYSRLCRESGAEPQEAVLQQLHQLPRGR------LDLATQSLTVETCRALGKLLPRETLCTELVLSDCMLSEEGATLLLRGLCANTVLRFLDLKGNNLRAAGAEALGKLLQQNKSIQSLTLEWNSLGTWDDAFATFCGGLAANGALQRLDLRNNQISHKGAEELALALKGNTTLQQLDLRWNNVGLLGGRALMNCLPSNRTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSK--QFLDLMETIDKQREEMAKSSRASAARVGQLQEALNERHSIINALKAKLQMTEAALALSEQKAQDLGELLATAEQEQLSLSQRQAKELKLEQQEAAERESKLLRDLSAANEKNLLLQNQVDELERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERL----DMEKRRCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSERGQAEEELIKAKSQARLEEQQRLAHLEDKLRLLAQARDEAQGACLQQKQVVAEAQTRVSQLGLQVEGLRRRLEELQQELSLKDQERVAEVSRVRVELQEQNGRLQAELAAQEALREKAAALERQLKVMASDHREALLDRESENASLREKLRLREAEIARIRDEEAQRASFLQNAVLAYVQAS 661          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 76.2554 bits (186), Expect = 1.395e-13
Identity = 64/245 (26.12%), Postives = 98/245 (40.00%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQV--------------------------GISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK 798
             N  L  L L   S+S      L      + T   +S ++  +SP+  Q I   L  N     L L  N + +QG  ++A  +  N T+T L L+WN +                           I   G       L  N  L  L L+   IG    Q+L EAL  N  L++LD+R N+IGV+G K + N  + N +L ++ +  N++ MD    I    + N  +   N + N   D   +
Sbjct:  804 VNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGAR 1048          

HSP 2 Score: 68.9366 bits (167), Expect = 2.841e-11
Identity = 53/178 (29.78%), Postives = 90/178 (50.56%), Query Frame = 1
Query:  253 FKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSD 786
            F+D ++  + L  +L G   +C   K+ L  N I N+G ++LAR +  N ++T L L  N +G  G       + L  N+TL  L L+ N +  D  + + EAL  N  L +L ++ NSIG  G + + +  ++NR+L +++   N+I     K +      N  +   + +SNS SD
Sbjct:  649 FQDPVM--ELLGSVLSG--KDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGA--KALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISD 820          

HSP 3 Score: 68.9366 bits (167), Expect = 2.866e-11
Identity = 49/208 (23.56%), Postives = 102/208 (49.04%), Query Frame = 1
Query:  103 DFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIEN 726
            D +++ + S     + ++  ++L+E  +S +  K L+     + +   +  +   + P   + + + L  N     L L+GN +++ G  S+A  ++ N T++ L L+ N +G  G    +  + L  N++L+ L   +N IG    + L EAL+ N  L+ LD++ NSI  +G   ++     N+TL  + +  N+I  +  + I +
Sbjct:  651 DPVMELLGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGA--QRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAH 856          

HSP 4 Score: 60.4622 bits (145), Expect = 1.186e-8
Identity = 47/177 (26.55%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            N  L  L+L   ++  +  + ++E    + T   +  +   + P   Q + + L  N    +L    N+I + G ++LA  +  N  +  L L+ N   IS  G       L  N+TL  L LR N I  +  Q +  AL  N+ LK LD+  N +   G + I     +NRTL+ +
Sbjct:  721 NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNS--ISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSL 895          

HSP 5 Score: 55.4546 bits (132), Expect = 4.441e-7
Identity = 55/178 (30.90%), Postives = 86/178 (48.31%), Query Frame = 1
Query:  322 CIKLCLKGNNIKNQGCESLARLIS-RNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI-PMDIIKNIENLANRNGEISEANERSNSRSDRNGK--RNNYENSRKLQTLDL 843
            C KL L  N  ++   E L  ++S ++  I  +SL  NQ  IS  G       L+ N++L  LDLR N IG    + L +AL+ N  L  L ++ N++   G + +      NRTLS + +  N+I PM   +  + L  +N  + E    SNS  D   K      + ++ L++LDL
Sbjct:  639 CRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISLAENQ--ISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADAL-KQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDL 813          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 76.2554 bits (186), Expect = 1.727e-13
Identity = 64/245 (26.12%), Postives = 98/245 (40.00%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQV--------------------------GISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK 798
             N  L  L L   S+S      L      + T   +S ++  +SP+  Q I   L  N     L L  N + +QG  ++A  +  N T+T L L+WN +                           I   G       L  N  L  L L+   IG    Q+L EAL  N  L++LD+R N+IGV+G K + N  + N +L ++ +  N++ MD    I    + N  +   N + N   D   +
Sbjct:  851 VNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGAR 1095          

HSP 2 Score: 68.9366 bits (167), Expect = 2.787e-11
Identity = 48/198 (24.24%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  103 DFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI 696
            D +++ + S     + ++  ++L+E  +S +  K L+     + +   +  +   + P   + + + L  N     L L+GN +++ G  S+A  ++ N T++ L L+ N +G  G    +  + L  N++L+ L   +N IG    + L EAL+ N  L+ LD++ NSI  +G   ++     N+TL  + +  N+I
Sbjct:  698 DPVMELLGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGA--QRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSI 893          

HSP 3 Score: 68.9366 bits (167), Expect = 2.835e-11
Identity = 53/178 (29.78%), Postives = 90/178 (50.56%), Query Frame = 1
Query:  253 FKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSD 786
            F+D ++  + L  +L G   +C   K+ L  N I N+G ++LAR +  N ++T L L  N +G  G       + L  N+TL  L L+ N +  D  + + EAL  N  L +L ++ NSIG  G + + +  ++NR+L +++   N+I     K +      N  +   + +SNS SD
Sbjct:  696 FQDPVM--ELLGSVLSG--KDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGA--KALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISD 867          

HSP 4 Score: 60.4622 bits (145), Expect = 1.180e-8
Identity = 47/177 (26.55%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            N  L  L+L   ++  +  + ++E    + T   +  +   + P   Q + + L  N    +L    N+I + G ++LA  +  N  +  L L+ N   IS  G       L  N+TL  L LR N I  +  Q +  AL  N+ LK LD+  N +   G + I     +NRTL+ +
Sbjct:  768 NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNS--ISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSL 942          

HSP 5 Score: 55.0694 bits (131), Expect = 4.846e-7
Identity = 55/178 (30.90%), Postives = 86/178 (48.31%), Query Frame = 1
Query:  322 CIKLCLKGNNIKNQGCESLARLIS-RNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI-PMDIIKNIENLANRNGEISEANERSNSRSDRNGK--RNNYENSRKLQTLDL 843
            C KL L  N  ++   E L  ++S ++  I  +SL  NQ  IS  G       L+ N++L  LDLR N IG    + L +AL+ N  L  L ++ N++   G + +      NRTLS + +  N+I PM   +  + L  +N  + E    SNS  D   K      + ++ L++LDL
Sbjct:  686 CRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISLAENQ--ISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADAL-KQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDL 860          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Human
Match: LRRC74A (leucine rich repeat containing 74A [Source:HGNC Symbol;Acc:HGNC:23346])

HSP 1 Score: 67.781 bits (164), Expect = 4.414e-11
Identity = 58/200 (29.00%), Postives = 88/200 (44.00%), Query Frame = 1
Query:  109 IIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECF-RHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMD 705
            +++ +Q  Y+     L  + +S   +  E  +++S+ F R+ ++   +         D   L+ + LS N    KL L  N   + G E L ++++ N  +T L L WN     G      CNGL  N TL  LDL  N  G +    L E L+ N  L  LD+  N IG  G   I    E N +L  + +  N I MD
Sbjct:  153 LVEMLQENYY-----LQEMNISNNHLGLEGARIISDFFERNSSSIWSLELSGNDFKEDSAALLCQALSTNYQIKKLDLSHNQFSDVGGEHLGQMLAINVGLTSLDLSWNNFHTRGA--VALCNGLRGNVTLTKLDLSMNGFGNEVALALGEVLRLNRCLVYLDIGGNDIGNEGASKISKGLESNESLRVLKLFLNPINMD 345          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 62.3882 bits (150), Expect = 2.104e-10
Identity = 39/133 (29.32%), Postives = 69/133 (51.88%), Query Frame = 1
Query:  268 LSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTL 666
            + P   + + + L  N     L L+GN +++ G  S+A  ++ N T++ L L+ N +G    G  +  + L  N++L+ L   +N IG    + L EAL+ N  L+ LD++ NSI  +G   ++     N+TL
Sbjct:    7 IGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGP--MGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTL 137          

HSP 2 Score: 56.9954 bits (136), Expect = 1.279e-8
Identity = 42/156 (26.92%), Postives = 70/156 (44.87%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSI 612
            N  L  L+L   ++  +  + ++E    + T   +  +   + P   Q + + L  N    +L    N+I + G ++LA  +  N  +  L L+ N   IS  G       L  N+TL  L LR N I  +  Q +  AL  N+ LK LD+++N I
Sbjct:   22 NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNS--ISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLQWNFI 175          

HSP 3 Score: 53.5286 bits (127), Expect = 2.005e-7
Identity = 43/162 (26.54%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  181 SMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTL 666
            S+  +  K L++  + + T   +S +   +  D  + + E L+ N     L L+ N+I   G + +A  + +N ++ +L    N +G  G         L  N+ L+ LDL++N I       L  AL  N  L  L +R NSI   G + I +    N TL
Sbjct:    6 SIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGA--KALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTL 165          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Zebrafish
Match: lrrc45 (leucine rich repeat containing 45 [Source:ZFIN;Acc:ZDB-GENE-121214-317])

HSP 1 Score: 310.071 bits (793), Expect = 9.884e-95
Identity = 219/676 (32.40%), Postives = 387/676 (57.25%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNY---ENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKE-NDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPSIQSSFA 2058
            +E+F+  +L LCK+  +   + ++  +      T S    L LS +S++ + C VL+   ++DT F EI   DCMLS + ++++L GL  N     L LKGNN++  G E+L +L+ RN  +  L LEWN +G+   GF  FC GL ++ +L  LDLRNNQI       L  AL++N+NL+ LD+R+N++G+ GG+ +L   ++NRTL+K+ + GNNIP D ++ IE   N N +       S SR+    K       E SR  Q L L++ ID Q   +  S + S  ++ QL++ L+E+K     L A L + E+ L + E +  +  D   +  +++ E  ERQ   ++ KE +     E + LKE ++L E+ LQL++K+ E E     Q + +FELK ++T T +E K ++   EE++   K + K+ + ++   + KE++ +      +E   +E+++K +  R +L +E+S +K  + ++R Q +E++ K++ ++  E+ Q ++ L+E+L+ ++  +DE ++   +Q + I  L    S+  IE +SL+ + + L+++L+GK+   +SE+ +VR+E   +I  L++ER +Q  L  KI   +++I+ +  + RE    + +EM +L +RL+ +E E+ R  EDE  RAS L NA++ Y Q S  + F+
Sbjct:    1 MEDFRRSYLRLCKEGGVDTQESVLAQLHDTRTVTGSSR--LDLSGQSITVDTCSVLARVLQNDTVFTEIILSDCMLSEEGVKMLLNGLCSNTTVKVLDLKGNNMRGTGAEALGQLLVRNKVLRRLVLEWNALGMWEEGFAVFCEGLASSTSLTQLDLRNNQINHQGAAELCVALKRNSNLQELDLRWNNMGLLGGRSLLEAMQQNRTLTKLELAGNNIPSDTLRAIEQSMNHNVDRQSTLRESKSRTQVLSKEIQLLKDEKSR--QYLSLMETIDRQKGEMGRSSRNSSIRLGQLQEALNEQKSSVNSLTAKLQMTEAALALSEQKNHDLADLLTRVKMEKNELRERQSR-EIKKEHEENAVREAKHLKEVNSLSEKNLQLRSKLEETERRCKTQQDQIFELKQELTNTTAELKLRLAQTEERLEMEKRRAKQALEDMDGLRQKEVDHLTRHQEDSERALQERILKLEGQRIQLEEELSRVKASLVTERAQAEEELGKVRSQVRLEEQQHLTSLEEKLRAVRQSRDESQNHCTQQKQTIAELHAKVSQQSIETDSLRRRIDELQQDLAGKEQEKVSEVTRVRVELQEQIGHLQAERTAQGGLKEKIAALEREIKALSVAHREALLDKESEMSSLLERLRIREGEIQRIREDEAQRASFLQNAILTYVQGSPLAHFS 671          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Zebrafish
Match: lrrc45 (leucine rich repeat containing 45 [Source:ZFIN;Acc:ZDB-GENE-121214-317])

HSP 1 Score: 301.982 bits (772), Expect = 8.494e-92
Identity = 218/676 (32.25%), Postives = 387/676 (57.25%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNY---ENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKE-NDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPSIQSSFA 2058
            +E+F+  +L LCK+  +   + ++           ++L  L LS +S++ + C VL+   ++DT F EI   DCMLS + ++++L GL  N     L LKGNN++  G E+L +L+ RN  +  L LEWN +G+   GF  FC GL ++ +L  LDLRNNQI       L  AL++N+NL+ LD+R+N++G+ GG+ +L   ++NRTL+K+ + GNNIP D ++ IE   N N +       S SR+    K       E SR  Q L L++ ID Q   +  S + S  ++ QL++ L+E+K     L A L + E+ L + E +  +  D   +  +++ E  ERQ   ++ KE +     E + LKE ++L E+ LQL++K+ E E     Q + +FELK ++T T +E K ++   EE++   K + K+ + ++   + KE++ +      +E   +E+++K +  R +L +E+S +K  + ++R Q +E++ K++ ++  E +Q ++ L+E+L+ ++  +DE ++   +Q + I  L    S+  IE +SL+ + + L+++L+GK+   +SE+ +VR+E   +I  L++ER +Q  L  KI   +++I+ +  + RE    + +EM +L +RL+ +E E+ R  EDE  RAS L NA++ Y Q S  + F+
Sbjct:    1 MEDFRRSYLRLCKEGGVDTQESVL-----------AQLSRLDLSGQSITVDTCSVLARVLQNDTVFTEIILSDCMLSEEGVKMLLNGLCSNTTVKVLDLKGNNMRGTGAEALGQLLVRNKVLRRLVLEWNALGMWEEGFAVFCEGLASSTSLTQLDLRNNQINHQGAAELCVALKRNSNLQELDLRWNNMGLLGGRSLLEAMQQNRTLTKLELAGNNIPSDTLRAIEQSMNHNVDRQSTLRESKSRTQVLSKEIQLLKDEKSR--QYLSLMETIDRQKGEMGRSSRNSSIRLGQLQEALNEQKSSVNSLTAKLQMTEAALALSEQKNHDLADLLTRVKMEKNELRERQSR-EIKKEHEENAVREAKHLKEVNSLSEKNLQLRSKLEETERRCKTQQDQIFELKQELTNTTAELKLRLAQTEERLEMEKRRAKQALEDMDGLRQKEVDHLTRHQEDSERALQERILKLEGQRIQLEEELSRVKASLVTERAQAEEELGKVRSQVRLE-EQHLTSLEEKLRAVRQSRDESQNHCTQQKQTIAELHAKVSQQSIETDSLRRRIDELQQDLAGKEQEKVSEVTRVRVELQEQIGHLQAERTAQGGLKEKIAALEREIKALSVAHREALLDKESEMSSLLERLRIREGEIQRIREDEAQRASFLQNAILTYVQGSPLAHFS 661          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Zebrafish
Match: lrrc45 (leucine rich repeat containing 45 [Source:ZFIN;Acc:ZDB-GENE-121214-317])

HSP 1 Score: 298.901 bits (764), Expect = 8.343e-91
Identity = 217/676 (32.10%), Postives = 377/676 (55.77%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNY---ENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKE-NDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPSIQSSFA 2058
            +E+F+  +L LCK+  +   + ++  +      T S    L LS +S++ + C VL+   ++DT F EI   DCMLS + ++++L GL  N     L LKGNN++  G E+L +L+ RN  +  L LEWN +G+   GF  FC GL ++ +L  LDLRNNQI       L  AL++N+NL+ LD+R+N++G+ GG+ +L   ++NRTL+K+ + GNNIP D ++ IE   N N +       S SR+    K       E SR  Q L L++ ID Q   +  S + S  ++ QL++ L+E+K     L A L + E+ L + E +  +  D   +  +++ E  ERQ  +  + E   R   E + LKE ++L E+ LQL++K+ E E     Q + +FELK ++T T +E K ++   E                     D+  +  RH+ + +E   +E+++K +  R +L +E+S +K  + ++R Q +E++ K++ ++  E+ Q ++ L+E+L+ ++  +DE ++   +Q + I  L    S+  IE +SL+ + + L+++L+GK+   +SE+ +VR+E   +I  L++ER +Q  L  KI   +++I+ +  + RE    + +EM +L +RL+ +E E+ R  EDE  RAS L NA++ Y Q S  + F+
Sbjct:    1 MEDFRRSYLRLCKEGGVDTQESVLAQLHDTRTVTGSSR--LDLSGQSITVDTCSVLARVLQNDTVFTEIILSDCMLSEEGVKMLLNGLCSNTTVKVLDLKGNNMRGTGAEALGQLLVRNKVLRRLVLEWNALGMWEEGFAVFCEGLASSTSLTQLDLRNNQINHQGAAELCVALKRNSNLQELDLRWNNMGLLGGRSLLEAMQQNRTLTKLELAGNNIPSDTLRAIEQSMNHNVDRQSTLRESKSRTQVLSKEIQLLKDEKSR--QYLSLMETIDRQKGEMGRSSRNSSIRLGQLQEALNEQKSSVNSLTAKLQMTEAALALSEQKNHDLADLLTRVKMEKNELRERQAGVLHNLENAVR---EAKHLKEVNSLSEKNLQLRSKLEETERRCKTQQDQIFELKQELTNTTAELKLRLAQTE--------------------GDRVDHLTRHQED-SERALQERILKLEGQRIQLEEELSRVKASLVTERAQAEEELGKVRSQVRLEEQQHLTSLEEKLRAVRQSRDESQNHCTQQKQTIAELHAKVSQQSIETDSLRRRIDELQQDLAGKEQEKVSEVTRVRVELQEQIGHLQAERTAQGGLKEKIAALEREIKALSVAHREALLDKESEMSSLLERLRIREGEIQRIREDEAQRASFLQNAILTYVQGSPLAHFS 648          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Zebrafish
Match: lrrc45 (leucine rich repeat containing 45 [Source:ZFIN;Acc:ZDB-GENE-121214-317])

HSP 1 Score: 261.922 bits (668), Expect = 4.399e-77
Identity = 209/675 (30.96%), Postives = 373/675 (55.26%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQ---LEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPSIQSSFA 2058
            +E+F+  +L L         + ++  +      T S    L LS +S++ + C VL+   ++DT F EI   DCMLS + ++++L GL  N     L LKGNN++  G E+L +L+ RN  +  L LEWN +G+   GF  FC GL ++ +L  LDLRNNQI       L  AL++N+NL+ LD+R+N++G+ GG+ +L   ++NRTL+K+ + GNNIP D ++ IE   N N +       S SR+           S+++Q L      DE++  +R+S       II    L++ L+E+K     L A L + E+ L + E   K +D +    L  R  +E+    +L + +   I+ E   LKE ++L E+ LQL++K+ E E     Q + +FELK ++T T +E K ++   EE++   K + K+ + ++   + KE+  +    +     +++ L+   +  + +  E+S +K  + ++R Q +E++ K++ ++  E+ Q ++ L+E+L+ ++  +DE ++   +Q + I  L    S+  IE +SL+ + + L+++L+GK+   +SE+ +VR+E   +I  L++ER +Q  L  KI   +++I+ +  + RE    + +EM +L +RL+ +E E+ R  EDE  RAS L NA++ Y Q S  + F+
Sbjct:    1 MEDFRRSYLRL-----FDTQESVLAQLHDTRTVTGSSR--LDLSGQSITVDTCSVLARVLQNDTVFTEIILSDCMLSEEGVKMLLNGLCSNTTVKVLDLKGNNMRGTGAEALGQLLVRNKVLRRLVLEWNALGMWEEGFAVFCEGLASSTSLTQLDLRNNQINHQGAAELCVALKRNSNLQELDLRWNNMGLLGGRSLLEAMQQNRTLTKLELAGNNIPSDTLRAIEQSMNHNVDRQSTLRESKSRTQ--------VLSKEIQLLK-----DEKSRQVRISG------IIHLHCLQEALNEQKSSVNSLTAKLQMTEAALALSE--QKNHDLA---DLLTRVKMEKN---ELRERQSREIKKEHEHLKEVNSLSEKNLQLRSKLEETERRCKTQQDQIFELKQELTNTTAELKLRLAQTEERLEMEKRRAKQALEDMDGLRQKEVKML----DCTSFIYKKMLVFFLKFIQGI--ELSRVKASLVTERAQAEEELGKVRSQVRLEEQQHLTSLEEKLRAVRQSRDESQNHCTQQKQTIAELHAKVSQQSIETDSLRRRIDELQQDLAGKEQEKVSEVTRVRVELQEQIGHLQAERTAQGGLKEKIAALEREIKALSVAHREALLDKESEMSSLLERLRIREGEIQRIREDEAQRASFLQNAILTYVQGSPLAHFS 635          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Zebrafish
Match: lrrc45 (leucine rich repeat containing 45 [Source:ZFIN;Acc:ZDB-GENE-121214-317])

HSP 1 Score: 229.18 bits (583), Expect = 1.577e-65
Identity = 195/680 (28.68%), Postives = 334/680 (49.12%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKS--FSKIIQLEKLLDERKQKCQ-----HLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIK-NDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPSIQSSFA 2058
            +E+F+  +L LCK+  +   + ++  +      T S    L LS +S++ + C VL+   ++DT F EI   DCMLS + ++++L GL  N     L LKGNN++  G E+L +L+ RN  +  L LEWN +G+   GF  FC GL ++ +L  LDLRNNQI       L  AL++N+NL+ LD+R+N++G+ GG+ +L   ++NRTL+K+ + GNNIP D ++ IE   N N                                     +D Q S LR S  ++   SK IQL K  DE+ ++ +     HL+    + E+K        KE ++  +K+L+ R  LE +   +   ++D   E+++      + L+ R+ Q +                VF++ D +T    + +  +   +E+I+KL+ Q          Q ++E+++++        +  E+L K   ++R E  Q ++SL+ ++ + R   DE  +   Q     Q Q I++L  ++    I  D +        R I+ LQ+D                     L+GK+   +SE+ +VR+E   +I  L++ER +Q  L  KI   +++I+ +  + RE    + +EM +L +RL+ +E E+ R  EDE  RAS L NA++ Y Q S  + F+
Sbjct:    1 MEDFRRSYLRLCKEGGVDTQESVLAQLHDTRTVTGSSR--LDLSGQSITVDTCSVLARVLQNDTVFTEIILSDCMLSEEGVKMLLNGLCSNTTVKVLDLKGNNMRGTGAEALGQLLVRNKVLRRLVLEWNALGMWEEGFAVFCEGLASSTSLTQLDLRNNQINHQGAAELCVALKRNSNLQELDLRWNNMGLLGGRSLLEAMQQNRTLTKLELAGNNIPSDTLRAIEQSMNHN-------------------------------------VDRQ-STLRESKSRTQVLSKEIQLLK--DEKSRQVRISGIIHLHCENAVREAK------HLKEVNSLSEKNLQLRSKLE-ETERRCKTQQDQIFELKQELTNTTAELKLRLAQTE------------VFYFVFQV-DHLTRHQEDSERAL---QERILKLEGQRI--------QLEEELSRVKASLVTERAQAEEELGKVRSQVRLEEQQHLTSLEEKLRAVRQSRDESQNHCTQ-----QKQTIAELHAKVSQQSIETDSLR-------RRIDELQQD---------------------LAGKEQEKVSEVTRVRVELQEQIGHLQAERTAQGGLKEKIAALEREIKALSVAHREALLDKESEMSSLLERLRIREGEIQRIREDEAQRASFLQNAILTYVQGSPLAHFS 574          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Xenopus
Match: pth2r (parathyroid hormone 2 receptor [Source:Xenbase;Acc:XB-GENE-1018413])

HSP 1 Score: 231.491 bits (589), Expect = 3.670e-65
Identity = 195/674 (28.93%), Postives = 367/674 (54.45%), Query Frame = 1
Query:   34 IMSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGE---ISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKERE--YLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            I  ++ FK  ++ +C++    P + ++  ++    +T  K   L LS +S+S E C+VL    ++D TF ++   DCM+S D L+  L+G+  N     L LKGNN++ +G E+L + +   +++T L+LEWN +G    GF  FC GL  N++LQ LDLRNNQI     + L  ALQ+N+ L+ LD+R+N+IG+ GG+ I + FE N+ L K+ + GNNI  D++K IE     N E   + + N   N +     +  N +  +  Q +++++ ID+Q   +   ++ +  +  +L   L+ER      L A L L E+ L +   Q +++     + +K+++   +E+     +  ++++R E E +  ++ +   E+ L  ++K+ ELE     Q + VFELK ++T T +E K + +  EE+    K + ++          KE++ M       E   +E++ + +  +  L +E+S LK  +++   Q +E++ K++  +  E +Q  + L ++L+T+   +D+ ++Q  +Q + I  LQ  N++L +E+E LK + + +++EL+ K+   +S + KVR+E+  +I  LE++  +Q  L  KI   ++Q +   +  RE    + +E+ TL ++L+ ++ E+ R  E+E  RA  L NA+  +   S
Sbjct:   32 IYEMDEFKRLYVFMCQERGSEPQESVLSQMKEIREST--KRRQLDLSTQSISQESCQVLGILLQNDVTFTQVLLSDCMISEDGLKAFLQGMQSNSVIKHLDLKGNNLQAKGGEALGKFLRHTASLTSLTLEWNNLGTWENGFSFFCEGLALNQSLQKLDLRNNQINHKGAEELAMALQRNSTLQELDLRWNNIGLLGGRAIQSCFESNKALVKLELSGNNISSDVLKAIELCIKHNQERQFVKKGN--MNQQQILTKEVQNLKQDKNRQFINMMETIDKQREEMNSINRNAVLQAGKLRGTLEERTSVVNSLTAKLQLMEADLALSH-QKEQDLGDLLRQVKQQDSSMMEKHAKELMKAKEEFR-EHEAKRRRDLAAANEKNLHYRSKIDELERKCQTQQDLVFELKQELTNTTAELKLRAVQAEERFEAEKKRFRQFRDNSTTLHQKEVDHMAKHLEDAERVTQERVQRLEATKLGLEEELSRLKIMLANQHTQAEEELQKVRSFVQLE-EQHSAVLHDKLRTLTQSRDQAQNQVLQQNQMIGELQTKNNQLSLEIEVLKRRIDGIQQELATKEEEKLSALTKVRVEFHEQIGHLEAQLATQEGLREKISALERQQKVQSHQHREILLDKESEISTLMEKLRLKDAEILRIREEEAHRACLLQNAIHSFISSS 698          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Xenopus
Match: pth2r (parathyroid hormone 2 receptor [Source:Xenbase;Acc:XB-GENE-1018413])

HSP 1 Score: 205.297 bits (521), Expect = 2.301e-56
Identity = 191/673 (28.38%), Postives = 349/673 (51.86%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQL---ILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGE---ISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDAS-FQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            ++ FK  ++ +C++    P + ++  ++    +T  K   L LS +S+S E C+VL    ++D TF ++   DCM+S D   +    L+G+  N     L LKGNN++ +G E+L + +   +++T L+LEWN +G    GF  FC GL  N++LQ LDLRNNQI     + L  ALQ+N+ L+ LD+R+N+IG+ GG+ I + FE N+ L K+ + GNNI  D++K IE     N E   + + N   N +     +  N +  +  Q +++++ ID+Q   +   ++     ++Q+ K        C  LN +L +    + +  +Q K+ D+S  +K  KE           L K K+ RI+  +R  + Q +L                        VFELK ++T T +E K + +  EE+    K + ++          KE++ M       E   +E++ + +  +  L +E+S LK  +++   Q +E++ K++  +  E +Q  + L ++L+T+   +D+ ++Q  +Q + I  LQ  N++L +E+E LK + + +++EL+ K+   +S + KVR+E+  +I  LE++  +Q  L  KI   ++Q +   +  RE    + +E+ TL ++L+ ++ E+ R  E+E  RA  L NA+  +   S
Sbjct:    1 MDEFKRLYVFMCQERGSEPQESVLSQMKEIREST--KRRQLDLSTQSISQESCQVLGILLQNDVTFTQVLLSDCMISEDGKLVGLSFLQGMQSNSVIKHLDLKGNNLQAKGGEALGKFLRHTASLTSLTLEWNNLGTWENGFSFFCEGLALNQSLQKLDLRNNQINHKGAEELAMALQRNSTLQELDLRWNNIGLLGGRAIQSCFESNKALVKLELSGNNISSDVLKAIELCIKHNQERQFVKKGN--MNQQQILTKEVQNLKQDKNRQFINMMETIDKQREEMNSINR----SVVQVSK-------DC--LNCSL-VRLIDILLIPLQVKQQDSSMMEKHAKE-----------LMKAKEVRIDELERKCQTQQDL------------------------VFELKQELTNTTAELKLRAVQAEERFEAEKKRFRQFRDNSTTLHQKEVDHMAKHLEDAERVTQERVQRLEATKLGLEEELSRLKIMLANQHTQAEEELQKVRSFVQLE-EQHSAVLHDKLRTLTQSRDQAQNQVLQQNQMIGELQTKNNQLSLEIEVLKRRIDGIQQELATKEEEKLSALTKVRVEFHEQIGHLEAQLATQEGLREKISALERQQKVQSHQHREILLDKESEISTLMEKLRLKDAEILRIREEEAHRACLLQNAIHSFISSS 619          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Xenopus
Match: pth2r (parathyroid hormone 2 receptor [Source:Xenbase;Acc:XB-GENE-1018413])

HSP 1 Score: 197.978 bits (502), Expect = 9.745e-54
Identity = 189/687 (27.51%), Postives = 340/687 (49.49%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGE---ISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESK---LEMYEIQFKENDASF-QKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISS-------LKNQISS----DRI---QHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            ++ FK  ++ +C++    P + ++  ++    +T  K   L LS +S+S E C+VL    ++D TF ++   DCM+S D L+  L+G+  N     L LKGNN++ +G E+L + +   +++T L+LEWN +G    GF  FC GL  N++LQ LDLRNNQI     + L  ALQ+N+ L+ LD+R+N+IG+ GG+ I + FE N+ L K+ + GNNI  D++K IE     N E   + + N   N +     +  N +  +  Q +++++ ID+Q   +   ++     ++Q+         + Q + A+L L+  K   L     Q K+ D+S  +K  KE           L K K+ RI+  +R  + Q +L                        VFELK ++T T +E K + +  EE+    K + ++          KE++ M       E   +E++ + +  +  L +  SS       L  Q+++    D I   QH   +H   + L   +DQ  +++ +Q + +     E++++NN+ + EIE L++              + + +++EL+ K+   +S + KVR+E+  +I  LE++  +Q  L  KI   ++Q +   +  RE    + +E+ TL ++L+ ++ E+ R  E+E  RA  L NA+  +   S
Sbjct:    1 MDEFKRLYVFMCQERGSEPQESVLSQMKEIREST--KRRQLDLSTQSISQESCQVLGILLQNDVTFTQVLLSDCMISEDGLKAFLQGMQSNSVIKHLDLKGNNLQAKGGEALGKFLRHTASLTSLTLEWNNLGTWENGFSFFCEGLALNQSLQKLDLRNNQINHKGAEELAMALQRNSTLQELDLRWNNIGLLGGRAIQSCFESNKALVKLELSGNNISSDVLKAIELCIKHNQERQFVKKGN--MNQQQILTKEVQNLKQDKNRQFINMMETIDKQREEMNSINRS----VVQV---------RLQLMEADLALSHQKEQDLGDLLRQVKQQDSSMMEKHAKE-----------LMKAKEVRIDELERKCQTQQDL------------------------VFELKQELTNTTAELKLRAVQAEERFEAEKKRFRQFRDNSTTLHQKEVDHMAKHLEDAERVTQERVQRLEATKLGLEEVRSSGGHMELFLCRQVAAALFLDYIAFQQHSAVLHDKLRTLTQSRDQAQNQVLQQNQMI----GELQTKNNQLSLEIEVLKR--------------RIDGIQQELATKEEEKLSALTKVRVEFHEQIGHLEAQLATQEGLREKISALERQQKVQSHQHREILLDKESEISTLMEKLRLKDAEILRIREEEAHRACLLQNAIHSFISSS 617          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Xenopus
Match: pth2r (parathyroid hormone 2 receptor [Source:Xenbase;Acc:XB-GENE-1018413])

HSP 1 Score: 197.208 bits (500), Expect = 1.139e-53
Identity = 175/604 (28.97%), Postives = 328/604 (54.30%), Query Frame = 1
Query:  253 FKDCMLSP---DCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGE---ISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKERE--YLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
             +DC LS    + L+  L+G+  N     L LKGNN++ +G E+L + +   +++T L+LEWN +G    GF  FC GL  N++LQ LDLRNNQI     + L  ALQ+N+ L+ LD+R+N+IG+ GG+ I + FE N+ L K+ + GNNI  D++K IE     N E   + + N   N +     +  N +  +  Q +++++ ID+Q   +   ++ +  +  +L   L+ER      L A L L E+ L +   Q +++     + +K+++   +E+     +  ++++R E E +  ++ +   E+ L  ++K+ ELE     Q + VFELK ++T T +E K + +  EE+    K + ++          KE++ M       E   +E++ + +  +  L +E+S LK  +++   Q +E++ K++  +  E+ Q  + L ++L+T+   +D+ ++Q  +Q + I  LQ  N++L +E+E LK + + +++EL+ K+   +S + KVR+E+  +I  LE++  +Q  L  KI   ++Q +   +  RE    + +E+ TL ++L+ ++ E+ R  E+E  RA  L NA+  +   S
Sbjct:    1 MQDCWLSAQHSEGLKAFLQGMQSNSVIKHLDLKGNNLQAKGGEALGKFLRHTASLTSLTLEWNNLGTWENGFSFFCEGLALNQSLQKLDLRNNQINHKGAEELAMALQRNSTLQELDLRWNNIGLLGGRAIQSCFESNKALVKLELSGNNISSDVLKAIELCIKHNQERQFVKKGN--MNQQQILTKEVQNLKQDKNRQFINMMETIDKQREEMNSINRNAVLQAGKLRGTLEERTSVVNSLTAKLQLMEADLALSH-QKEQDLGDLLRQVKQQDSSMMEKHAKELMKAKEEFR-EHEAKRRRDLAAANEKNLHYRSKIDELERKCQTQQDLVFELKQELTNTTAELKLRAVQAEERFEAEKKRFRQFRDNSTTLHQKEVDHMAKHLEDAERVTQERVQRLEATKLGLEEELSRLKIMLANQHTQAEEELQKVRSFVQLEEQQHSAVLHDKLRTLTQSRDQAQNQVLQQNQMIGELQTKNNQLSLEIEVLKRRIDGIQQELATKEEEKLSALTKVRVEFHEQIGHLEAQLATQEGLREKISALERQQKVQSHQHREILLDKESEISTLMEKLRLKDAEILRIREEEAHRACLLQNAIHSFISSS 600          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Xenopus
Match: hcn4 (hyperpolarization activated cyclic nucleotide gated potassium channel 4 [Source:Xenbase;Acc:XB-GENE-940130])

HSP 1 Score: 70.4774 bits (171), Expect = 4.132e-12
Identity = 41/110 (37.27%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  337 LKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTL 666
            L  NN+   G ++LA  ++ N T+ +LSL  N VG    G    CN L+ N+TLQ L L +N++       L++AL  N +L+ L +  N IG  GGK +L     N TL
Sbjct:  312 LSNNNVGAHGAQALAHALTNNWTLRNLSLRLNHVG--NEGGQALCNALLPNQTLQELHLGSNELSEPTASALSQALTHNGSLRRLSLACNRIGPDGGKQLLEGMSDNETL 419          

HSP 2 Score: 55.0694 bits (131), Expect = 3.343e-7
Identity = 39/142 (27.46%), Postives = 60/142 (42.25%), Query Frame = 1
Query:  376 LARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKR 801
            L R +  +  +  L L  NQV   G    +    L+    L+VLDL NN +G    Q L  AL  N  L+ L +R N +G  GG+ + N    N+TL ++ +  N +       +      NG +   +   N      GK+
Sbjct:  270 LVRSLLNHPALVHLDLSHNQVSDRGA---RAIAKLLKESALRVLDLSNNNVGAHGAQALAHALTNNWTLRNLSLRLNHVGNEGGQALCNALLPNQTLQELHLGSNELSEPTASALSQALTHNGSLRRLSLACNRIGPDGGKQ 408          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Mouse
Match: Lrrc45 (leucine rich repeat containing 45 [Source:MGI Symbol;Acc:MGI:2387183])

HSP 1 Score: 266.544 bits (680), Expect = 1.689e-78
Identity = 191/667 (28.64%), Postives = 364/667 (54.57%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKR-NNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            +E F+  +  LC++    P + ++Q +             L L+ +S++ E C+ L +    +T  +E+   DCMLS +   L+ +GL  N     L LKGNN++  G E+L +L+ +N +I  L+LEWN +G     F  FC GL  N  L+ LDLRNNQI     + L  AL+ NT L+ LD+R+N+IG+ GG+ ++N    NRTL K+ + GNNIP DI++ +E   + N +   A   + +R+    K   + +  +  Q LDL++ ID+Q   +    + S  ++ QL++ L+ER+     L A L + E+ L + E + ++         +ER+ L +++  +   E+    + E + L++ S   E+ L L+++V ELE     Q   +F  K ++T T++E K + +  EE++   K + K+ M ++ +   KE++ M      +E   +E++ + + +R  L +E+S +K  + S+R Q +E++ K + +   E+  +++ L+E+++ +   +DE +    +Q + +   Q   S+L +++E  + + E L++EL  K    ++E+ +VR+E   ++ +++++  +Q  L  K+   ++Q++ + +  RE    R +E  +L+++L+ +E E++R  ++E  RAS L NAV+ Y Q S
Sbjct:    1 MEEFRRSYNRLCEESGAEPQEAVLQQLHQLPKGG------LDLTTQSLTVETCRALGKLLHKETLLKELVLSDCMLSEEGSTLLFQGLCANTSVQHLDLKGNNLRATGAEALGKLLRQNKSIQSLTLEWNNLGTWEDAFATFCGGLAANSALRQLDLRNNQISHKGAEELALALKGNTTLQQLDLRWNNIGLLGGRALVNCLPSNRTLWKLDLAGNNIPGDILRAVEQAMDHNQDRLTAFRENQARTKILSKEVQHLQEEKSKQFLDLMETIDKQREEMARDSRASAVRVGQLQEALNERQSIINALKAKLQMTEAALALSEQKVRDLGELLVAGDQERQSLSQRHEKERKLERQEAADRESKLLRDLSAASEKNLLLRSQVDELERKARSQQEQLFLTKQELTNTSAELKIRAIQAEERLDVEKRRAKQNMEDLEKLHSKEVDHMTRHLEESERAMQERVQRLEALRLSLEEELSRMKAAVLSERGQAEEELIKARNQARLEEQHRLAHLEEKIRLLAQARDEAQGTCVQQKQMVAESQARVSQLNLQMEGQQRRLEELQQELINKDQEKVAEVARVRVELQEQMGRMQADLVAQEALREKVAALERQMKVIGSEHREALLDRESENASLREKLRLKEAEISRIRDEEAQRASFLQNAVLAYVQGS 661          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Mouse
Match: Lrrc45 (leucine rich repeat containing 45 [Source:MGI Symbol;Acc:MGI:2387183])

HSP 1 Score: 202.601 bits (514), Expect = 2.602e-57
Identity = 129/418 (30.86%), Postives = 222/418 (53.11%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKR-NNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYE 1293
            +E F+  +  LC++    P + ++Q +             L L+ +S++ E C+ L +    +T  +E+   DCMLS +   L+ +GL  N     L LKGNN++  G E+L +L+ +N +I  L+LEWN +G     F  FC GL  N  L+ LDLRNNQI     + L  AL+ NT L+ LD+R+N+IG+ GG+ ++N    NRTL K+ + GNNIP DI++ +E   + N +   A   + +R+    K   + +  +  Q LDL++ ID+Q   +    + S  ++ QL++ L+ER+     L A L + E+ L + E + ++         +ER+ L +++  +   E+    + E + L++ S   E+ L L+++V ELE     Q   +F  K ++T T++E K + +  E
Sbjct:    1 MEEFRRSYNRLCEESGAEPQEAVLQQLHQLPKGG------LDLTTQSLTVETCRALGKLLHKETLLKELVLSDCMLSEEGSTLLFQGLCANTSVQHLDLKGNNLRATGAEALGKLLRQNKSIQSLTLEWNNLGTWEDAFATFCGGLAANSALRQLDLRNNQISHKGAEELALALKGNTTLQQLDLRWNNIGLLGGRALVNCLPSNRTLWKLDLAGNNIPGDILRAVEQAMDHNQDRLTAFRENQARTKILSKEVQHLQEEKSKQFLDLMETIDKQREEMARDSRASAVRVGQLQEALNERQSIINALKAKLQMTEAALALSEQKVRDLGELLVAGDQERQSLSQRHEKERKLERQEAADRESKLLRDLSAASEKNLLLRSQVDELERKARSQQEQLFLTKQELTNTSAELKIRAIQAE 412          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Mouse
Match: Lrrc45 (leucine rich repeat containing 45 [Source:MGI Symbol;Acc:MGI:2387183])

HSP 1 Score: 108.612 bits (270), Expect = 5.794e-27
Identity = 56/162 (34.57%), Postives = 87/162 (53.70%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQI 528
            +E F+  +  LC++    P + ++Q +             L L+ +S++ E C+ L +    +T  +E+   DCMLS +   L+ +GL  N     L LKGNN++  G E+L +L+ +N +I  L+LEWN +G     F  FC GL  N  L+ LDLRNNQI
Sbjct:    1 MEEFRRSYNRLCEESGAEPQEAVLQQLHQLPKGG------LDLTTQSLTVETCRALGKLLHKETLLKELVLSDCMLSEEGSTLLFQGLCANTSVQHLDLKGNNLRATGAEALGKLLRQNKSIQSLTLEWNNLGTWEDAFATFCGGLAANSALRQLDLRNNQI 156          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Mouse
Match: Nlrc3 (NLR family, CARD domain containing 3 [Source:MGI Symbol;Acc:MGI:2444070])

HSP 1 Score: 68.1662 bits (165), Expect = 1.309e-11
Identity = 51/180 (28.33%), Postives = 85/180 (47.22%), Query Frame = 1
Query:  163 LTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWN--QVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI 696
            L L   S+S     VL      + T   ++ ++  +SP+  Q + + L  N     L L  N + ++G +++A  +  N ++T L L+WN  Q G +          L  N+TL  LDL+ N IG +    +  AL+ NT L  L ++  SIG  G + +      NRTL  + + GN++
Sbjct:  143 LDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQWNFIQAGAA----RALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDV 318          

HSP 2 Score: 61.2326 bits (147), Expect = 2.547e-9
Identity = 46/157 (29.30%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSI 612
            +N  L  L L E S+S E  + L++    + T + +     +L     Q I   + +N     L L+ N I+     +L + +  N T+T L L+ N +G  G         L  N TL  L L+   IG    Q L EAL  N  L++LD+R N +
Sbjct:  164 SNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQWNFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGA--SSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDV 318          

HSP 3 Score: 59.3066 bits (142), Expect = 9.789e-9
Identity = 46/170 (27.06%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  166 TLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            +L+E  +  +  K L+     + +   +  +   + P   + + + L  N     L L+ N IK+ G   +A  +  N TI+ L L+ N +G+   G  Q  + L  N++L+ L   +N IG      L EAL+ N  L+ LD++ NSI   G  +++     N+TLS +
Sbjct:    4 SLAENQIGNKGAKALARSLLVNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGL--IGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSL 171          

HSP 4 Score: 54.6842 bits (130), Expect = 3.186e-7
Identity = 50/204 (24.51%), Postives = 82/204 (40.20%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVG--------------------------ISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
             N  L  L L   S+     K L++  + + T   +S +  ++  D +  + E L  N     L L+ N I   G + +A  + +N ++  L    N +G                          IS  G       L +N+TL  L+LR N I  +  Q LT+AL +N  LK LD+  N +   G + I     +N +L+ +
Sbjct:   24 VNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHL 227          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Mouse
Match: Nlrc3 (NLR family, CARD domain containing 3 [Source:MGI Symbol;Acc:MGI:2444070])

HSP 1 Score: 68.5514 bits (166), Expect = 2.873e-11
Identity = 50/178 (28.09%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  163 LTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI 696
            L L   S+S     VL      + T   ++ ++  +SP+  Q + + L  N     L L  N + ++G +++A  +  N ++T L L+WN   I           L  N+TL  LDL+ N IG +    +  AL+ NT L  L ++  SIG  G + +      NRTL  + + GN++
Sbjct:  848 LDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQWNF--IQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDV 1023          

HSP 2 Score: 62.3882 bits (150), Expect = 1.962e-9
Identity = 55/232 (23.71%), Postives = 107/232 (46.12%), Query Frame = 1
Query:  103 DFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK 798
            D +++ + S     + ++  ++L+E  +  +  K L+     + +   +  +   + P   + + + L  N     L L+ N IK+ G   +A  +  N TI+ L L+ N +G+   G  Q  + L  N++L+ L   +N IG      L EAL+ N  L+ LD++ NSI   G  +++     N+TLS + +  N+I  +  + +     RN  +   +  +N   DR  +
Sbjct:  688 DPVMELLGSVLSGKDCRIRKISLAENQIGNKGAKALARSLLVNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGL--IGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQ 917          

HSP 3 Score: 59.6918 bits (143), Expect = 1.493e-8
Identity = 46/157 (29.30%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSI 612
            +N  L  L L E S+S E  + L++    + T + +     +L     Q I   + +N     L L+ N I+     +L + +  N T+T L L+ N +G  G         L  N TL  L L+   IG    Q L EAL  N  L++LD+R N +
Sbjct:  869 SNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQWNFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGA--SSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDV 1023          

HSP 4 Score: 53.9138 bits (128), Expect = 9.384e-7
Identity = 50/204 (24.51%), Postives = 82/204 (40.20%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVG--------------------------ISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
             N  L  L L   S+     K L++  + + T   +S +  ++  D +  + E L  N     L L+ N I   G + +A  + +N ++  L    N +G                          IS  G       L +N+TL  L+LR N I  +  Q LT+AL +N  LK LD+  N +   G + I     +N +L+ +
Sbjct:  729 VNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHL 932          
BLAST of Leucine-rich repeat-containing protein 45 vs. UniProt/SwissProt
Match: sp|Q5ZI11|LRC45_CHICK (Leucine-rich repeat-containing protein 45 OS=Gallus gallus OX=9031 GN=LRRC45 PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 1.025e-81
Identity = 200/677 (29.54%), Postives = 370/677 (54.65%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGE----ISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPSIQSSFAL 2061
            +E F+  +  LC      P + +++ ++    A       L L+E+S+S E C  L         F E++  DC LS D ++L+L GL  N     L LKGNN++  G E+L +L+ +N +I  L LEWN +G+   GF  FC GL  N  LQ LDLRNNQI       L  AL++N +L+ LD+R+N+IG+ GG+ +LN  + N+TL K+ + GNN+P DI+K +E   + N +    +SE   R++  S    +  N ++ +  Q LDL+D ID+Q   +  S + S  ++ QL++ L+E+      L A L + E+ L + E +          + +E+  +  ++  +L ++K    + E +  ++ S   E+ L L+N+V ELE     Q + +F+LK  +T T +E K + +  EE++   K + K+ + ++   + KE++ +      +E   ++++ + + IR  L +E+S +K    ++R   +E++ K++ +   E+ Q++  L+E+L+ M   +DE ++   +Q + +   Q   ++L +  + L+ + E L+++L+ K+   ++E+ KV++E   +I  L++ER +Q  L  KI   ++Q++ + ++ RE    +  E+  L ++L+ +E +++R  E+E  RAS L NA+M Y Q S   + +L
Sbjct:    1 MEEFRRAYAKLCA----APQEAVLRRLRERGEAPGR--ARLDLAEQSLSLETCGALGRLLPGAAHFAEVALGDCGLSEDGVKLLLHGLCSNSTVKSLDLKGNNLRTTGAEALGKLLRQNKSIRSLILEWNSLGVWEEGFSFFCQGLGANNFLQRLDLRNNQINHHGAGELAMALKRNASLQELDLRWNNIGLLGGRALLNCLQSNKTLKKLELAGNNVPSDILKAVEQAMDHNRDRQTILSETQNRTSVLSK---EILNLKDEKTKQFLDLMDTIDKQREEIARSGRISAGRVSQLQEALNEQHSIMNSLKAKLQMTEAALALSEQKVHNLGELLSATKQEQASMAERHFAELQQQKQEGADREGKLFRDLSASNEKNLFLRNQVDELEKKCKVQQDQIFQLKQDLTNTTAELKLRAVQAEERLEMEKRRFKQSLEDMESLRLKEVDHLTQHMEASERSMQDRVQRLEAIRIALEEELSQVKAAALTERGHAEEELIKVRNQARLEEQQRVEHLEEKLRLMTEARDEAQNCCLKQKQMVGEAQVKANQLNLHADGLRRRIEELQQDLNSKEQEKVTEVNKVKVELQEQIGHLQAERTAQEGLREKIAALERQLKVLSSNHREALLDKEGEISMLMEKLRMKEADISRMKEEEAQRASILQNAIMAYVQGSSLGTHSL 668          
BLAST of Leucine-rich repeat-containing protein 45 vs. UniProt/SwissProt
Match: sp|Q8CIM1|LRC45_MOUSE (Leucine-rich repeat-containing protein 45 OS=Mus musculus OX=10090 GN=Lrrc45 PE=2 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 1.181e-77
Identity = 191/667 (28.64%), Postives = 364/667 (54.57%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKR-NNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            +E F+  +  LC++    P + ++Q +             L L+ +S++ E C+ L +    +T  +E+   DCMLS +   L+ +GL  N     L LKGNN++  G E+L +L+ +N +I  L+LEWN +G     F  FC GL  N  L+ LDLRNNQI     + L  AL+ NT L+ LD+R+N+IG+ GG+ ++N    NRTL K+ + GNNIP DI++ +E   + N +   A   + +R+    K   + +  +  Q LDL++ ID+Q   +    + S  ++ QL++ L+ER+     L A L + E+ L + E + ++         +ER+ L +++  +   E+    + E + L++ S   E+ L L+++V ELE     Q   +F  K ++T T++E K + +  EE++   K + K+ M ++ +   KE++ M      +E   +E++ + + +R  L +E+S +K  + S+R Q +E++ K + +   E+  +++ L+E+++ +   +DE +    +Q + +   Q   S+L +++E  + + E L++EL  K    ++E+ +VR+E   ++ +++++  +Q  L  K+   ++Q++ + +  RE    R +E  +L+++L+ +E E++R  ++E  RAS L NAV+ Y Q S
Sbjct:    1 MEEFRRSYNRLCEESGAEPQEAVLQQLHQLPKGG------LDLTTQSLTVETCRALGKLLHKETLLKELVLSDCMLSEEGSTLLFQGLCANTSVQHLDLKGNNLRATGAEALGKLLRQNKSIQSLTLEWNNLGTWEDAFATFCGGLAANSALRQLDLRNNQISHKGAEELALALKGNTTLQQLDLRWNNIGLLGGRALVNCLPSNRTLWKLDLAGNNIPGDILRAVEQAMDHNQDRLTAFRENQARTKILSKEVQHLQEEKSKQFLDLMETIDKQREEMARDSRASAVRVGQLQEALNERQSIINALKAKLQMTEAALALSEQKVRDLGELLVAGDQERQSLSQRHEKERKLERQEAADRESKLLRDLSAASEKNLLLRSQVDELERKARSQQEQLFLTKQELTNTSAELKIRAIQAEERLDVEKRRAKQNMEDLEKLHSKEVDHMTRHLEESERAMQERVQRLEALRLSLEEELSRMKAAVLSERGQAEEELIKARNQARLEEQHRLAHLEEKIRLLAQARDEAQGTCVQQKQMVAESQARVSQLNLQMEGQQRRLEELQQELINKDQEKVAEVARVRVELQEQMGRMQADLVAQEALREKVAALERQMKVIGSEHREALLDRESENASLREKLRLKEAEISRIRDEEAQRASFLQNAVLAYVQGS 661          
BLAST of Leucine-rich repeat-containing protein 45 vs. UniProt/SwissProt
Match: sp|Q96CN5|LRC45_HUMAN (Leucine-rich repeat-containing protein 45 OS=Homo sapiens OX=9606 GN=LRRC45 PE=1 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 3.402e-77
Identity = 199/673 (29.57%), Postives = 361/673 (53.64%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNY---ENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKD----KEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            +E F+  +  LC++    P + ++Q +             L L+ +S++ E C+ L +    +T   E+   DCMLS +   L+L GL  N     L LKGNN++  G E+L +L+ +N +I  L+LEWN +G     F  FC GL  N  LQ LDLRNNQI     + L  AL+ NT L+ LD+R+N++G+ GG+ ++N    NRTL ++ + GNNIP D+++ +E     + +     + + +R+    K   +   E S+  Q LDL++ ID+Q   +  S + S +++ QL++ L+ER      L A L + E+ L + E + ++       + +E+  L ++   +L  E+    E E + L++ S   E+ L LQN+V ELE     Q   +F+ + ++T  ++E K + +  EE++    D  K+   + +E  +    KE+  M      +E+  +E++ + +  R  L +E+S +K    S+R Q +E++ K K +   E+ Q+++ L+++L+ +   +DE +    +Q + +   Q   S+L +++E L+ + E L++ELS K    ++E+ +VR+E   +  +L++E  +Q  L  K    ++Q++ M +  RE    R +E  +L+++L+ +E E+ R  ++E  RAS L NAV+ Y Q S
Sbjct:    1 MEEFRRSYSRLCRESGAEPQEAVLQQLHQLPRGR------LDLATQSLTVETCRALGKLLPRETLCTELVLSDCMLSEEGATLLLRGLCANTVLRFLDLKGNNLRAAGAEALGKLLQQNKSIQSLTLEWNSLGTWDDAFATFCGGLAANGALQRLDLRNNQISHKGAEELALALKGNTTLQQLDLRWNNVGLLGGRALMNCLPSNRTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSK--QFLDLMETIDKQREEMAKSSRASAARVGQLQEALNERHSIINALKAKLQMTEAALALSEQKAQDLGELLATAEQEQLSLSQRQAKELKLEQQEAAERESKLLRDLSAANEKNLLLQNQVDELERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERL----DMEKRRCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSERGQAEEELIKAKSQARLEEQQRLAHLEDKLRLLAQARDEAQGACLQQKQVVAEAQTRVSQLGLQVEGLRRRLEELQQELSLKDQERVAEVSRVRVELQEQNGRLQAELAAQEALREKAAALERQLKVMASDHREALLDRESENASLREKLRLREAEIARIRDEEAQRASFLQNAVLAYVQAS 661          
BLAST of Leucine-rich repeat-containing protein 45 vs. UniProt/SwissProt
Match: sp|Q7RTR2|NLRC3_HUMAN (NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 6.698e-13
Identity = 64/245 (26.12%), Postives = 98/245 (40.00%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQV--------------------------GISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK 798
             N  L  L L   S+S      L      + T   +S ++  +SP+  Q I   L  N     L L  N + +QG  ++A  +  N T+T L L+WN +                           I   G       L  N  L  L L+   IG    Q+L EAL  N  L++LD+R N+IGV+G K + N  + N +L ++ +  N++ MD    I    + N  +   N + N   D   +
Sbjct:  804 VNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALSGNHRLQHINLQGNHIGDSGAR 1048          

HSP 2 Score: 68.9366 bits (167), Expect = 1.364e-10
Identity = 53/178 (29.78%), Postives = 90/178 (50.56%), Query Frame = 1
Query:  253 FKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSD 786
            F+D ++  + L  +L G   +C   K+ L  N I N+G ++LAR +  N ++T L L  N +G  G       + L  N+TL  L L+ N +  D  + + EAL  N  L +L ++ NSIG  G + + +  ++NR+L +++   N+I     K +      N  +   + +SNS SD
Sbjct:  649 FQDPVM--ELLGSVLSG--KDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGA--KALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISD 820          

HSP 3 Score: 68.9366 bits (167), Expect = 1.376e-10
Identity = 49/208 (23.56%), Postives = 102/208 (49.04%), Query Frame = 1
Query:  103 DFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIEN 726
            D +++ + S     + ++  ++L+E  +S +  K L+     + +   +  +   + P   + + + L  N     L L+GN +++ G  S+A  ++ N T++ L L+ N +G  G    +  + L  N++L+ L   +N IG    + L EAL+ N  L+ LD++ NSI  +G   ++     N+TL  + +  N+I  +  + I +
Sbjct:  651 DPVMELLGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGA--QRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAH 856          

HSP 4 Score: 60.4622 bits (145), Expect = 5.695e-8
Identity = 47/177 (26.55%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            N  L  L+L   ++  +  + ++E    + T   +  +   + P   Q + + L  N    +L    N+I + G ++LA  +  N  +  L L+ N   IS  G       L  N+TL  L LR N I  +  Q +  AL  N+ LK LD+  N +   G + I     +NRTL+ +
Sbjct:  721 NRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNS--ISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSL 895          

HSP 5 Score: 55.4546 bits (132), Expect = 2.133e-6
Identity = 55/178 (30.90%), Postives = 86/178 (48.31%), Query Frame = 1
Query:  322 CIKLCLKGNNIKNQGCESLARLIS-RNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI-PMDIIKNIENLANRNGEISEANERSNSRSDRNGK--RNNYENSRKLQTLDL 843
            C KL L  N  ++   E L  ++S ++  I  +SL  NQ  IS  G       L+ N++L  LDLR N IG    + L +AL+ N  L  L ++ N++   G + +      NRTLS + +  N+I PM   +  + L  +N  + E    SNS  D   K      + ++ L++LDL
Sbjct:  639 CRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISLAENQ--ISNKGAKALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADAL-KQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDL 813          
BLAST of Leucine-rich repeat-containing protein 45 vs. UniProt/SwissProt
Match: sp|Q5DU56|NLRC3_MOUSE (Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.091e-10
Identity = 50/178 (28.09%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  163 LTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI 696
            L L   S+S     VL      + T   ++ ++  +SP+  Q + + L  N     L L  N + ++G +++A  +  N ++T L L+WN   I           L  N+TL  LDL+ N IG +    +  AL+ NT L  L ++  SIG  G + +      NRTL  + + GN++
Sbjct:  810 LDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQWNF--IQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDV 985          

HSP 2 Score: 62.3882 bits (150), Expect = 1.324e-8
Identity = 55/232 (23.71%), Postives = 107/232 (46.12%), Query Frame = 1
Query:  103 DFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK 798
            D +++ + S     + ++  ++L+E  +  +  K L+     + +   +  +   + P   + + + L  N     L L+ N IK+ G   +A  +  N TI+ L L+ N +G+ G    Q  + L  N++L+ L   +N IG      L EAL+ N  L+ LD++ NSI   G  +++     N+TLS + +  N+I  +  + +     RN  +   +  +N   DR  +
Sbjct:  650 DPVMELLGSVLSGKDCRIRKISLAENQIGNKGAKALARSLLVNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGA--QQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQ 879          

HSP 3 Score: 59.6918 bits (143), Expect = 9.910e-8
Identity = 46/157 (29.30%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSI 612
            +N  L  L L E S+S E  + L++    + T + +     +L     Q I   + +N     L L+ N I+     +L + +  N T+T L L+ N +G  G         L  N TL  L L+   IG    Q L EAL  N  L++LD+R N +
Sbjct:  831 SNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQWNFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGA--SSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDV 985          

HSP 4 Score: 53.5286 bits (127), Expect = 6.678e-6
Identity = 50/204 (24.51%), Postives = 82/204 (40.20%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVG--------------------------ISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
             N  L  L L   S+     K L++  + + T   +S +  ++  D +  + E L  N     L L+ N I   G + +A  + +N ++  L    N +G                          IS  G       L +N+TL  L+LR N I  +  Q LT+AL +N  LK LD+  N +   G + I     +N +L+ +
Sbjct:  691 VNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHL 894          
BLAST of Leucine-rich repeat-containing protein 45 vs. TrEMBL
Match: A0A3S1AUP5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_019570 PE=4 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 3.394e-103
Identity = 231/664 (34.79%), Postives = 393/664 (59.19%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKR-NNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYC 2031
            +E+F++ ++ LCK   + P + +++ ++S    +  K   L LS  S+S + C VL +    D TF EI F DCML+ D ++ + +GL+ N  C KL LKGNNI+    E+L +++ +N T+  + LEWN +G+  + F  FC+G+ ++ +L  LDLRNNQI  D+   L  AL++N +LK LD+R+N+ G+ GG+ +L + + N+TLS++ I GNNIP D+ K+IE     N +     E +  R+    K   N E  RKLQ  DLL  +DEQ + LR S + S  +I  L+  LDERK     L A L++AE++L + E +  + +++  +   E + +   +   + +EK+ R   + +FLKE S LQ++  QLQ KV +L+    QQ   V++L++ +T   SE   K   +EE+I + K ++K+ M +  + K KEM +++ E    E   RE++ K ++ R ++ +EIS LK    +D++ ++E +  +K +L +E++Q+  +L+E+++ +Q  KDE++S  N+Q   +  LQ  NS L++ELE+LK + + L +ELS K +   +E+EKV++E    + KLE ER +Q +L  K+   D Q+ E     R+    ++ E+ TL+++LK +++EL R  E+E  R   L +A++ Y 
Sbjct:    2 MEDFRHIYIRLCKDHHVDPQECVLEKLKSLEKKSTGK-AILDLSTNSLSPKTCAVLGKALVADRTFIEIKFSDCMLAEDAVKGLAQGLAFNTFCRKLDLKGNNIRGASTEALGKMLRQNKTLVSMCLEWNGMGMLDSSFAVFCDGVGSSTSLMALDLRNNQISHDSVIELAAALKRNVHLKALDLRWNNCGLLGGRALLEMLQSNKTLSRLEIAGNNIPSDVSKSIETAVQNNADRQAIVEENLKRTQTMAKHIRNVEQDRKLQLNDLLTTLDEQETLLRKSKRASTEQIGNLQFALDERKGAFNSLAAKLSMAETELALSEQKVSDFNSTVNRLKAEMQEMAANHVNDIRREKEERANEDLKFLKEISELQDKNTQLQTKVEDLDRKCRQQQEQVYDLREHLTHAQSEVTLKGSQFEERITQEKARHKEAMRDQDQYKQKEMARLKQEGEDMERILRERISKLEQHRLDMEEEISRLKATNVADKLNNEEQVSSLKHRLKSEEEQRHVQLEEKIRVLQTSKDELQSHCNQQTASLTQLQHRNSNLQLELENLKRQMQELNQELSQKNSQTYAEVEKVKVELNKALSKLEQERSTQSELRDKLASVDSQMSEQLLKHRKIVEEKDKEIVTLEEKLKGRDLELVRMREEEAQRVQVLQSAILNYV 664          
BLAST of Leucine-rich repeat-containing protein 45 vs. TrEMBL
Match: A0A1S3IM07 (leucine-rich repeat-containing protein 45 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106165548 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 1.772e-101
Identity = 227/680 (33.38%), Postives = 401/680 (58.97%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNYEN-----SRKLQTL---------DLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            ++ FK+ +L LC++  + P D +++ ++    +       L LS  S+S + C VL +    D TF EI   DCML+ D ++ +  GL++N  C +L LKGNN++  G E+LAR++  N ++T L LEWN +G+    F  FC  L  N TL+ LDLRNNQI  D  Q L  AL++NT L+ +D+R+N++G+ GG+ +L    +N+T+ K+ + GNNIP D++++I+     N              DR    N+Y       S +L+TL         +L+ +IDEQ   +R + + S  KI QL+  L+ERK   + L A L++ ES+L + + +  + +    +  +++  L  ++   L +E++ R  +E R L+E S   +R +QL+ K  EL     QQ + +++LK+++T   ++ K K   YEE++   K +NK+ + EV   K +E+ K++ +++  E++ RE++ K +  R EL +E+S LK+Q ++DRI+ +E++  +KQK+ ++++Q+  +L+++++ +Q  KDE++S +N Q   I  LQ  NS +++ELE+ K + +    ELSGK   MM+E+ KV+LE   ++ +LE+ERQ+Q +L  +IE   +QI E     RE  + +  E+++L+++++ ++ EL R  E++  R+S L +A+M Y   S
Sbjct:    1 MDEFKSAYLRLCREYNVEPHDALMKQLKIIPTSPRKGKQSLKLSSVSLSPKTCTVLGKVLATDHTFTEIKLADCMLNEDAVKSLAYGLAENVVCKRLDLKGNNVRGTGTEALARMLRHNKSLTSLCLEWNAMGMIDNSFGTFCEALAVNTTLKELDLRNNQISHDGAQELASALKRNTTLQAIDLRWNNVGIIGGRALLEALRRNKTIYKLSLAGNNIPTDVLQSIDTALGHN-------------EDRQLMSNDYYQRTHMLSSELRTLKEEKMMQMSELMGKIDEQEDFMRKTTRSSSHKIGQLQSALEERKAAFESLKAKLSMVESELALEQQKSHDLEGLVARMKQDQSELSSRHQSDLRQEREDRASVESRLLRELSEANDRNVQLEAKEDELSRKCKQQQDQIYDLKEQLTHAQADIKLKGAQYEEKLNNEKQKNKEILQEVESLKTREIAKLQQDFDDTEKQLRERINKLERQRLELEEEVSKLKSQAAADRIKAEEELATVKQKIRSDEEQRQKQLEDRMRLLQQSKDELQSHSNHQKALILELQGKNSSMELELETHKRRIDAQNTELSGKNNEMMAEVGKVKLEVKQKMAQLETERQAQNELKEEIERLKRQISEQTGKHRELIHDKEREIESLQEKVREKDKELIRMREEDAQRSSMLQSAIMTYVARS 667          
BLAST of Leucine-rich repeat-containing protein 45 vs. TrEMBL
Match: A0A1S3INX5 (leucine-rich repeat-containing protein 45 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106165548 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.842e-99
Identity = 224/680 (32.94%), Postives = 397/680 (58.38%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNYEN-----SRKLQTL---------DLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            ++ FK+ +L LC++  + P D +++ ++    +       L LS  S+S + C VL +    D TF EI   DCML+ D ++ +  GL++N  C +L LKGNN++  G E+LAR++  N ++T L LEWN +G+    F  FC  L  N TL+ LDLRNNQI  D  Q L  AL++NT L+ +D+R+N++G+ GG+ +L    +N+T+ K+ + GNNIP D++++I+     N              DR    N+Y       S +L+TL         +L+ +IDEQ   +R + + S  KI QL+  L+ERK   + L A L++ ES+L + + +  + +    +  +++  L  ++   L +E++ R  +E R L+E S   +R +QL+ K  EL     QQ + +++LK+++T   ++ K K   YEE+    K +NK+ + E+   K +E+ K++ +++  E++ RE++ K +  R EL +E+S LK+Q ++DRI+ +E++  +K K+ ++++Q+  +L+++++ +Q  KDE++S +N Q   I  LQ  NS + +ELE+ K + +    ELSGK   MM+E+ KV+LE   ++ +LE+ERQ+Q +L  +I    +QI E     RE  + +  E+++L+++++ ++ EL R  E++  R+S L +A+M Y   S
Sbjct:    1 MDEFKSAYLRLCREYNVEPHDALMKQLKIIPTSPRKGKQSLKLSSVSLSPKTCTVLGKVLATDHTFTEIKLADCMLNEDAVKSLAYGLAENVVCKRLDLKGNNVRGTGTEALARMLRHNKSLTSLCLEWNAMGMIDNSFGTFCEALAVNTTLKELDLRNNQISHDGAQELASALKRNTTLQAIDLRWNNVGIIGGRALLEALRRNKTIYKLSLAGNNIPTDVLQSIDTALGHN-------------EDRQLMSNDYYQRTHMLSSELRTLKEEKMMQMSELMGKIDEQEDFMRKTTRSSSHKIGQLQSALEERKAAFESLKAKLSMVESELALEQQKSHDLEGLVARMKQDQSELSSRHQSDLRQEREDRASVESRLLRELSEANDRNVQLEAKEDELSRKCKQQQDQIYDLKEQLTHAQADIKLKGAQYEEKFNNEKQKNKEILQEMESLKTREIAKLQQDFDDTEKQLRERINKLERQRLELEEEVSKLKSQAAADRIKAEEELATVKHKIRSDEEQRQKQLEDRMRILQQSKDELQSHSNHQQALISELQGKNSSMVLELETHKRRIDAQNTELSGKNNEMMAEVGKVKLEVKQKMAQLETERQAQNELKEEIGRLKRQISEQTGKHRELIHDKEREIESLQEKVREKDKELIRMREEDAQRSSMLQSAIMTYVARS 667          
BLAST of Leucine-rich repeat-containing protein 45 vs. TrEMBL
Match: A0A1S3IMD1 (leucine-rich repeat-containing protein 45 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106165548 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 9.118e-99
Identity = 219/680 (32.21%), Postives = 398/680 (58.53%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNY--------------ENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            ++ FK+ +L LC++  + P D +++ ++    +       L LS +S+S + C +L +    D TF EI+  +CML+   ++ +  G+++N  C +L LKGNNI+  G E+LAR++  N ++T L LE N +G+    F  FC  L  N TL+ LDLR+NQI  +  Q L  AL++NT L+ +DMR N++G  GG+ +L    +N+T+ K+ + GNNIP D++++I+     N              DR    N+Y              +  +K+Q  +L+D+IDEQ   +R + + +  KI QL+  LDERK   + L A L++ ES+L + + +  + +    +   ++  L  ++   L +E++ R  +E R L+E S + +R +QL+    EL     QQ + +++LK+++T   ++ + K   YEE++   K +NK+ + EV   K +E+ K++ +++  E++ RE++ K +  R EL +E+S LK+Q ++DRI+ +E++  +KQK+ ++++Q+  +L+++++ +Q  KDE++S +N Q   I  LQ  NS +++ELE+ K + +    ELSGK   MM+E+ KV+LE   ++ +LE+ERQ+Q +L  +IE   +QI E     RE  + +  E+++L+++++ ++ EL R  E++  R+S L +A+M Y   S
Sbjct:    1 MDEFKSAYLCLCREYNVEPHDALMKQLKIIPTSPRKGKQSLQLSRESLSPKTCTILGKVLATDHTFSEINLSNCMLNEYAVKSLAYGMAENVVCKRLDLKGNNIRETGTEALARMLRHNKSLTSLCLEQNDMGMIENSFGTFCEALAANTTLKELDLRSNQISHNGAQELASALKRNTTLQAIDMRSNNVGFIGGRALLEALRRNKTIYKLSLAGNNIPTDVLQSIDTALGHN-------------EDRQLMCNDYYQRTHMLSCELRTLKKEKKMQMSELMDKIDEQEDFMRKTTRSTSHKIGQLQSALDERKAAFKSLKAKLSMVESELALEQQKSHDLEGLVARMKTDQSELSIRHQSDLRQEREDRTSVESRLLRELSEVNDRNVQLEATEDELSRKGKQQQDQIYDLKEQLTHAQADIRLKGAQYEEKLNNEKQKNKEILQEVESLKTREIAKLQQDFDDTEKQLRERINKLERQRLELEEEVSKLKSQAAADRIKAEEELATVKQKIRSDEEQRQKQLEDRMRLLQQSKDELQSHSNHQKALILELQGKNSSMELELETHKRRIDAQNTELSGKNNEMMAEVGKVKLEVKQKMAQLETERQAQNELKEEIERLKRQISEQTGKHRELIHDKEREIESLQEKVREKDKELIRMREEDAQRSSMLQSAIMTYVARS 667          
BLAST of Leucine-rich repeat-containing protein 45 vs. TrEMBL
Match: A0A2T7PVH9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00026 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 9.712e-99
Identity = 225/671 (33.53%), Postives = 388/671 (57.82%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGE----ISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIE-QKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            ++ F+  ++ LCK+    P D +++ ++S           L LS  S+S + C VL +    D  F E+ F DCMLS D ++ + +GL+ N  C KL LKGNNI+  G E+L +++  N ++  + LEWN +G+  T F  FC+GL  N  LQ LDLRNNQI  +  + L  AL++NT L+ LD+R+N+IG+ GG+  L + + N++LS++ + GNN+P DI K+IE   + N E      E  +R+++ S       + E  R +Q  +L++ ID +   LR + + S   I QL++ L++RK     L A L++ ES+L + E +  +  A      +E       +  +L KEK+ R ++E R+LKE S+L+E++L  QNKV +L+    QQ   +FELK+ +    +E K K   +EE+ ++ + Q+ KE+   +E  + K++  ++ E    E   R+++ K +  R EL +EIS LK+   +D++  +E +   KQ++ AE++Q+  +L+E+++ +Q  KDE++S  N+QA  +  LQ  NS L +E+E+LK + E +  EL+ K    M+E+ KV++E    + KLESER    +L  K+   D+++ +    +R+    ++ E+  ++++L+ +E+E+ R+ E+E  RA  L +A+M Y   S
Sbjct:    1 MDEFRLTYVRLCKENHTEPQDVVVEKLKSLEQTGGKGRTTLDLSTHSLSPKTCAVLGKVLATDRNFTEVKFADCMLSDDAVKSLAQGLAYNGFCKKLDLKGNNIRGSGVEALGKMLQHNKSLISICLEWNALGMLETSFATFCDGLGANSVLQALDLRNNQINHEGGEELATALKRNTCLRALDLRWNNIGLLGGRAFLEMLKSNKSLSRLELAGNNVPSDITKSIETAIDNNAERQILSMEHQKRTHTLSQHI---KSVEKERSVQLSELMNEIDHKEELLRKTKRTSSHHIGQLQEALEDRKGAFNSLAAKLSMTESELVLAEQKANDYGAIVNHLKQEMTDAALIHQNELRKEKEDRAQVEMRYLKEVSDLEEKLLLSQNKVEDLDRKCRQQQEQIFELKEYVAHFQAELKLKGAQFEER-LQAERQHHKEIQRDLETARSKDIAHVKQEAEDVERSLRDRIQKMESHRLELEEEISRLKSNNMADKLLAEEQLQSAKQRIRAEEEQRHRQLEEKVRVLQTTKDELQSHCNQQAALVSELQSRNSGLTLEVENLKRRLEEMGHELADKNNYTMAEVGKVKIELNQVVNKLESERSLNAELREKLSQVDRELSDQLLRYRQAMEEKDRELVMVQEKLRARELEMQRQREEEVQRAQLLQSAMMSYITRS 667          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Cavefish
Match: lrrc45 (leucine rich repeat containing 45 [Source:NCBI gene;Acc:103038066])

HSP 1 Score: 317.39 bits (812), Expect = 1.260e-97
Identity = 213/668 (31.89%), Postives = 377/668 (56.44%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKR-NNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKE-NDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            +E+F+  ++ LCK+  + P + ++  +Q    A       L LS +S++ E C VL    + DT F E+   DCMLS +  +L L GL  N     L LKGNN++  G E+L +L+ RN T+  L LEWN +G+   GF  FC GL +N  L  LDLRNNQI       L  AL++N+ L+ LD+R+N+IG+ GG+ +++  ++NR+L ++ + GNNIP DI+++IE     N +         SR+    K     +  +  Q L L++ ID+Q   +  S + S  ++ QL++ L ERK     L A L + E+ L M E +     D   +  L++ E +ER ++  + K ++  +  E + L+E +NL E+  QL+NK+ E E     Q + +FELK ++T + +E K ++   EE++   K + K+ + ++   + KE++ +      +E   +++++K +  R +L +E+S +K  I ++R Q +E++ K++ ++  E+ Q +S ++E+L+  +  +DE +S   +Q + I  L     +  IE+++L+ + +  ++ELSGK+   M+E+ +VR+E   +I  L++ER +Q  L  KI   +++++ +  S RE    + +E+ +L +RL+ +E E+ R  EDE  RAS L NA++ Y Q S
Sbjct:    1 MEDFRRAYMQLCKEAGVEPQESVLAQLQGTRAAAGG--TRLDLSGQSLTVESCAVLGRTLQKDTLFTELGLSDCMLSEEGAKLFLSGLCSNTTVKVLDLKGNNLRGAGAEALGKLLVRNKTLRRLVLEWNALGMWEEGFSIFCEGLASNSCLTQLDLRNNQINHQGAAELALALKRNSVLQELDLRWNNIGLLGGRALMDALQQNRSLLQLEMAGNNIPSDILRSIEQSMEHNSDRQSTMRERRSRTHVLSKEIQILKEEKGRQFLSLMETIDKQKDEMGRSSRNSSIRVGQLQEALSERKSTVNALTAKLQMTEAALAMSEQKVNNLGDLLTRVKLEKTELMER-HSKDIKKHQEDNVLHEGKLLREVNNLSEKNHQLKNKLEERERRCKSQQDQIFELKQELTNSTAELKLRLAQAEERLDMEKRRAKQALEDMDSLRQKEVDHINRHLEESERALQDRILKLEGQRIQLEEELSRVKAAIVTERAQAEEELGKVRTQVRLEEQQHLSSMEEKLRNARQARDEAQSHCTQQKQTIAELHARTGQQSIEMDALRRRIDEQQQELSGKEQEKMAEVARVRVELQEQIGHLQAERTAQSSLKEKIAALEREMKALSTSHREALLDKESEISSLLERLRMKEGEIQRMREDEAQRASFLQNAILTYVQGS 665          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Cavefish
Match: lrrc45 (leucine rich repeat containing 45 [Source:NCBI gene;Acc:103038066])

HSP 1 Score: 317.39 bits (812), Expect = 1.260e-97
Identity = 213/668 (31.89%), Postives = 377/668 (56.44%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKR-NNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKE-NDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPS 2040
            +E+F+  ++ LCK+  + P + ++  +Q    A       L LS +S++ E C VL    + DT F E+   DCMLS +  +L L GL  N     L LKGNN++  G E+L +L+ RN T+  L LEWN +G+   GF  FC GL +N  L  LDLRNNQI       L  AL++N+ L+ LD+R+N+IG+ GG+ +++  ++NR+L ++ + GNNIP DI+++IE     N +         SR+    K     +  +  Q L L++ ID+Q   +  S + S  ++ QL++ L ERK     L A L + E+ L M E +     D   +  L++ E +ER ++  + K ++  +  E + L+E +NL E+  QL+NK+ E E     Q + +FELK ++T + +E K ++   EE++   K + K+ + ++   + KE++ +      +E   +++++K +  R +L +E+S +K  I ++R Q +E++ K++ ++  E+ Q +S ++E+L+  +  +DE +S   +Q + I  L     +  IE+++L+ + +  ++ELSGK+   M+E+ +VR+E   +I  L++ER +Q  L  KI   +++++ +  S RE    + +E+ +L +RL+ +E E+ R  EDE  RAS L NA++ Y Q S
Sbjct:    1 MEDFRRAYMQLCKEAGVEPQESVLAQLQGTRAAAGG--TRLDLSGQSLTVESCAVLGRTLQKDTLFTELGLSDCMLSEEGAKLFLSGLCSNTTVKVLDLKGNNLRGAGAEALGKLLVRNKTLRRLVLEWNALGMWEEGFSIFCEGLASNSCLTQLDLRNNQINHQGAAELALALKRNSVLQELDLRWNNIGLLGGRALMDALQQNRSLLQLEMAGNNIPSDILRSIEQSMEHNSDRQSTMRERRSRTHVLSKEIQILKEEKGRQFLSLMETIDKQKDEMGRSSRNSSIRVGQLQEALSERKSTVNALTAKLQMTEAALAMSEQKVNNLGDLLTRVKLEKTELMER-HSKDIKKHQEDNVLHEGKLLREVNNLSEKNHQLKNKLEERERRCKSQQDQIFELKQELTNSTAELKLRLAQAEERLDMEKRRAKQALEDMDSLRQKEVDHINRHLEESERALQDRILKLEGQRIQLEEELSRVKAAIVTERAQAEEELGKVRTQVRLEEQQHLSSMEEKLRNARQARDEAQSHCTQQKQTIAELHARTGQQSIEMDALRRRIDEQQQELSGKEQEKMAEVARVRVELQEQIGHLQAERTAQSSLKEKIAALEREMKALSTSHREALLDKESEISSLLERLRMKEGEIQRMREDEAQRASFLQNAILTYVQGS 665          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 67.3958 bits (163), Expect = 3.909e-11
Identity = 53/187 (28.34%), Postives = 91/187 (48.66%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISG--TGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI 696
            +N  L  L L E S+  E  K ++   + ++T  E+  +   +     + + + L  N     L L+ N + ++G  +LA  +  NS++  L L+    G+S    G +     L+ N+TL  LDLR N IG    + L+ AL+ N +L+ L+++ NS+G+ G   I      N  L+ I + GN I
Sbjct:  649 SNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQ----GVSAGKAGAEALAEALMVNQTLCTLDLRGNSIGMGGAKALSSALKTNRSLRSLNLQENSLGMDGAIFIATALRGNHQLTYINLQGNGI 831          

HSP 2 Score: 64.3142 bits (155), Expect = 3.381e-10
Identity = 58/199 (29.15%), Postives = 93/199 (46.73%), Query Frame = 1
Query:  196 MCKVLSECFR-HDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLIS-RNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSD 786
            +C VL+   +  D   EE    +C+ S    +L+ + L     C KL ++ N  K+   E L  L+S ++  I  LSL      IS  G       L+ N+TL +LDL  N IG    + L EAL+ N  +  ++++ NSI   G + +  + + NR L+ + +  N I  D +K I     +N  + + N  SN   D
Sbjct:  417 VCAVLAYLLQVSDACAEETHLSNCLDSASLKRLLPQLL----YCSKLRMENNGFKDDAMELLGSLLSAKDCHIQFLSLA--DSSISSKGIKPLSRALLVNRTLTILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGD 609          

HSP 3 Score: 64.3142 bits (155), Expect = 3.944e-10
Identity = 55/226 (24.34%), Postives = 100/226 (44.25%), Query Frame = 1
Query:  205 VLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKV----------------------------LDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK 798
             L++    + T   +S +   +S   ++ +   L  N     L L+ N+I  +G +++AR +  NST+ +L L+WN + I           L +N ++Q+LDL+ N +G +    L  AL+ N++L V                            LD+R NSIG+ G K + +  + NR+L  + +  N++ MD    I      N +++  N + N   +   K
Sbjct:  614 ALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLQWNFMKIGAA--KALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQGVSAGKAGAEALAEALMVNQTLCTLDLRGNSIGMGGAKALSSALKTNRSLRSLNLQENSLGMDGAIFIATALRGNHQLTYINLQGNGIGESGAK 837          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 64.3142 bits (155), Expect = 3.608e-10
Identity = 58/199 (29.15%), Postives = 93/199 (46.73%), Query Frame = 1
Query:  196 MCKVLSECFR-HDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLIS-RNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSD 786
            +C VL+   +  D   EE    +C+ S    +L+ + L     C KL ++ N  K+   E L  L+S ++  I  LSL      IS  G       L+ N+TL +LDL  N IG    + L EAL+ N  +  ++++ NSI   G + +  + + NR L+ + +  N I  D +K I     +N  + + N  SN   D
Sbjct:  417 VCAVLAYLLQVSDACAEETHLSNCLDSASLKRLLPQLL----YCSKLRMENNGFKDDAMELLGSLLSAKDCHIQFLSLA--DSSISSKGIKPLSRALLVNRTLTILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGD 609          

HSP 2 Score: 63.929 bits (154), Expect = 5.486e-10
Identity = 57/247 (23.08%), Postives = 105/247 (42.51%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVL----------------------------DMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK 798
             N  L  L+L   S+S +  K L+   R +     ++ ++  +  +  + I   L +N    +L L  N + ++G  ++A  +  N  +  L L+WN + I           L +N ++Q+LDL+ N +G +    L  AL+ N++L VL                            D+R NSIG+ G K + +  + NR+L  + +  N++ MD    I      N +++  N + N   +   K
Sbjct:  621 VNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLTANLLHDEGVTAIAGSVKVNRALRSLHLQWNFMKIGAA--KALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQGVSAGKAGAEALAEALMVNQTLCTLDLRGNSIGMGGAKALSSALKTNRSLRSLNLQENSLGMDGAIFIATALRGNHQLTYINLQGNGIGESGAK 865          

HSP 3 Score: 62.003 bits (149), Expect = 1.832e-9
Identity = 54/214 (25.23%), Postives = 97/214 (45.33%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSD 786
            N  +  + L   S+  E  + L+E  + +     ++ +   + PD ++ I E L  N     L +  N++ + G  +LA+ +  N T+  LSL+ N V  S  G       L +N+ L  L+LR N IG +  + +  ALQ+N+ L+ LD+  N +   G   I    + NR L  + +  N + +   K +    + N  I   + + N+  D
Sbjct:  538 NQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSV--SDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLTANLLHDEGVTAIAGSVKVNRALRSLHLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGD 749          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Cavefish
Match: lrrc74a (leucine rich repeat containing 74A [Source:NCBI gene;Acc:103039030])

HSP 1 Score: 58.5362 bits (140), Expect = 1.776e-8
Identity = 48/159 (30.19%), Postives = 71/159 (44.65%), Query Frame = 1
Query:  277 DCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMD-------IIKNIENLA 732
            D  +   E  S N    +L L  N    +G E L ++++ N  I  L L WN + + G     FC GL  N TL+ LDL  N  G +    L EAL+ N  L  LD+  N I   G  ++    E N TL  + +  N++ ++       ++KN    A
Sbjct:  170 DDAKWFAEAFSSNYRVKELDLSHNQFSGKGGEYLGQMLANNEGIELLDLSWNHLRMKGA--VAFCAGLKVNVTLKQLDLSWNGFGNEGALALGEALKFNNTLVDLDLSNNRITNEGVGMLCRGLEANDTLRTLKLAYNSLTVEGALALIRVVKNTPKTA 326          

HSP 2 Score: 52.7582 bits (125), Expect = 1.143e-6
Identity = 40/149 (26.85%), Postives = 65/149 (43.62%), Query Frame = 1
Query:  199 CKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNI 645
             K  +E F  +   +E+       S    + + + L++N     L L  N+++ +G  +    +  N T+  L L WN  G    G       L  N TL  LDL NN+I  +   ML   L+ N  L+ L + YNS+ V G   ++ +
Sbjct:  172 AKWFAEAFSSNYRVKELDLSHNQFSGKGGEYLGQMLANNEGIELLDLSWNHLRMKGAVAFCAGLKVNVTLKQLDLSWN--GFGNEGALALGEALKFNNTLVDLDLSNNRITNEGVGMLCRGLEANDTLRTLKLAYNSLTVEGALALIRV 318          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002444.1 (pep scaffold:Pmarinus_7.0:GL480979:320698:340261:-1 gene:ENSPMAG00000002230.1 transcript:ENSPMAT00000002444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.926e-10
Identity = 39/177 (22.03%), Postives = 83/177 (46.89%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            N+ +  L LS+  +  E C+ LS   + +   EE++     +       +   L +N     L L GNN+ ++    L   +S N ++ +L +  N++G +G       + + N++TL+ LDL  +   ++    +  A+  N +++ L + +  +G+ G   +    ++NRTL  +
Sbjct:    1 NTVVTKLDLSDNWLQEEGCRHLSRMLKENCYIEELNVSSNRMGVGGAMALCSALRENSTITSLNLSGNNLTDEAARHLHNAMSVNRSLKELDMSHNRIGDAGA--MHVAHMIANSETLETLDLAWSLWRWNGSVAIAAAISVNRSVRWLSLAWTGVGIEGALALREALQRNRTLHHL 175          

HSP 2 Score: 50.8322 bits (120), Expect = 7.036e-7
Identity = 42/172 (24.42%), Postives = 74/172 (43.02%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNR 660
            NS +  L LS  +++ E  + L      + + +E+      +       +   ++++     L L  +  +  G  ++A  IS N ++  LSL W  VGI G         L  N+TL  LDL + ++     + L   LQ N  L+ L +  N I   G   +L+  +KN+
Sbjct:   57 NSTITSLNLSGNNLTDEAARHLHNAMSVNRSLKELDMSHNRIGDAGAMHVAHMIANSETLETLDLAWSLWRWNGSVAIAAAISVNRSVRWLSLAWTGVGIEGA--LALREALQRNRTLHHLDLSSCRVDERGARALAAGLQTNVALRSLKLALNPIMAEGALALLSAIQKNK 226          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Sea Lamprey
Match: lrrc74a (leucine rich repeat containing 74A [Source:ZFIN;Acc:ZDB-GENE-131127-263])

HSP 1 Score: 52.7582 bits (125), Expect = 1.142e-7
Identity = 43/153 (28.10%), Postives = 62/153 (40.52%), Query Frame = 1
Query:  277 DCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISG--------------TGFDQFCNGLIN------------NKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKN 657
            D + L    L  N    +L L  N     G E L +L++ N T+ +L L WN + + G              T      NGL N            N  L  LDLRNN+IG    + L   L  N +L+VL + +N   V G  +++   + N
Sbjct:    1 DAVLLTFLLLQSNYSVKELDLSHNEFSEMGGEHLGQLLAHNETLEELELSWNHLRLKGAVALCAGLRVNYALTHLHLSVNGLGNEGALAMAEALKFNGALLHLDLRNNRIGNTGMEALARGLLTNDSLRVLQLCFNIFTVEGALVLIKAVKVN 153          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Sea Lamprey
Match: lrrc74a (leucine rich repeat containing 74A [Source:ZFIN;Acc:ZDB-GENE-131127-263])

HSP 1 Score: 51.9878 bits (123), Expect = 1.674e-7
Identity = 43/153 (28.10%), Postives = 62/153 (40.52%), Query Frame = 1
Query:  277 DCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISG--------------TGFDQFCNGLIN------------NKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKN 657
            D + L    L  N    +L L  N     G E L +L++ N T+ +L L WN + + G              T      NGL N            N  L  LDLRNN+IG    + L   L  N +L+VL + +N   V G  +++   + N
Sbjct:    1 DAVLLTFLLLQSNYSVKELDLSHNEFSEMGGEHLGQLLAHNETLEELELSWNHLRLKGAVALCAGLRVNYALTHLHLSVNGLGNEGALAMAEALKFNGALLHLDLRNNRIGNTGMEALARGLLTNDSLRVLQLCFNIFTVEGALVLIKAVKVN 153          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Nematostella
Match: EDO43196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ93])

HSP 1 Score: 81.6481 bits (200), Expect = 1.680e-16
Identity = 58/186 (31.18%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIP 699
            TNS L  L L    +  E    +++    ++T E++  +   +  +    I + L  N    KL L+GN I ++G  ++A+ +  NST+  L LE N++G  G         L+ N TL+ LDL  N+IG +    + +AL  N+ LK LD+  N IG  G   I      N TL K+ + GN I 
Sbjct:  144 TNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGA--IAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIG 327          

HSP 2 Score: 81.6481 bits (200), Expect = 2.105e-16
Identity = 58/186 (31.18%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIP 699
            TNS L  L L    +  E    +++    ++T E++  +   +  +    I + L  N    KL L+GN I ++G  ++A+ +  NST+  L LE N++G  G         L+ N TL+ LDL  N+IG +    + +AL  N+ LK LD+  N IG  G   I      N TL K+ + GN I 
Sbjct:  116 TNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGA--IAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIG 299          

HSP 3 Score: 80.8777 bits (198), Expect = 2.964e-16
Identity = 57/186 (30.65%), Postives = 89/186 (47.85%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIP 699
            TNS L  L L    +  E    +++    ++T E++  +   +  +    I + L  N    KL L+GN I + G  ++A+ +  NST+  L LE N++G    G       L+ N TL+ LDL  N+IG +    + +AL  N+ L+ LD+  N IG  G   I      N TL K+ + GN I 
Sbjct:    2 TNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDDGAIAIAKALMTNSTLEKLDLEGNKIGDEDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIG 187          

HSP 4 Score: 80.1073 bits (196), Expect = 6.371e-16
Identity = 57/186 (30.65%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIP 699
            TNS L  L L    +  E    +++    ++T +++  +   +  +    I + L  N    KL L+GN I ++G  ++A+ +  NST+  L LE N++G  G         L+ N TL+ LDL  N+IG +    + +AL  N+ LK LD+  N IG  G   I      N TL K+ + GN I 
Sbjct:  200 TNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGA--IAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIG 383          

HSP 5 Score: 79.7221 bits (195), Expect = 7.161e-16
Identity = 57/186 (30.65%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIP 699
            TNS L  L L    +  E    +++    ++T +++  +   +  +    I + L  N    KL L+GN I ++G  ++A+ +  NST+  L LE N++G  G         L+ N TL+ LDL  N+IG +    + +AL  N+ LK LD+  N IG  G   I      N TL K+ + GN I 
Sbjct:  172 TNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGA--IAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIG 355          

HSP 6 Score: 76.6406 bits (187), Expect = 7.733e-15
Identity = 52/169 (30.77%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  193 EMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIP 699
            E    +++    ++T E++  +   +  +    I + L  N    KL L+GN I ++G  ++A+ +  NST+  L LE N++G  G         L+ N TL+ LDL  N+IG +    + +AL  N+ LK LD+  N IG  G   I      N TL K+ + GN I 
Sbjct:  105 EGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGA--IAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIG 271          

HSP 7 Score: 75.0998 bits (183), Expect = 2.411e-14
Identity = 57/188 (30.32%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPD--CLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIP 699
            TNS L  L L    +  +    +++    ++T E++  +   +  +      I + L  N    KL L+GN I ++G  ++A+ +  NST+  L LE N++G  G         L+ N TL+ LDL  N+IG +    + +AL  N+ LK LD+  N IG  G   I      N TL K+ + GN I 
Sbjct:   58 TNSTLEKLDLEGNKIGDDGAIAIAKALMTNSTLEKLDLEGNKIGDEDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGA--IAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIG 243          

HSP 8 Score: 73.559 bits (179), Expect = 8.812e-14
Identity = 49/161 (30.43%), Postives = 80/161 (49.69%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSG 624
            TNS L  L L    +  E    +++    ++T +++  +   +  +    I + L  N    KL L+GN I ++G  ++A+ +  NST+  L LE N++G  G         L+ N TL+ LDL  N+IG +    + +AL  N+ LK LD+  N IG  G
Sbjct:  228 TNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGA--IAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEG 386          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Nematostella
Match: EDO35050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SML2])

HSP 1 Score: 69.3218 bits (168), Expect = 2.254e-12
Identity = 44/183 (24.04%), Postives = 90/183 (49.18%), Query Frame = 1
Query:   64 FLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSI 612
            +L LC++E + PS   ++  ++          C++L    +  +  +V+++    +     ++  D  + P   Q +   LS NC    + L GN I+ +G  ++  ++  ++++  L+L   + GI+G    +FC G+  N  L+ L   +N +     ++L+EAL  NT L+ LD+ +N I
Sbjct:    1 YLELCEKENIAPSWRFLRECETE---------CVSLPHYGLGDKGVRVVAKVLEQNLFVNILNLFDNGIGPHGAQDLSRMLSVNCFITHMNLSGNMIRKEGIIAIGIMLQESASLVFLNLA--KCGINGKDMMEFCKGIATNPHLKSLIFHSNNLSDQGSRLLSEALASNTALETLDLSWNDI 172          

HSP 2 Score: 50.8322 bits (120), Expect = 1.399e-6
Identity = 43/167 (25.75%), Postives = 69/167 (41.32%), Query Frame = 1
Query:  139 ATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLIL 639
            ATN  L  L     ++S +  ++LSE    +T  E +                             L  N+I+     +LA+ +  N TI +L L WN     G    Q+   L ++ +LQ LD+ N  I  D  +++ + L+ N NL+VL +  N    +G   IL
Sbjct:  129 ATNPHLKSLIFHSNNLSDQGSRLLSEALASNTALETLD----------------------------LSWNDIRPGAMATLAKGLRLNHTIQELDLSWNTFQSRGVIAVQWF--LTHSTSLQTLDISNCGIHLDGAEVIAKVLRANRNLQVLKLGRNPFQNAGVPCIL 265          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Nematostella
Match: EDO35561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL68])

HSP 1 Score: 67.0106 bits (162), Expect = 4.661e-12
Identity = 56/204 (27.45%), Postives = 82/204 (40.20%), Query Frame = 1
Query:  142 TNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGT--------------------------GFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            TNS L  L L++ ++  E  K ++E    ++T +E    D  +  +    I   L  N    KL L    I+  G  +LAR      ++  L L  NQ+   G                           G     N L+ N TL+ LDL  N IG +  + + EAL  N+ LK L +  ++IG  G   I N    N TL K+
Sbjct:   64 TNSTLKILDLTKNNIGNEGAKAIAEALMTNSTLKEFDLCDTNIGDEGAIAIANALMTNSTLKKLYLHDYGIRAVGIAALARTQLHKPSLIGLDLSSNQISSKGAIAIAEMLSKNQLLETFRLCLYQIGDEGAIAIANALMTNSTLKKLDLEGNYIGDEGAKAIAEALMTNSTLKELHLYESNIGDEGAIAIANALMTNSTLKKL 267          

HSP 2 Score: 63.5438 bits (153), Expect = 7.254e-11
Identity = 41/117 (35.04%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  325 IKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            I L L  N I ++G  ++A ++S+N  +    L +NQ+G  G       N L  N TL++LDL  N IG +  + + EAL  N+ LK  D+   +IG  G   I N    N TL K+
Sbjct:   13 IDLDLSLNKISSKGAIAIAEMLSKNQLLETFRLSFNQIGDEGA--IAIANALKTNSTLKILDLTKNNIGNEGAKAIAEALMTNSTLKEFDLCDTNIGDEGAIAIANALMTNSTLKKL 127          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Nematostella
Match: EDO35563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL71])

HSP 1 Score: 63.929 bits (154), Expect = 6.597e-12
Identity = 42/117 (35.90%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  325 IKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKI 675
            I L L  N I ++GC ++A ++S+N  +    L +NQ+G  G       N L  N TL++LDL  N IG +  + +  AL  N+ LK L +  N+IG  G   I N    N TL K+
Sbjct:   24 IDLDLSLNKISSKGCIAIAEMLSKNQWLETFILSYNQIGDEGA--MSIANALKTNSTLKILDLTKNNIGNEGAKAIANALMTNSTLKKLHLCENNIGDEGAIAIANALMTNSTLKKL 138          

HSP 2 Score: 49.2914 bits (116), Expect = 6.472e-7
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 1
Query:  403 TITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI 696
            ++ DL L  N+  IS  G       L  N+ L+   L  NQIG +    +  AL+ N+ LK+LD+  N+IG  G K I N    N TL K+ +  NNI
Sbjct:   22 SLIDLDLSLNK--ISSKGCIAIAEMLSKNQWLETFILSYNQIGDEGAMSIANALKTNSTLKILDLTKNNIGNEGAKAIANALMTNSTLKKLHLCENNI 117          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Nematostella
Match: EDO39348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC5])

HSP 1 Score: 65.855 bits (159), Expect = 1.030e-11
Identity = 46/146 (31.51%), Postives = 74/146 (50.68%), Query Frame = 1
Query:  244 EISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILI 681
            E+  ++  + P+    + E L+ N     L L  N I+N+G  ++A+L+  N  ITDL++  N   +S +G D   N LI N TL  LD+  N    D+   LT  LQ    L  LD+R+N+     G  +  + +KN +L ++ I
Sbjct:    7 ELVMRNLGIGPEGAAAVAEILAGNSSVRVLDLSVNGIQNKGAFAVAQLLEHNQWITDLNISENN--LSKSGLDSIGNMLILNNTLTCLDVSRNSFTCDDIHFLTNVLQTADALLFLDLRHNAFKEKAGLYLGEMVKKNTSLRELYI 150          

HSP 2 Score: 51.9878 bits (123), Expect = 2.913e-7
Identity = 47/184 (25.54%), Postives = 81/184 (44.02%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNI 696
            N+ L CL +S  S +C+    L+   +   T + + F D                         L+ N  K +    L  ++ +N+++ +L + WN  G  G      C GL  N++L++LD+  N+IG D    + E ++ N  L  L++  N I   G + I    E N TL ++L +G N+
Sbjct:   86 NNTLTCLDVSRNSFTCDDIHFLTNVLQ---TADALLFLD-------------------------LRHNAFKEKAGLYLGEMVKKNTSLRELYIGWNHFGDEGA--KHLCAGLQENRSLEILDICWNEIGRDGAGYIAEFIENNGRLVELNLDNNHITDHGLRSIARGLEVNETL-RLLKVGFNL 238          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Medaka
Match: lrrc45 (leucine rich repeat containing 45 [Source:NCBI gene;Acc:101174918])

HSP 1 Score: 253.062 bits (645), Expect = 1.347e-73
Identity = 200/686 (29.15%), Postives = 374/686 (54.52%), Query Frame = 1
Query:   43 LENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK-RNNYEN----SRKLQT---------LDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGXXXXXXXXXXXXVFELKDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHEWNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQKLHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDXXXXXXXXXXXXXXXXXXXXXXSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDLISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDEKTRASALHNAVMQYCQPSIQSSFA 2058
            +E+ +  +L LCK+  + P + ++  +Q            L LS +S+S + C VL+     D  F ++S  DCMLS +  +++L GL  N     L +KGNN+++ G E L +L++RN T+  L LEWN +G+    F  FC+GL +N TL  LDLRNNQI       L  AL+++ +L+ LD+R+N++G+ GG+ +L   + N+++ K+ + GNNIP D +K IE  A  N             SDR    R N+      SR++QT         L L++ ID Q   +  S++ +  +I  L++ L+ERK   + L A L +AE+ L + E + +       +   E+E    + + +  KE++  +  E + L+E  NL E   QL++K  ELE     Q   +FELK ++  + +E K ++   ++++   K ++K+ + +    + KE+  +      +E + +E+++K +E R +L +E+S  K    ++R+  +E++ +++ +L  ++ + +S L+E+L++++    E++   ++Q + I  LQ  N +   E++  + + E L++EL+GK    ++E+ +V++E   +I  L++E  +Q  L +KI   +++++ + ++ RE    + +E+ +L ++L+ +E E+ R  EDE  RAS L +A+  Y Q S    F 
Sbjct:    1 MEDSRGLYLRLCKEGGVEPQEGVLDQLQEGSR--------LDLSGQSLSADTCSVLARAL-QDGAFTQVSLSDCMLSEEGAKILLSGLFGNTTVKSLDMKGNNLRSAGAEVLGKLLARNKTLCRLVLEWNALGVWEEAFSAFCDGLGSNNTLTHLDLRNNQISHHGAAALALALRRSGSLEELDLRWNNLGLLGGRSLLEALQSNKSMVKLKVAGNNIPSDPLKAIEQTAGHN-------------SDRQTTLRENHSRTQVLSREIQTLKEEKGRQFLSLMETIDRQKEEMGRSNRSASVQISHLQEALNERKSAVKALTAKLQMAEAALALSEQKNQSLGERLSRLEAEKEDEREKQSRRRKKEEEDSLLREGKLLREIQNLTETNGQLRSKGEELEQRCKSQQQQIFELKQELANSTAELKMRLAQADDRLEMEKRRSKQALEDSESLRQKEVEHVSRRLEESERQLQERVLKLEEQRIQLEEEVSKGKAACVTERVHAEEELGRVRSQLRLQEQEHVSLLEEKLRSVRSSLQEVQLHCSQQKQTISELQAKNGQQSAEMDGCRRRVEELQQELAGKDQERVAEVSRVKVELQEQIALLQAEMMAQGGLKAKISALERELKVLGSNHREALLDKESEISSLLEKLRLKEAEIQRIREDEAHRASCLQSAIRAYVQGSPLGHFG 664          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Medaka
Match: ENSORLT00000033051.1 (pep primary_assembly:ASM223467v1:4:31968248:31976451:-1 gene:ENSORLG00000026968.1 transcript:ENSORLT00000033051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 7.114e-26
Identity = 72/236 (30.51%), Postives = 124/236 (52.54%), Query Frame = 1
Query:   37 MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNG 744
            M++E+ +  +L LCK+  + P + ++  +Q            L LS +S+S + C VL            +S  DCMLS +  +++L GL  +     L + GNN+++   E L +L++ N T++ L             F  FC+ L  N TL  LDLRNNQI       L  AL+++ +++ LD+R+N++G+ GG+ +L   + N+++ ++ + GNNIP D +K +E  A  N 
Sbjct:    1 MTVEDSRGLYLCLCKEGGVEPQEGVLDQLQEGSR--------LDLSGQSLSKDTCSVL------------VSLSDCMLSEEGAKVLLSGLFGDTTVKSLDMNGNNLRSARAEVLGKLLAPNKTLSRLE-----------AFSGFCDCLGINNTLTPLDLRNNQISPCGAAALVLALRRSGSVEELDLRWNNLGLLGGRSLLEALQSNKSMVRLKVAGNNIPSDTLKALEQTAGHNA 205          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Medaka
Match: ENSORLT00000026816.1 (pep primary_assembly:ASM223467v1:4:31968248:31976451:-1 gene:ENSORLG00000026968.1 transcript:ENSORLT00000026816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 8.643e-25
Identity = 70/236 (29.66%), Postives = 122/236 (51.69%), Query Frame = 1
Query:   37 MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNG 744
            M++E+ +  +L LCK+  + P + ++  +Q            L LS +S+S + C VL+               DCMLS +  +++L GL  +     L + GNN+++   E L +L++ N T+ +              F  FC+ L  N TL  LDLRNNQI       L  AL+++ +++ LD+R+N++G+ GG+ +L   + N+++ ++ + GNNIP D +K +E  A  N 
Sbjct:    1 MTVEDSRGLYLCLCKEGGVEPQEGVLDQLQEGSR--------LDLSGQSLSKDTCSVLARAL------------DCMLSEEGAKVLLSGLFGDTTVKSLDMNGNNLRSARAEVLGKLLAPNKTLKE-------------AFSGFCDCLGINNTLTPLDLRNNQISPCGAAALVLALRRSGSVEELDLRWNNLGLLGGRSLLEALQSNKSMVRLKVAGNNIPSDTLKALEQTAGHNA 203          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Medaka
Match: ENSORLT00000031050.1 (pep primary_assembly:ASM223467v1:4:31973141:31976451:-1 gene:ENSORLG00000026968.1 transcript:ENSORLT00000031050.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 2.110e-24
Identity = 71/236 (30.08%), Postives = 123/236 (52.12%), Query Frame = 1
Query:   37 MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNG 744
            M++E+ +  +L LCK+  + P + ++  +Q            L LS +S+S + C VL            +S  DCMLS +  +++L GL  +     L + GNN+++   E L +L++ N T+ +              F  FC+ L  N TL  LDLRNNQI       L  AL+++ +++ LD+R+N++G+ GG+ +L   + N+++ ++ + GNNIP D +K +E  A  N 
Sbjct:    1 MTVEDSRGLYLCLCKEGGVEPQEGVLDQLQEGSR--------LDLSGQSLSKDTCSVL------------VSLSDCMLSEEGAKVLLSGLFGDTTVKSLDMNGNNLRSARAEVLGKLLAPNKTLKE-------------AFSGFCDCLGINNTLTPLDLRNNQISPCGAAALVLALRRSGSVEELDLRWNNLGLLGGRSLLEALQSNKSMVRLKVAGNNIPSDTLKALEQTAGHNA 203          
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Medaka
Match: ENSORLT00000040321.1 (pep primary_assembly:ASM223467v1:4:31968248:31976451:-1 gene:ENSORLG00000026968.1 transcript:ENSORLT00000040321.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.399e-23
Identity = 71/236 (30.08%), Postives = 123/236 (52.12%), Query Frame = 1
Query:   37 MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNG 744
            M++E+ +  +L LCK+  + P + ++  +Q            L LS +S+S + C VL            +S  DCMLS +  +++L GL  +     L + GNN+++   E L +L++ N T+ +              F  FC+ L  N TL  LDLRNNQI       L  AL+++ +++ LD+R+N++G+ GG+ +L   + N+++ ++ + GNNIP D +K +E  A  N 
Sbjct:    1 MTVEDSRGLYLCLCKEGGVEPQEGVLDQLQEGSR--------LDLSGQSLSKDTCSVL------------VSLSDCMLSEEGAKVLLSGLFGDTTVKSLDMNGNNLRSARAEVLGKLLAPNKTLKE-------------AFSGFCDCLGINNTLTPLDLRNNQISPCGAAALVLALRRSGSVEELDLRWNNLGLLGGRSLLEALQSNKSMVRLKVAGNNIPSDTLKALEQTAGHNA 203          
BLAST of Leucine-rich repeat-containing protein 45 vs. Planmine SMEST
Match: SMESG000060194.1 (SMESG000060194.1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 355/356 (99.72%), Postives = 355/356 (99.72%), Query Frame = 1
Query:   37 MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKD 1104
            MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCN LINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKD
Sbjct:    1 MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNSLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDERKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQLDKEKD 356          
BLAST of Leucine-rich repeat-containing protein 45 vs. Planmine SMEST
Match: SMESG000023093.1 (SMESG000023093.1)

HSP 1 Score: 63.1586 bits (152), Expect = 5.287e-10
Identity = 63/256 (24.61%), Postives = 101/256 (39.45%), Query Frame = 1
Query:  130 AYHATNSKLYCLT---LSEKSMSCEM-------------CKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSDRNGK--RNNYENSRKLQTLDL 843
            A+    SKL+CLT   +S    +C M             C  L++C       +        +  D  ++I+  L D+   I+L    N+I ++G  +L ++++                              N  +L+VL + NN I     Q +  A++KNT LK+LDMR N I   GG+ I      N TL  I + GN +       +  + N N  +   +  +N      GK  +    N+R L  LDL
Sbjct:  240 AFDPIVSKLFCLTDLRISYDVKNCGMNFEWNIFQFTINDCLQLAKCVSAAKQLKVFHLTRSRVDCDRCRVIISHLLDHPALIELDFSHNHIGDRGARALGKILN------------------------------NRSSLEVLKISNNMIKTAGAQAIAYAVKKNTTLKILDMRLNRILDEGGQAICKALLTNETLININLAGNEMSEPTAAILAQVVNSNTSLVSIDLSNNRLGPDGGKQIQEGMTNNRSLLNLDL 465          
BLAST of Leucine-rich repeat-containing protein 45 vs. Planmine SMEST
Match: SMESG000053819.1 (SMESG000053819.1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.022e-9
Identity = 44/124 (35.48%), Postives = 55/124 (44.35%), Query Frame = 1
Query:  454 GFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILN-----------------------------IFEKNRTLSKILILGNNIPMDIIKNIENLANR 738
            G ++ C+ LI N+TL VLDL  N+I  D  ++L + L+ NT LKVLD+ YN I   G K I N                               E N TL KI I GN    D IK    L +R
Sbjct:  178 GMERLCDALIINRTLTVLDLSCNRITRDGAKILAKVLKCNTPLKVLDLGYNRIHDQGIKAIANSLCYCNTNLKCLVITFNEIHDEGLMEITAALELNTTLDKIYIWGNEFTSDAIKYFGALMDR 301          
BLAST of Leucine-rich repeat-containing protein 45 vs. Planmine SMEST
Match: SMESG000006391.1 (SMESG000006391.1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.470e-7
Identity = 47/171 (27.49%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  145 NSKLYCLTLSEKSMSCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLCLKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLILNIFEKN 657
            N +L  L LS+          + +   + +  E ++F     S  CL     GL+     ++L L  N+I     +     ++ NST+  L+L WN +G S  G   F   L  N TL+ +D+ NN+I  +   +L   L  N  LK L +  N +  +G   IL+   KN
Sbjct:   35 NLQLSRLDLSQNVFDDRAAGFIGDLIANASKLEYLNFSKNKFSSHCLLAFGMGLTQTRQLVELDLSWNHITGNEMKHFCSGLADNSTLKVLNLSWNGLG-SIPGMQDFGKMLKTNTTLEEIDISNNRITTEGAVLLGRGLSVNCTLKTLKIGSNPMQTAGCYAILSTILKN 204          
BLAST of Leucine-rich repeat-containing protein 45 vs. Planmine SMEST
Match: SMESG000053815.1 (SMESG000053815.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.656e-6
Identity = 44/124 (35.48%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  367 CESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLINNKTLQVLDLRNNQIGFDNCQMLTEALQK-NTNLKVLDMRYNSIGVSGGKLILNIFEKNRTLSKILILGNNIPMDIIKNIENLAN 735
            C++L  LI+R+ T+ DLS       I+  G       L  N  L++LDL  N+I     Q +  +L+  NT LK L ++YN I   G K IL    +N TL KI I GN      I+   +L N
Sbjct:  244 CDAL--LINRSLTVLDLSCNR----ITSDGALHLAKVLKFNTPLEILDLGYNRIHDQGIQAIAGSLRYCNTRLKCLVIKYNEIEDEGLKAILTALHENSTLEKIYIWGNKFTSKFIELFVSLVN 361          
The following BLAST results are available for this feature:
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC457.083e-7829.57leucine rich repeat containing 45 [Source:HGNC Sym... [more]
NLRC31.395e-1326.12NLR family CARD domain containing 3 [Source:HGNC S... [more]
NLRC31.727e-1326.12NLR family CARD domain containing 3 [Source:HGNC S... [more]
LRRC74A4.414e-1129.00leucine rich repeat containing 74A [Source:HGNC Sy... [more]
NLRC32.104e-1029.32NLR family CARD domain containing 3 [Source:HGNC S... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc459.884e-9532.40leucine rich repeat containing 45 [Source:ZFIN;Acc... [more]
lrrc458.494e-9232.25leucine rich repeat containing 45 [Source:ZFIN;Acc... [more]
lrrc458.343e-9132.10leucine rich repeat containing 45 [Source:ZFIN;Acc... [more]
lrrc454.399e-7730.96leucine rich repeat containing 45 [Source:ZFIN;Acc... [more]
lrrc451.577e-6528.68leucine rich repeat containing 45 [Source:ZFIN;Acc... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth2r3.670e-6528.93parathyroid hormone 2 receptor [Source:Xenbase;Acc... [more]
pth2r2.301e-5628.38parathyroid hormone 2 receptor [Source:Xenbase;Acc... [more]
pth2r9.745e-5427.51parathyroid hormone 2 receptor [Source:Xenbase;Acc... [more]
pth2r1.139e-5328.97parathyroid hormone 2 receptor [Source:Xenbase;Acc... [more]
hcn44.132e-1237.27hyperpolarization activated cyclic nucleotide gate... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc451.689e-7828.64leucine rich repeat containing 45 [Source:MGI Symb... [more]
Lrrc452.602e-5730.86leucine rich repeat containing 45 [Source:MGI Symb... [more]
Lrrc455.794e-2734.57leucine rich repeat containing 45 [Source:MGI Symb... [more]
Nlrc31.309e-1128.33NLR family, CARD domain containing 3 [Source:MGI S... [more]
Nlrc32.873e-1128.09NLR family, CARD domain containing 3 [Source:MGI S... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZI11|LRC45_CHICK1.025e-8129.54Leucine-rich repeat-containing protein 45 OS=Gallu... [more]
sp|Q8CIM1|LRC45_MOUSE1.181e-7728.64Leucine-rich repeat-containing protein 45 OS=Mus m... [more]
sp|Q96CN5|LRC45_HUMAN3.402e-7729.57Leucine-rich repeat-containing protein 45 OS=Homo ... [more]
sp|Q7RTR2|NLRC3_HUMAN6.698e-1326.12NLR family CARD domain-containing protein 3 OS=Hom... [more]
sp|Q5DU56|NLRC3_MOUSE2.091e-1028.09Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1AUP53.394e-10334.79Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3IM071.772e-10133.38leucine-rich repeat-containing protein 45 isoform ... [more]
A0A1S3INX51.842e-9932.94leucine-rich repeat-containing protein 45 isoform ... [more]
A0A1S3IMD19.118e-9932.21leucine-rich repeat-containing protein 45 isoform ... [more]
A0A2T7PVH99.712e-9933.53Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc451.260e-9731.89leucine rich repeat containing 45 [Source:NCBI gen... [more]
lrrc451.260e-9731.89leucine rich repeat containing 45 [Source:NCBI gen... [more]
nlrc33.909e-1128.34NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc33.608e-1029.15NLR family CARD domain containing 3 [Source:NCBI g... [more]
lrrc74a1.776e-830.19leucine rich repeat containing 74A [Source:NCBI ge... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002444.12.926e-1022.03pep scaffold:Pmarinus_7.0:GL480979:320698:340261:-... [more]
lrrc74a1.142e-728.10leucine rich repeat containing 74A [Source:ZFIN;Ac... [more]
lrrc74a1.674e-728.10leucine rich repeat containing 74A [Source:ZFIN;Ac... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO431961.680e-1631.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350502.254e-1224.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355614.661e-1227.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355636.597e-1235.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393481.030e-1131.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc451.347e-7329.15leucine rich repeat containing 45 [Source:NCBI gen... [more]
ENSORLT00000033051.17.114e-2630.51pep primary_assembly:ASM223467v1:4:31968248:319764... [more]
ENSORLT00000026816.18.643e-2529.66pep primary_assembly:ASM223467v1:4:31968248:319764... [more]
ENSORLT00000031050.12.110e-2430.08pep primary_assembly:ASM223467v1:4:31973141:319764... [more]
ENSORLT00000040321.11.399e-2330.08pep primary_assembly:ASM223467v1:4:31968248:319764... [more]
back to top
BLAST of Leucine-rich repeat-containing protein 45 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060194.10.000e+099.72SMESG000060194.1[more]
SMESG000023093.15.287e-1024.61SMESG000023093.1[more]
SMESG000053819.13.022e-935.48SMESG000053819.1[more]
SMESG000006391.11.470e-727.49SMESG000006391.1[more]
SMESG000053815.11.656e-635.48SMESG000053815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000732 ID=SMED30000732|Name=Leucine-rich repeat-containing protein 45|organism=Schmidtea mediterranea sexual|type=transcript|length=2262bp
TATATAAATCTTATATGATCAAAAATCAAATAAATCATGTCATTAGAAAA
TTTTAAAAACAGATTTCTTAATTTATGTAAACAAGAAAAATTAACTCCAT
CAGATTTTATTATCCAGTCTATACAGAGTGCTTATCATGCCACTAATTCA
AAACTGTATTGTCTGACATTATCAGAGAAAAGTATGAGCTGTGAGATGTG
TAAAGTTCTTTCCGAATGTTTTCGGCATGACACGACGTTTGAGGAAATTT
CTTTTAAAGATTGCATGCTATCACCAGACTGTCTACAGCTAATTTTGGAA
GGCCTTAGTGATAACTGCTGTTGCATTAAATTGTGCTTGAAGGGAAACAA
CATTAAAAATCAAGGCTGCGAATCGCTAGCGAGACTGATTAGTCGTAATA
GCACGATAACCGACTTGTCTCTTGAATGGAATCAAGTTGGAATCAGCGGA
ACTGGATTCGATCAGTTCTGTAACGGTTTAATTAATAATAAAACGCTTCA
GGTTTTGGATTTGAGAAACAATCAAATCGGATTCGATAATTGCCAAATGC
TCACAGAAGCATTACAGAAAAATACAAATCTGAAAGTCCTTGATATGCGA
TACAATTCAATTGGCGTCAGTGGAGGGAAACTTATACTGAACATATTCGA
AAAGAATCGAACCTTGTCAAAGATACTAATTCTCGGAAATAATATCCCAA
TGGATATAATCAAAAATATTGAAAATCTTGCCAACAGAAATGGAGAAATC
TCCGAAGCCAATGAAAGATCAAATTCCCGGTCGGATAGAAATGGGAAGCG
AAATAATTATGAGAATTCAAGAAAATTACAAACATTGGATTTGCTCGATA
GAATAGATGAACAAAACAGCGGATTACGAATGAGTGACAAGAAAAGCTTT
TCGAAAATAATTCAATTGGAGAAATTGCTAGATGAAAGAAAGCAGAAATG
CCAGCATCTGAATGCCAATCTAAATTTGGCTGAATCAAAACTAGAGATGT
ACGAAATACAATTCAAAGAAAACGATGCAAGTTTTCAGAAATCGTTAAAA
GAAAGAGAATATCTGGAGAGGCAATATAATTTACAGCTCGATAAAGAAAA
AGATTATCGGATTGAAATAGAAAAGCGATTTTTAAAAGAGCAATCAAATC
TACAAGAAAGGATATTACAACTCCAGAACAAAGTAGGAGAATTGGAAATA
AATCTCAACCAACAAAACAATAATGTATTCGAATTGAAAGACAAAATTAC
TTTGACAAATTCCGAATGTAAATCGAAAATTCTGGATTACGAAGAACAAA
TAATCAAACTAAAAGACCAAAATAAAAAAGAAATGCATGAAGTTATCGAA
CAGAAAGACAAAGAAATGAATAAAATGCGGCATGAATGGAATTTGAATGA
AGAAAAATGGCGAGAAAAACTCATAAAAAACGATGAGATCCGAGAAGAAC
TTAATCAAGAAATATCGAGTCTAAAAAATCAAATTTCTTCTGATAGAATA
CAACATGACGAAGATATCCATAAGATCAAGCAGAAACTCCACGCCGAACA
AGATCAGAAAATCAGTAAGCTTGATGAGCAACTCAAAACAATGCAAATCC
TAAAAGATGAAATCGAATCACAAAATAATCGACAGGCTCGAGAAATCGAA
ACATTACAAAAGGATAATTCGAAATTGAAAATTGAATTGGAAAGCTTAAA
AATCAAAAAAGAAAATTTGGAAGAGGAATTATCGGGAAAACAAGCCACAA
TGATGAGCGAAATAGAAAAGGTTCGTCTCGAATATATGCATCGAATCCAA
AAATTAGAAAGTGAAAGACAAAGTCAAGTTGATCTGATATCCAAAATCGA
GCATCAAGATAAACAAATTCAAGAGATGAGGAATTCCTTCAGAGAAGAAT
CGTATTCTCGAAACACAGAAATGCAAACTCTGAAAGATAGACTCAAAAAT
CAAGAAGTTGAGCTAAATCGACGCCATGAAGATGAAAAGACTCGGGCCAG
TGCGTTGCATAATGCGGTGATGCAATACTGTCAACCATCAATACAAAGCA
GTTTTGCTCTTAACAGCCGTGGTGACATGTAGCAAAACATGTGATGCCAG
AATCATTTAATTGGTTATTTGATTGAATAAATTCTCTATTTGTTTTTGTT
TGAGTTGATAAATTTGCTCACTCGAAATATTTATACATCCGGTTTTGTTC
TATTGCTGTATTGTATGTTGAATGGGCAGAGAATTGGAGCAGGTTTGGCT
GCTATGTGACAA
back to top

protein sequence of SMED30000732-orf-1

>SMED30000732-orf-1 ID=SMED30000732-orf-1|Name=SMED30000732-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=682bp
MSLENFKNRFLNLCKQEKLTPSDFIIQSIQSAYHATNSKLYCLTLSEKSM
SCEMCKVLSECFRHDTTFEEISFKDCMLSPDCLQLILEGLSDNCCCIKLC
LKGNNIKNQGCESLARLISRNSTITDLSLEWNQVGISGTGFDQFCNGLIN
NKTLQVLDLRNNQIGFDNCQMLTEALQKNTNLKVLDMRYNSIGVSGGKLI
LNIFEKNRTLSKILILGNNIPMDIIKNIENLANRNGEISEANERSNSRSD
RNGKRNNYENSRKLQTLDLLDRIDEQNSGLRMSDKKSFSKIIQLEKLLDE
RKQKCQHLNANLNLAESKLEMYEIQFKENDASFQKSLKEREYLERQYNLQ
LDKEKDYRIEIEKRFLKEQSNLQERILQLQNKVGELEINLNQQNNNVFEL
KDKITLTNSECKSKILDYEEQIIKLKDQNKKEMHEVIEQKDKEMNKMRHE
WNLNEEKWREKLIKNDEIREELNQEISSLKNQISSDRIQHDEDIHKIKQK
LHAEQDQKISKLDEQLKTMQILKDEIESQNNRQAREIETLQKDNSKLKIE
LESLKIKKENLEEELSGKQATMMSEIEKVRLEYMHRIQKLESERQSQVDL
ISKIEHQDKQIQEMRNSFREESYSRNTEMQTLKDRLKNQEVELNRRHEDE
KTRASALHNAVMQYCQPSIQSSFALNSRGDM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 509..607
NoneNo IPR availableCOILSCoilCoilcoord: 362..403
NoneNo IPR availableCOILSCoilCoilcoord: 408..450
NoneNo IPR availableCOILSCoilCoilcoord: 462..489
NoneNo IPR availableCOILSCoilCoilcoord: 626..653
NoneNo IPR availableCOILSCoilCoilcoord: 291..325
NoneNo IPR availableSMARTSM00368LRR_RI_2coord: 93..120
e-value: 120.0
score: 2.5
coord: 151..178
e-value: 0.052
score: 22.7
coord: 179..206
e-value: 0.95
score: 17.3
coord: 121..150
e-value: 110.0
score: 2.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 241..258
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 239..261
NoneNo IPR availablePANTHERPTHR23170NY-REN-58 ANTIGENcoord: 3..668
NoneNo IPR availablePANTHERPTHR23170:SF3LEUCINE-RICH REPEAT-CONTAINING PROTEIN 45coord: 3..668
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 27..241
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 7..137
e-value: 2.0E-15
score: 58.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 138..268
e-value: 2.1E-19
score: 71.7
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 178..200
e-value: 0.0077
score: 16.2
coord: 150..165
e-value: 0.35
score: 11.0