Dynein heavy chain 5, axonemal

Overview
NameDynein heavy chain 5, axonemal
Smed IDSMED30000708
Length (bp)14177
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000708

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000708SMESG000049144.1 SmedASXL_018345SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000708SMESG000049144.1 dd_Smed_v6_4569_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30000708SMESG000049144.1 dd_Smed_v6_4569_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30000708SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30000708 gnl|ti|1314596667_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH5 (dynein axonemal heavy chain 5 [Source:HGNC Symbol;Acc:HGNC:2950])

HSP 1 Score: 5866.19 bits (15217), Expect = 0.000e+0
Identity = 2917/4663 (62.56%), Postives = 3615/4663 (77.53%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXX---XVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS-----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKE---RKTAKQLAAEALQSNE-KDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSED--IVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++K E+ AKR+ LD RH YL   VA   DL  TEVE++IL+GNQIE +D+ F+      L F++Q+ E E ETG    +G   +   ++ KPKVF+T+G +  L G CV F+R+     I  + I ++V+F +++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV VLS A+ES+ E+V L+ C  ++LK ++ P D + + NN E L K+E C+ +W+KQ EQVLAE++Q+ +EAD++GPRAEL++WKKR++KFNYLL+QLK P+VKA + +L AAKSK LKTW EMD RITDA NEAKDNVK+LYTLE+ C PLY ++P  M+D IP LI++++MI+SIS YYNTSEK+TSLFVK+TNQ+I++CKAYI+N+ T ++W    + + +++L   +L + YQ CF +TK +L   P+ +QF+ SEMYIFGKF+TF RRL+ II IF  +KTYSVL D++IEGLE M  K+  IV+TIKKK YNFLDQR+ +F QD+++F +Q  +LHN +  FMD  F  I +T +A++ L++FERLNIP+LGI++KY  IL +YG D++ + K Y++ K DPP+AR+ P IAGKI WARQLF RIQ PM++F+ QH  +L T EAK II++YN++A+ L+ FE+++H+AW+RQI   H GL +SL+++ P T EL+VNFDP ILIL RET+ M ++ LE+ P A +L  K++  K  F N  M++  Y Q+V + IP   EQL+V  +AK+   ++PGL    WTS+ ++ Y+++ +  + +LELLLDR  DL ++RID +LEEMS+  LC+LP + P+T +EF+  T++LC+  A++L  KS  VE++VNEL+NML   E   E +         V    E     ++       + ++  A+  +     + K+    + E A ELL HFNH+N++A++KV RNTLE++RKRI +   + +  S     +K ++ P FR +  L IPNIVM P +E+VQ T+N+    IISV KG+ QWS E   +K  ++    ALQSNE  D D E+G        N  Q  +  A                                 S NL    Q KN YKNV+ENKE+ K+ S+LST INST+KEV T+M  F  Y+H+W K K+  ++ F+   P +SEF+  I  +  LE +INAE +Y   G IAL+T  LK  L +ETKAW +  G+ CN KY++EME IF   E+  K+L+R IKDLDDIRIAM ALKEIRE +I ID  + PIEESYA+L RY L + ++E ++VDTL Y W+KL++R  +VQ+ L+++QP F+  LI  V++F +DC +FY DYD +GPM  GL P+EASDRLI+ QN++DN+ R++ITY+GGEELFGL  T Y +L +IKK+LNLLQK+Y+LYN VI +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD TSEII+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS +S+DKIF +IG GHYC +RGF++EVR  V  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSR+WQGM+NT  +VI     LL LWKHEC RVI+DRF    D++WF K L   + E+  E+  ++    +   D +F+DF+RDA EA GE  ++ D + PK+YEPI SF  LK+RL MF  LYNESIRGAGMDMVFF DAM HL+KISR+IRTP+GNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +L  +MKKE+PR  PTN+NL +YF+SR +QNLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+L+S++I C+  +KKE++  MG   DGVAE CVDYFQRFRR THVTPKSYLSF+ GYK IY EK      LA RM++GL+KL EA ESVA L + L  KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKD+AQ+IV+ I +DK IAE KLEAA+PAL EAE AL TI+P+DIATVR LGRPPHLIMRIMDCVL+ FQR++  +  D E++   PSW ES+KLM+   FL NL  FPKDTINEE +E +SPY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD+KQ EL  VQA Y++A+ +KQTLL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E++ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLE+NFIK GSTFKVKVGDKEVDV+ GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  LMEDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TE++INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++  ++K EEF T IKGGASLD+    PKP  WI D+TWLNLVELS L QFS VLDQ+SRNEK W+ WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GEK+AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL +D+++EL  +I E+  V+  +RLWMT+E H QFPI  LQ++IKF N+PP+G+RA L+R+++ ++QD LD      WK M Y++AFLH TVQERRKFG LGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  +RYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKD+  G  ETRE++V +   +ML+K+P +++PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLAIDG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF ELI+RN+QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT++  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI I+A     +     D + Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKGEKEAKRALLDARHNYLFAIVASCLDLNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVE-EAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATSHGWGELEGLQDAANIRQEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKEPTDYLTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLLEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASIWNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEFCKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADIDMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQ-QHPAVLSTAEAKPIIRSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGTGELFVNFDPQILILFRETECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEY-QRVKSKIPAAIEQLIVPHLAKVDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPLCQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLPIFRASVTLAIPNIVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVEMGE-------NELQDTLEIA---------------------------------SVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDCFKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTADLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAALKEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKLVSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPATQYPQLLEIKKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDCGI---DTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRDPRFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALLCDVK 4624          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 5345.4 bits (13865), Expect = 0.000e+0
Identity = 2678/4660 (57.47%), Postives = 3448/4660 (73.99%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEK-ETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++E L E+Q + +E R ++R ++D  ++Y+   +A+   L+   VEE ILD   +E    FF+ D   TL F +QE ++   E G  I     G K       K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL ++++ EL + +  +   +  +R+W+T+E HD+FPI  LQ ++KFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  YI +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P ++IP +V  ++ KMG    MNIFLRQEIDR+ +VI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GA+WD+RNG+L+E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  122 LQETLKERQARFREARESRRLKIDPSYKYIFEILAENLGLDIVTVEELILDCPSLEAFTNFFAKDGCKTLKFLYQEGDVPGIECGRTIAGATKGAKMM-----KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4707          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 5301.49 bits (13751), Expect = 0.000e+0
Identity = 2647/4557 (58.09%), Postives = 3397/4557 (74.54%), Query Frame = 3
Query:  456 KVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL ++++ EL + +  +   +  +R+W+T+E HD+FPI  LQ ++KFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  YI +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P ++IP +V  ++ KMG    MNIFLRQEIDR+ +VI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GA+WD+RNG+L+E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:    3 KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4490          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4689.41 bits (12162), Expect = 0.000e+0
Identity = 2375/4113 (57.74%), Postives = 3047/4113 (74.08%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEK-ETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLM 12470
            ++E L E+Q + +E R ++R ++D  ++Y+   +A+   L+   VEE ILD   +E    FF+ D   TL F +QE ++   E G  I     G K       K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+
Sbjct:  122 LQETLKERQARFREARESRRLKIDPSYKYIFEILAENLGLDIVTVEELILDCPSLEAFTNFFAKDGCKTLKFLYQEGDVPGIECGRTIAGATKGAKMM-----KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLI 4169          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 2000.71 bits (5182), Expect = 0.000e+0
Identity = 1209/3574 (33.83%), Postives = 1946/3574 (54.45%), Query Frame = 3
Query: 3525 VAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTD---CGEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISR--IHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSEN-GEWVHWNSKV-EEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSE--DLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKN-------KVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKP-KAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECR--AISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQ-DYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMV-ITKWYFQEPMFQPDFFINPIQKIVVF--NTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPK-DSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN----LTYIANAELVC-SKSAEHWIMRGVAMLCDI 14108
            V +++++ K+Q+ +S+ + +    ++  +  +  Y  +W   KD+ +  + + +P VS F   I  Y  + + +  E    +   + L    LK  L+     W+  +           + ++ T+ ++  +++SR  + L+++ +++  +  ++ +   ++  I PI E +A+L +YE+PV+    E +D+L   W          +  L   + +F++ LI +   FKK      ED++  G     +    A D++   +     +     +      +F +       L++++KEL+ LQ+++ +  D   + N +    +  +  E +         R  KL K  KD  W   E  R  I+ F   +PL+  + NPA++ RHW ++ D     FD ES+ F L  I+E  + +  E+I +I  SA KE  IE  L+ +   W   +L    +K++G   LRG  T E+   +ED+ + LS++ ++R+   F+KD+      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F  ++ +W  IM R +++ N L+       L  L+       +I QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK ++  +      ++E +   +S +GE ++    V  E  VE WL  +    + +L  ++R  + ++        +++  +  QV +   Q+ WT D T+ L+ AK  +D+KI++   +  + +LN   +    +L K+ R K   L+TI +H +D+ ++L K  +   + FDWL Q RFY+ +D+D C++  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +D++ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV A QI  +LS        F F DG  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF +  +LA+K YTLY L  +QL++Q HYDFGLR + S+LR  G+++R  P  T++  ++  +RDMN++KL   D PLF +++ DLFP I+L    Y +L   + ++I +  + S P  + K+ QL+ET+  RH  M +G +G+GKT    +L  +L+     G+P+    RE  +NPKA++  +++G  D+STN+WTDGI S++ R     +K +  W++ DGPVD +WIEN+NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   + L W P ++ WL KR   E   +  +F      +  +        +   E   +   C L   L   ++  + +         E  ++FS++WS+ A ++ E R ++++Y+R    I+   P     ++DT+++Y V      W  +  K+ + + YP ++ P Y  I+VP VD VR ++L++++ + +  +LL+G  GT KT +    L S          +N S+ T     Q  IES V+KR    Y P  G+ M  F+DD+NMP  + +G Q   E++R  ++  GF+          I +M  MAAM  PGGGR  I  RL+ +F I N T P+ S I +IF   GT    K + F +EV+ +   +   T  ++     + LPTP K HY+FNLRD+S+++QGM+    D      ++  LW HEC RV SDR V   D   F+  +   L    DL+   +  S+       F DF+++                PKVYE +     LK  ++     YN S     M +V F +A+ H+ +I R+I  PRGN LLVG+GGSG+Q+L +LAS I  Y  FQI +T+ Y      +D+K LYR AG + K  +F+F D +I DE FLE +NN+LSSG V NL+  DE +EI   +I   + E  + P ++D+L  Y + R + NLH+VLC SP+G+ FRN   ++P L++  T++WF  WP++AL+ VA   L   ++     + +++      +H  VA+         RR  +VTP  YL  L+GYK +  EK       A ++ +GL K+ E +E V  +   L + +K++A   ++ EE L  +  QK  A+E +        K+ V + K Q++ +  ++D + A        PAL EA  AL ++   DI  ++  GRPP  +  +M  V+I                  +P+W E+ + +    F+ +LINF KD I+++ ++ I  Y    D+  D+  RV      L  W RAM  +  + + V P +  +     +  +    L  AQ  L E  ++L  ++  YDE L +K+ L   +E    K+  A  L+ GLAGEK RW       +  +  LVGD L A AFLSY GPF   +R+ I+N  W  ++   ++P S S  I + L +PT + +W++QGLP+D  S +NGIIVT+ +R+ L+IDPQ Q   WIKN E  + L++  L    + + LE ++  G P+L++++ E LDP L+ +L K+  + G    +++GDKEV+    F  YITTKL NP Y+PE  A+T+I++F V  +GLE QLLG+V++ E+ ELE Q+  L+ ++   K+K+KELED +L  L    GSL+DD  L+  L T+K+T+ EV+++L  +  TEI  + ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF LS+ +S +S   + RI  + +  TY V++Y  R L+E  K+ F+  M  K+   +GK+ ++E++ F++GG  LD       P  +W+ D  W N+ EL  L  F  +++   +  + W  W+   APE+ ++P  +    +  +R+L+VR    DR       +I  +LG +F E  +L+   V E+S PR+P+V +LS G DPT  +  LA+   +  R  A+S+GQGQ   + RL+   +  G WV L NCHL + ++  L ++++  +  + +  +RLW++S  H  FPI+ LQ++IK T EPP+G++AN+ R +  +++  +        +K + +SL F H  + ER+KF  LGWNI Y FN +DF      +  +LD        +     W  ++Y+I+ I YGG VTDD+D RLL   I  ++  + +  P   ++ ++   +    ++  Y+ YIS LP  D P +FG H NAD++      + + +T+LS+QP+    +  G+TRE  V +   ++  KIP   I ++  +K+  +    P+N+ L QEI R + ++  +  +LTDL+  I G++VM+  L +  +CIFDA +P +W K       L  W  +L  R  QF  W +  R PV FW++GF  P GFLTA+ Q   R ++  + DS+     V+      L  PPK+GV++ GL+LEGA WD++N  L+EA+P  L   +P I+        + +++    MY  P Y  P R       +++   +L   + + +HWI RG A+L  +
Sbjct:  928 VEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRG--TEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDI-QKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAV-GMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHF-DGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRPKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLRE---IEGSFP-----NKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNA-PFY-KIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIF---GTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSK---RPPIFGDFLKE----------------PKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVE--QVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEA-------LPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMIL--------------RGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLD--------EYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIP-EMIDYEGTQKLLALDP-SPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNV-SVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHF----RPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSL 4425          

HSP 2 Score: 94.7449 bits (234), Expect = 5.104e-18
Identity = 77/287 (26.83%), Postives = 132/287 (45.99%), Query Frame = 3
Query:  474 GKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPH-FRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMN-----IVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITN 1316
            G     + Q V F+R +      EN  A  V F  + G    +  L   +  V  P  F N   GW      E  R    + L  F+  L++ R  +     L +           P + MN     ++ + E + ++E  +  W +QI+++L+  + +    +N+GP  E+++W+ R    + +  QL    VK    IL  AKS  L  ++++ ++I D + +A+ N+ FL  L+E    L    P  +   +PKLIS +R+I   S +YNT E++TSLF K+ +
Sbjct:  129 GMPVQTQNQLVYFIRQAPVPITWENFEAT-VQFGTVRGP--YIPALLRLLGGVFAPQIFAN--TGW-----PESIRNHFASHLHKFLACLTDTRYKLEGHTVLYI-----------PAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEMLSAQETVE-TGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVCD 393          

HSP 3 Score: 63.1586 bits (152), Expect = 1.894e-8
Identity = 64/290 (22.07%), Postives = 118/290 (40.69%), Query Frame = 3
Query: 1641 FNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMK--ILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKE--LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWT 2498
            F+  + T++      LD + T + +D++ F   I++L     N +   F+ +      +  L  F RL   +  I+  Y K  +  +   + E  + +  RNK+ P +   +   +GK  W   L RRI   M      H  L +    K  +  Y ++ + +        Q W   ++        + ++R  + K   L VNFD  +LIL  E D   +L  E P   +N+  +   L+     L+L+     ++   +  + + L   R+  L + I PGL   +W 
Sbjct:  431 FHKNLHTLRAVRGGILDVKNTCWHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASRE-AIKRTYDKKAVDLYMLFNSELALVNRERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAH-FLPRIGTGKESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFAEIDYWERLLFETPHYVVNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWA 718          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1169.84 bits (3025), Expect = 0.000e+0
Identity = 916/3421 (26.78%), Postives = 1650/3421 (48.23%), Query Frame = 3
Query: 4053 RYELPVQKDETERVDTLRYTWQKLMS-RGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYA-----KLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVIT-----NAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKM-FEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRP----PTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFE------------------IVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXX----XXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGN-KKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVT--QKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGK-------------------IKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEE--VIPDGYNTNLD----TFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFE-------ESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIH-SRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSH-KTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPI----QKIVVFNTV--DEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQ----PMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISW-ESTTLGFWFIELIDRNNQFLK--WLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTR 13781
            RY+ P Q   +E V+     + +++S R + +Q  ++ +Q +F     E+  + K+  +   E ++ S P+     P+EA + +   + + + L               L+ + +A     KL    +EL  ++ ++     V   ++   +  W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+   D   ++ + +++    LS++  + Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQL+E+ GFY       + ++  +QF+ A   P   GR+ +  R  R   I     P  +S+ +I+                   QL   ++ +      L   +      + HYV++ R+L+R  +G+     + IT     +A+ L+ LW HE  R+  DR V  E+  W  K +             + ++ +  +A  +D      EA  + P      + + Y P+   ++L+D +    +G Y E +    + +V F   + H+L+I RI R  +G+ LL+G  G+GK TL++  +++ G  +FQ+ +   Y  ++  ED++ + R AG + + + F+  +  + D GFLE +N +L++G V  LF  DE   +  ++     KE  +R      ++D L ++F  +  +NLHVV   +P G   R RA   P L + C ++WF  W ++AL  V      + +                  +   P  +  ++ ++ +VH  V +      ++  R    TP+ +L F+  + S++ EK          ++ GL K+ E +E V EL++ L  K     ++   AN + +E+L     Q+ A  E K   Q+ K+ A+ + +  E+ K   E+ L   EPA+ EA+ A+  IK + +  V+ +  PP  +   ++ + I     + T             W    ++M  + F+  ++ F  + +  E ++ +  Y++  D+  D   R       ++ W RA + +  +  +V PL++ L + +    K  ++       + E ++ +GK +  Y + + + + +  D  + + K+  + EL+  L  E+ RW++ S+ F  Q+D LVGD L ++AFL+Y G ++Q  R+ +   W   +    + F   L  I+ L+      +W L  LP D+L  +N I++ + +RYPL+IDP GQ   +I  + A K +Q TS   + FR++LE +L  G  LL++D+ E  DP L+ VL +   + G    + +GD+++D+   F++++ T+     ++P+I +R + ++FTVT   L  Q L  V+++E+ +++ +R  L++ +QG    +++ LE  LL  L  +KG ++DD  +I+ L+  K  +AEV+QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T   KR++ I   +   V++   RG+  +DK+   LL+ +++ +R+                      K +E  + I GG  LD   V+ K           ++ +   +  F  V   +  N      W   + PE    V+ D  +  L         L++V    PDR ++ A + +  +  + F     +  DKV +       E  P  P++   + G D +  IE LA +   +  +I++G  +  + +   +     +G WVLL+N HL   ++ +L + +  S   +A +RL++T+E H + P + L+ +     EP  G++ANL RS + +    L        + ++  + +LH  VQER ++ PLGW+  YEF+ AD       +   +D +   + + +   + W  +R ++S+  YGG++ + FD  LL  + +  F    F+ D  + P       +   N    D+   ++  L     P   GL NNA+    TK  + +L  +L +   D      E  +  V  Q    L ++    +     E +      +    P+  F  +E++   +++ ++R  L ++          N+  R     +   ++P  W++ +     T+  W  +L +R  Q ++    ++ +   FW+ G F+P+ ++TA RQ+V ++ + W+ + + L   + R
Sbjct:  236 RYQFPAQWLYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQ---EDELVEKRTVETLTE-WNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQLTNAMVDV-----YLASQEHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVD------------TTAERYFGNACRLD------EAL-KRPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGD---QQKAEEEKKFSEQLQKELAEQLKQMAEK-KTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT------------DWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLK-LQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHF-----MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLH-SMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQA-NTWSLEQLNLHIHIGR 3546          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1168.68 bits (3022), Expect = 0.000e+0
Identity = 918/3422 (26.83%), Postives = 1653/3422 (48.31%), Query Frame = 3
Query: 4053 RYELPVQKDETERVDTLRYTWQKLMS-RGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYA-----KLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVIT-----NAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKM-FEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRP----PTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFE------------------IVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXX----XXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGN-KKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVT--QKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGK-------------------IKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEE--VIPDGYNTNLD----TFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFE-------ESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIH-SRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSH-KTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPI----QKIVVFNTV--DEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKM-----GAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISW-ESTTLGFWFIELIDRNNQFLK--WLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTR 13781
            RY+ P Q   +E V+     + +++S R + +Q  ++ +Q +F     E+  + K+  +   E ++ S P+     P+EA + +   + + + L               L+ + +A     KL    +EL  ++ ++     V   ++   +  W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+   D   ++ + +++    LS++  + Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQL+E+ GFY       + ++  +QF+ A   P   GR+ +  R  R   I     P  +S+ +I+                   QL   ++ +      L   +      + HYV++ R+L+R  +G+     + IT     +A+ L+ LW HE  R+  DR V  E+  W  K +             + ++ +  +A  +D      EA  + P      + + Y P+   ++L+D +    +G Y E +    + +V F   + H+L+I RI R  +G+ LL+G  G+GK TL++  +++ G  +FQ+ +   Y  ++  ED++ + R AG + + + F+  +  + D GFLE +N +L++G V  LF  DE   +  ++     KE  +R      ++D L ++F  +  +NLHVV   +P G   R RA   P L + C ++WF  W ++AL  V      + +                  +   P  +  ++ ++ +VH  V +      ++  R    TP+ +L F+  + S++ EK          ++ GL K+ E +E V EL++ L  K     ++   AN + +E+L     Q+ A  E K   Q+ K+ A+ + +  E+ K   E+ L   EPA+ EA+ A+  IK + +  V+ +  PP  +   ++ + I     + T             W    ++M  + F+  ++ F  + +  E ++ +  Y++  D+  D   R       ++ W RA + +  +  +V PL++ L + +    K  ++       + E ++ +GK +  Y + + + + +  D  + + K+  + EL+  L  E+ RW++ S+ F  Q+D LVGD L ++AFL+Y G ++Q  R+ +   W   +    + F   L  I+ L+      +W L  LP D+L  +N I++ + +RYPL+IDP GQ   +I  + A K +Q TS   + FR++LE +L  G  LL++D+ E  DP L+ VL +   + G    + +GD+++D+   F++++ T+     ++P+I +R + ++FTVT   L  Q L  V+++E+ +++ +R  L++ +QG    +++ LE  LL  L  +KG ++DD  +I+ L+  K  +AEV+QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T   KR++ I   +   V++   RG+  +DK+   LL+ +++ +R+                      K +E  + I GG  LD   V+ K           ++ +   +  F  V   +  N      W   + PE    V+ D  +  L         L++V    PDR ++ A + +  +  + F     +  DKV +       E  P  P++   + G D +  IE LA +   +  +I++G  +  + +   +     +G WVLL+N HL   ++ +L + +  S   +A +RL++T+E H + P + L+ +     EP  G++ANL RS + +    L        + ++  + +LH  VQER ++ PLGW+  YEF+ AD       +   +D +   + + +   + W  +R ++S+  YGG++ + FD  LL  + +  F    F+ D  + P       +   N    D+   ++  L     P   GL NNA+    TK  + +L  +L +   D      E  +  V  Q    L ++    +   + ++I KM         P+  F  +E++   +++ ++R  L ++          N+  R     +   ++P  W++ +     T+  W  +L +R  Q ++    ++ +   FW+ G F+P+ ++TA RQ+V ++ + W+ + + L   + R
Sbjct: 1168 RYQFPAQWLYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQ---EDELVEKRTVETLTE-WNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQLTNAMVDV-----YLASQEHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVD------------TTAERYFGNACRLD------EAL-KRPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGD---QQKAEEEKKFSEQLQKELAEQLKQMAEK-KTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT------------DWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLK-LQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHF-----MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLH-SMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQL-LPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQA-NTWSLEQLNLHIHIGR 4478          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1168.68 bits (3022), Expect = 0.000e+0
Identity = 918/3422 (26.83%), Postives = 1653/3422 (48.31%), Query Frame = 3
Query: 4053 RYELPVQKDETERVDTLRYTWQKLMS-RGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYA-----KLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVIT-----NAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKM-FEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRP----PTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFE------------------IVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXX----XXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGN-KKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVT--QKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGK-------------------IKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEE--VIPDGYNTNLD----TFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFE-------ESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIH-SRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSH-KTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPI----QKIVVFNTV--DEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKM-----GAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISW-ESTTLGFWFIELIDRNNQFLK--WLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTR 13781
            RY+ P Q   +E V+     + +++S R + +Q  ++ +Q +F     E+  + K+  +   E ++ S P+     P+EA + +   + + + L               L+ + +A     KL    +EL  ++ ++     V   ++   +  W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+   D   ++ + +++    LS++  + Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQL+E+ GFY       + ++  +QF+ A   P   GR+ +  R  R   I     P  +S+ +I+                   QL   ++ +      L   +      + HYV++ R+L+R  +G+     + IT     +A+ L+ LW HE  R+  DR V  E+  W  K +             + ++ +  +A  +D      EA  + P      + + Y P+   ++L+D +    +G Y E +    + +V F   + H+L+I RI R  +G+ LL+G  G+GK TL++  +++ G  +FQ+ +   Y  ++  ED++ + R AG + + + F+  +  + D GFLE +N +L++G V  LF  DE   +  ++     KE  +R      ++D L ++F  +  +NLHVV   +P G   R RA   P L + C ++WF  W ++AL  V      + +                  +   P  +  ++ ++ +VH  V +      ++  R    TP+ +L F+  + S++ EK          ++ GL K+ E +E V EL++ L  K     ++   AN + +E+L     Q+ A  E K   Q+ K+ A+ + +  E+ K   E+ L   EPA+ EA+ A+  IK + +  V+ +  PP  +   ++ + I     + T             W    ++M  + F+  ++ F  + +  E ++ +  Y++  D+  D   R       ++ W RA + +  +  +V PL++ L + +    K  ++       + E ++ +GK +  Y + + + + +  D  + + K+  + EL+  L  E+ RW++ S+ F  Q+D LVGD L ++AFL+Y G ++Q  R+ +   W   +    + F   L  I+ L+      +W L  LP D+L  +N I++ + +RYPL+IDP GQ   +I  + A K +Q TS   + FR++LE +L  G  LL++D+ E  DP L+ VL +   + G    + +GD+++D+   F++++ T+     ++P+I +R + ++FTVT   L  Q L  V+++E+ +++ +R  L++ +QG    +++ LE  LL  L  +KG ++DD  +I+ L+  K  +AEV+QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T   KR++ I   +   V++   RG+  +DK+   LL+ +++ +R+                      K +E  + I GG  LD   V+ K           ++ +   +  F  V   +  N      W   + PE    V+ D  +  L         L++V    PDR ++ A + +  +  + F     +  DKV +       E  P  P++   + G D +  IE LA +   +  +I++G  +  + +   +     +G WVLL+N HL   ++ +L + +  S   +A +RL++T+E H + P + L+ +     EP  G++ANL RS + +    L        + ++  + +LH  VQER ++ PLGW+  YEF+ AD       +   +D +   + + +   + W  +R ++S+  YGG++ + FD  LL  + +  F    F+ D  + P       +   N    D+   ++  L     P   GL NNA+    TK  + +L  +L +   D      E  +  V  Q    L ++    +   + ++I KM         P+  F  +E++   +++ ++R  L ++          N+  R     +   ++P  W++ +     T+  W  +L +R  Q ++    ++ +   FW+ G F+P+ ++TA RQ+V ++ + W+ + + L   + R
Sbjct: 1168 RYQFPAQWLYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQ---EDELVEKRTVETLTE-WNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQLTNAMVDV-----YLASQEHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVD------------TTAERYFGNACRLD------EAL-KRPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGD---QQKAEEEKKFSEQLQKELAEQLKQMAEK-KTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT------------DWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLK-LQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHF-----MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLH-SMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQL-LPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQA-NTWSLEQLNLHIHIGR 4478          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 848/3230 (26.25%), Postives = 1478/3230 (45.76%), Query Frame = 3
Query: 4602 LRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTS--HHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAH-ELHFGTFKN-RGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNP---GYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVR-TDFLMNTVASQEKAVLLI-GEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKR--MGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFY--NLEKPGDFTNIVDMQFMAAMIHPG-GGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGT--GHYCKERG-FNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGE-EPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLK-----ISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGV-VHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTID--VARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRY---EKSMEDLNAAQSVLDEKQKELG-KVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKN--------REAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIK-INSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRN-----EKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNT--VDEYRNYIS-NLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESI-----VYKQCTEMLDKIPSNHIP--FKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLND--------GRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDK--RNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAML 14099
            L K ++ F  +   L+      +   HW  M           +E   FA    +   +++  ++++ +   A  E  I   ++ +   W+A  E     +K+  G+ L       E I+ ++DS  +L SL S+ Y   F        ++L++    + Q   +Q  W+YLE +F  G     LP EA RFS +D  +  I++   ++  ++  C   ++L + L  +++QL  CQK+L  +LE+KR  FPRF+F+ D  LLEILGQ+++P  IQ+H+  +F  I  V+F     ETI++  S EGE + L K V+    VE WL  L +  +R+L  +   A   + D + +    L  YP+QV  L  ++ ++  S E  +N  SD       + +  LL  L          KV   K ++LI   +H  D+ DQL+ ++ KS + + W +Q RFY V      ++     +F Y  E+ G   +LV TPLTD+CY+TL QA+ M +GG P GPAGTGKTE+VK +   +G+ V+VFNC + +D   +GRIF G+ + G+WGCFDEFNR+D  VLS  + QI  +    K R     F  G  V +NP   IF+T+NP   GY GRQ++P+NLK  FR V M  PD ++I    L S GF+D   LARK  ++++L  + L+KQ HYD+GLR +  VL   G  +R      E   V++ L    LSKL   D   F SLI+D+F  +  +   + EL   +     E  I      + K+ QL+E  R R G++ +G +G+GK+    +L ++L    +P +  + NPKA+   ++ G +D+ T +W+DGI +   R   K     H W+V DG +D  W+E LNSVLDDN+ LT+ +G+RI    +   +FE  ++  ASPATVSR GM+Y+S   +    ++  WL+K   +    M       F   +R       +K+  + +F +     L  GL   K  K  +Q           F V+   G L  +    + E + +      + +P  +    D   D ++S   + V  N   EE +  +D  P      V   D  R +D + + + S  +   LI G  G  K  ++ K+    +PE  +      + ++   + Q   ++ V      G  + P     M +F+  IN+P  +++G      +++QLL  +GF+  NLE    + +I ++QF+ +M   G G    I  RL   F +  C   + +   ++ SI  T      +E G  N E+  +   ++ I  ++    +    PT +   ++F+ RDL+     ++  + D       L  +   E  R+ +DR     D   F         E++  +++  SQ  ET    + F       TG   P +++  +P    PI   D        F  L  +SI     ++  F   +T  L      I R++  P G+  L G  G G++   +L +++   ++F   +T +++      +LK     A    + +  +  D +++   FL+ +N++L+SG V  LF + E+D +       +  E   +      LQ++   R +  +HVVL        F+    + P ++  C + +  R+ +++L+ +             P ++ E   S G+   D +     D          + P  Y  F+  +  +   K    S   +R+  G+ KL EA++ VA++++   +K K LA    EA+E LK +T   + A + K  ++ +K   +     IE  K   + +L+  +P + EA  A+ +IK   ++ +R L  PP  +  I+  VL+F    LDT            SW    K +S +   ++++NF  + I  E  + ++  ++ +  + +   A+R     A L +W +A + + +I +++ PL+    K        EK ME+L+     +DE   EL  K + +  EA + K  L  + +T R   T    L         RW  Q   F  +  ++    L  +AF++Y G  +++ R  L  S  K       P    L+   + T+      W  +GLP D+LS++NG I+  +   PL+ID  GQ  +++          + AQ +L             +E ++  G+ ++I+DI  E D AL  +L K+   QG    +  G K +D    F++Y  T+       P  + + +I++FT T+  L  QLL + I  EK ELE +   L+ D +  K +++ LE  LL +L S++G+L+++  L+  L  +K  SAE+  K I+ S+   K + + ++ Y P++   S L+F    +   N MY  S+   + LF  ++   +    T  R++ +   M   V+ +  RG++  D++ F +        +  + K  E  T +    S D++ ++         + W++   L +L +    L  +  N     +  W + F K    E   P      +  F+++L ++   P+R  +    ++  +L          +   +F+ES    P++ +L+ G+DP+  +   A    V   +ISMGQGQEI +   +      G W+ L N HL +  +  +F+ +  +T  +  +RLW+T+E   +FP   LQ ++K T EPP G+R NL R++  + +   +   VI  + +F  LA+LH  +QERR F P GW   YEF  +D      F++     +T  K+      DW+ VR ++  + YGGR+ +DFD ++L       F +           ++ I +  T  V EY  +IS ++P+ D P  FGL  N   S+      R + +I ++   D+     +  + I     ++K+  +  D +P   +P   + A+ I+++   + +N      I ++ + I +V  ++    LA   V       +  +  +   + P  W+ + W   +    ++ ++ +  +    L +          P+ F  +  F P  FL A+RQ  +R       D +IL +  T       + P K+ V + GL L+GA++D   R   +  A     Y   P+  +F              ++ + P+Y    R++L  I +  + C + A+ W +  VA+ 
Sbjct: 1144 LMKDVEHFKEVSSALKFCRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTL-WAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRG----ALPSEASRFSRVDSEYRAILNDVSKDARLVSLC-SRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTG-ETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQA---VADAQPS----LAKYPSQVLCLAEEVKFSA-SIENNLNGSSD-----LNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNG--GIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTF-GGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTSVHH-WIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSWIEEHF---WRCLKWVRSHKISGITSFAI-----LKNGLTHLKASKTKTQ-----------FLVLLFNGFLPTVTPENRQE-FAKGVVFQGMSVPDPKNICYDERIDGIMSYTDD-VSQNVTKEE-VEREDLRP-----FVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLL-KHCFQNDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDHNLE----WVSIENIQFVGSMNPIGDGAAVSISNRL---FSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGERNSEI--IANRMVDIYNKV----QSNFRPTDSVV-FLFSPRDLTNWVVSLLRHELD----QGKLEAVICFEARRIFADRLPTENDKLKF---------EEILRNVIPISQANET----VIFKEKVYVTTGTVVPGESNTGLP--LTPINMSD--------FNQLLAKSINRFAFEIANFNCPLTSQLAFFCACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVA-----LVSEAANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEI-------------PKIQME---SQGITTTDAILTGFNDVLVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMG-ILDT------------SWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFE----RWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSMCKMFNMP--PTFKPLSFASLETEQL---NWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLEKSETFKAAQPDLMT----------QIELAIRFGKTIIIDDIV-EFDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSK-ESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSST--RVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKEWELFTGVLVDESTDLSALR---------VQWISPDRLQSLARIRTHLPSLFNNFQIQDDATWNE-FSKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLSLTTP-HENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKN---VITCQSIFV-LAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQ----LTANKA------DWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKISQIVSLWKKLCQS-DDLPKRELPTAIRSADPISEVLCLETINAL--SLIKQLHRSIGHVAKSMKTPSLASPAV-------QKTIQSLVFQQTPDEWDSM-WAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSR-QIKIPLDQLILSSAWT-----PSQLPAKQCVQVQGLLLQGATFDSFLRETTVSSAA----YSQAPI--VFLAWTSESSSTITGEQIQV-PVYSSSERSDL--ICSVNMPC-RGADQWNIAAVALF 4169          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 98.2117 bits (243), Expect = 1.719e-19
Identity = 116/486 (23.87%), Postives = 215/486 (44.24%), Query Frame = 3
Query: 4611 TIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVK---AESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVG--LLGIQLLWTRDST---EALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKF-ETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLG 6041
             + +F  ++P+L  ++  AMK RHW+ +   +     VE +   +  +LE   ++  ++ E +   A KE+ +E  ++ +K++W      F T +  GELL     T+E+   M+  L    ++LS+ +       I+  +  L N +  +  +      W  +E VF   DIA Q+P E + F  I   W+ I ++  E   +L+     + L+  L  L       +     YL KKR +FPR F +SD  +L ++  + +P   +S++  +F ++ T  F +     I++  S + E + L KPV    ++ +VE W+  L +  + +L   IR     +N     V   LN  P QV    L I   W  +++    +L    S+ KI  +  +  +L              K +R +F   L  I+     + ++L+ ++V    D+ W  Q R+Y+   ++   + +  V   Y  E  G
Sbjct:  684 VLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPL-VSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTAT--FVTHQG-GELL-----TTELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTT--FDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILN-EPIQVAAVYLKIAFTWQMENSMKQNSLTILASELKICIRDCQHAVL-------------HKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYW--HLENVFIRVGTVSTRYDYEVQG 1141          

HSP 2 Score: 68.9366 bits (167), Expect = 1.244e-10
Identity = 76/282 (26.95%), Postives = 140/282 (49.65%), Query Frame = 3
Query: 9960 AANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELI-SPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQ----SSEFKAQIDRLVGDVLSATAF 10790
            AANE  NK      KAQS+  E       +E++L +A PAL  A +AL T+  +D+++++ +  PP+ +   M+ V I    +   +  +         W    KL+S+  FL  + +F +DT++++TV+LI   YL  E++  +  ++      GL  W  A+  + +I+K V P ++ L K +V  ++ ++ L   +  L +  ++L  +   + +  +KKQ L     +C  +M  A  L++ L+GEK +W N+    + E    +   VG  L+   F
Sbjct: 2182 AANE--NKANEAATKAQSLKAE-------SEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEI-GEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVGSSLALHVF 2453          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 4358.9 bits (11304), Expect = 0.000e+0
Identity = 2196/3741 (58.70%), Postives = 2784/3741 (74.42%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISR----------------------IHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +    + A            +   +         +Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct:  994 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPVRTAPL----------NSFAMFSKILSYQPQQVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWK--NDRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4692          

HSP 2 Score: 404.06 bits (1037), Expect = 9.435e-112
Identity = 274/908 (30.18%), Postives = 458/908 (50.44%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQ---PHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y     ET   +  Q   P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   14 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 900          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 4357.36 bits (11300), Expect = 0.000e+0
Identity = 2195/3741 (58.67%), Postives = 2779/3741 (74.28%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISRI----------------------HYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +                                  Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct: 1023 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPP-------------------------------QVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKN--DRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4700          

HSP 2 Score: 403.675 bits (1036), Expect = 1.071e-111
Identity = 274/908 (30.18%), Postives = 458/908 (50.44%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQ---PHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y     ET   +  Q   P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   43 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 929          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 4354.67 bits (11293), Expect = 0.000e+0
Identity = 2196/3765 (58.33%), Postives = 2778/3765 (73.78%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +                                  Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct: 1023 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPP-------------------------------QVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKN--DRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4724          

HSP 2 Score: 404.445 bits (1038), Expect = 5.977e-112
Identity = 274/908 (30.18%), Postives = 458/908 (50.44%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQ---PHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y     ET   +  Q   P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   43 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 929          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 4353.51 bits (11290), Expect = 0.000e+0
Identity = 2197/3765 (58.35%), Postives = 2783/3765 (73.92%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +    + A            +   +         +Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct:  994 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPVRTAPL----------NSFAMFSKILSYQPQQVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKN--DRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4716          

HSP 2 Score: 404.445 bits (1038), Expect = 7.301e-112
Identity = 274/908 (30.18%), Postives = 458/908 (50.44%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQ---PHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y     ET   +  Q   P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   14 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 900          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: kl-3 (gene:FBgn0267432 transcript:FBtr0346771)

HSP 1 Score: 3876.25 bits (10051), Expect = 0.000e+0
Identity = 1953/3546 (55.08%), Postives = 2586/3546 (72.93%), Query Frame = 3
Query: 3507 KNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMM-RFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLI---PRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVF-ETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINEL-FQVIQ-----ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++ ++ V E+K+V +    L+  + S + ++E      F  Y +LWA+ ++  +  F+  +P   +   +   Y  +  +I   S     GPI +        L+SE+K W++  G   +V+YK +++++  F  +    L + I DLDD+R AM  L+++R+N I +D+++  I ++Y++  ++ + V +++ ++V+ L+  + K++    +V D +  ++      L + +  F ++   F  D+D +GPMV G+  +EASDR+ + QNR+D L R+F  YS GE+LFGL +TDY  L   K+E N L +LYSLY  V+ ++  YY++ W DV+IEKIS EL++FQ RCRKLPKG++ WPAF DL+  IDDFN   PLLELMTN AMK RHW R++ L +  FD  +  F L  +LEAP+LK+KE++EDIC+ A KE DIEAKLK + ++WS   L  G FKNRG+L+L+G  T EIIS +EDSLMI++SL SNRYN PFKKDIQ  +SKL N+ +I+E+W+ VQNLW+YLEAVFVGGDI+KQLP EAKRF+NIDKS++KIM RA E  N + CC GDE+L+  L  LL+QLE CQKSLTGYLE KRL+FPRFFFVSDP LLEILGQASDP +IQ HLLS+FD I TV F EK  + I +  SM  E ++ E  V+   +VE+WL  LL   Q ++  ++   + S+ND EFN  E    +  Q G++G+QLLWT+DS  AL   ++D+ IM++TN +FL+LLN  I  T  DL  ++R +FET++TIHVHQ+DIFD L   ++KS  DF+W KQ RFY+ ED D  IV ITDV+F+YQNE+LG TERL ITPLTDRCYITLAQA+GM MGGAPAGPAGTGKTET KDMGR LGK VVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KE++  F+F DGD+V +NPEFGIF+TMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVK+ASCGF +N+VL+RK YTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG QKR+NP DTE+T VMRVLRDMN+SKL+D+DE LF+SL++D+FPGI+L    Y +L+ AI +  DE   +++P W LK++QL+ET  VRHG+M +GP+G+GKT+C   +++  T+ G  H+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRR+LK  + ++ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRI M+ + K++FE  N+DNASPATVSR GMV+ SSS L W   ++ WLLK+  +   +    +   + D + +    L+ KM  LEA  +RQ  D+++GL+   P + EK          ER+++FS+MWS+GA+LE+ +R KLE ++  + + KL  PK  +   +T+F+Y V +NG W HW+++VEE+ YP+D  PE+ SILVPNVDNVRT FL++ +A Q K VLLIGEQGTAKTVMI  Y+   +PE H+FKS NFSSAT P M+QR IES+V+KR G+TYGPP  R MT+FIDDINMPVINEWGDQI NEIVRQ++E +GFY+LE+PGDF+ I+D+Q ++AMIHPGGGRNDIP RLKR  CIFNCTLPSN+S+D+IF  IG G++  +R   DEV +++  L+P+TR  W   K KMLPTPA FHYVFNLRDLSRIW+G++  + +   +   +L LW HEC RVISDRF   +D  WF   +      D   +I    + + E   +++DF+RDA E   EE ++  F+ PK+YE I SFD ++ ++ +F   +NE IRG  MD+VFF DA+ HL+ +SRII  PRGNALLVGVGGSGKQ+LT+L+S+IAGYK FQ+TLTRSYN  NL EDLKFLYRTAG  G G+TF+FT  EIK+E FLE++NN+LSSG ++NLFA+DE+DE+  ELIP+MKK  PRRP T DNL ++F+SR + NLH+ LCFSP+GEKFR R+LKFPGLISGC +DWFQ+WP+DA IAV+ HYL+ ++IVC+  VK ++I  M  +H+ V E C+ Y+ RFRR T VTPKS +SFL  YK +YK+K DH   +++RM SGL KL EA  SVA LK+ L E  K +A+A+ EAE+VL TV   K AA  VK +V   K +A+ +V+ I   K +AE+KLE A PAL EAE AL TIK ADIATVRKLG+PP+LI  IMDCV I F+R++  +  D E+   + SW ES+K+MS+  FL  ++ +P D IN E V+++ PY +   YT + A+  CGNVAGLLSWT AM  +FE+NKEVLPLK NL  Q+ +Y+K+  DL  A+ +L +K+ EL +VQ   ++A+ KK  +LD+A+ C+ KM AA  LI GLAGEK+RWT Q + FK++ DRLVGDV+  TAFLSY GPFNQEFR+ L + W K++  + IP S ++NII+ LTD + +GEW++QGLP DELS+QNGII TKA R+PLLIDPQ QGK+WIKN+E Q ++ VT+LNHKYFR HLEDS+S+G P++IED+ EELDP LDN+L++N +K G+ +K+K+GDKEVD    F  YITTKLPNP+YTPEIFARTSIIDFTVTM+GLEDQLLG VI  E++ELE +R+QL+E V GN KKMKELE NLL +L++TKGSL+DD  +I+VL T+K T+ EV +K+ IA  TE KIN+AREEYR VATRGS+LYFL+  M+ VN MYQTSL QFL  FD SM  S K+ +TQKRI+ II  +T+E+++Y  RGLYE DK  F LLMAL +D +   I  +EF  FIKGGA+L++N   P P  W TD TWLNLV+L+NL  F  +L +VS NE+ W  W+ K+APE E+IPDGYN+ LD FR++LLVR WC DRT+SQ +KYI +SLG++FAE  +L+ +++  ES    PM+  LS+GSDP+  IE+LAKK++++C  ISMGQGQEIH+R+L+ + L  GGWVLLQNCHL ++Y+ EL  Q+++     +   VN  +R+W+T+E H +FPI  LQ+ +K+TNEPP GIRA L+R++ +L+QD+LD      +  + YS++FLH  VQERRKFGPLGWNIPYEFN +D+ A  +F+QNHLD I      +  GI W  VRYM+ E+QYGGRVTDD+D RLL   T+ +F + +F+  F      K+  F   + Y   I ++   D P  +G H+NA+I+Y T T + IL+ I+SIQPK+S  G GE+RE  V +Q  EML K P     F V + +  MGA   MNIFLRQEIDR+ ++I  VR    DL LA++G ++M++ LRDALD IF+A++P ++++ SW S++LGFWF EL++R+ QF  W    RPV FW++GFFNPQGFLTAMRQEV R+H GWA D V + N V +   EE ++PPKEGV++YGLF++GA WDKR  RL+EA  K+L+  +PVI+I+A+         +++K+Y  P+YKK  RT+L YI    L  +K  +HW +RGVA+LCD+K
Sbjct: 1075 RSYFRYVMEHKDVIRAVQNLANGLLSYKSDMEEFQRDMFEKYKYLWAEDREDIINSFVLTNPLTVDIRDMFLHYDNISLKIETMSAKRIIGPIEVRMGSTIEKLVSESKKWKVLLGHLLSVQYKKQLDEMIEFITEQNNILDKPINDLDDVRQAMVVLEKVRDNYIEMDVSLQLITDTYSLFSQFYIYVPQEDYDKVEGLQVLFNKMLENAKKVSDRISEMEEPLLRELNDGIATFVQEFYDFNLDFDLNGPMVEGISAKEASDRVFLFQNRFDELWRKFEMYSSGEKLFGLPITDYPLLHQRKREFNYLNRLYSLYIQVLKTITDYYEMPWADVNIEKISAELSDFQLRCRKLPKGMQSWPAFIDLKTKIDDFNETCPLLELMTNKAMKERHWIRLNALFNTDFDPTNPKFTLGKLLEAPILKYKEDVEDICVGASKELDIEAKLKQIVSDWSLVSLQLGQFKNRGDLVLKGGETLEIISSLEDSLMIMNSLASNRYNAPFKKDIQLWLSKLVNTGDILEKWLMVQNLWIYLEAVFVGGDISKQLPMEAKRFTNIDKSYVKIMMRAREIPNAVDCCTGDESLATNLTWLLDQLETCQKSLTGYLESKRLVFPRFFFVSDPVLLEILGQASDPTSIQPHLLSIFDAIATVDFQEKSIDIIESMNSMNREKVKFENTVQCLGSVELWLGRLLKEMQDTIRTILAQMSVSLNDPEFNFAEEFPSFCGQAGVVGVQLLWTKDSEYALRKCRTDKTIMKRTNNKFLVLLNFFIDLTVKDLTSLDRIRFETMVTIHVHQRDIFDDLCTLRIKSAGDFEWQKQARFYYNEDNDDVIVGITDVNFVYQNEYLGVTERLAITPLTDRCYITLAQAVGMCMGGAPAGPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKEKRSTFIFLDGDIVSLNPEFGIFITMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKMASCGFKENVVLSRKMYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGSQKRSNPNDTEETIVMRVLRDMNVSKLIDEDEGLFVSLVDDMFPGIKLTTNVYKDLQKAIIKVCDELGYVNNPEWNLKVVQLYETSLVRHGLMLMGPTGSGKTSCTVCMLRCFTEMGRTHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRSLKVPQHQNCWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIKMADNSKLVFEPDNVDNASPATVSRVGMVFTSSSVLSWKIYMEAWLLKQGEDSE-VFRRCYDVLYDDAHVFLQSRLLAKMRILEAIYIRQMLDIMDGLLLDLPLRTEK--------ALERIFLFSLMWSLGAVLELSEREKLEEFLLKHVS-KLRWPK--RGVNETIFEYYVDDNGNWQHWSTRVEEFRYPEDEIPEFSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPEVHIFKSFNFSSATTPNMYQRIIESYVEKRQGTTYGPPNQRAMTIFIDDINMPVINEWGDQITNEIVRQMIEQRGFYSLERPGDFSTIMDIQMLSAMIHPGGGRNDIPNRLKRHLCIFNCTLPSNNSMDQIFKSIGAGYFSPDR-LGDEVVEVIPLLVPLTRIFWQNVKAKMLPTPANFHYVFNLRDLSRIWEGILKVKHEECKSVDQILKLWCHECTRVISDRFTAEKDKIWFSSKM----ISDAELNIKEFMEFYPEEPTYWVDFLRDAPEGQEEEDEEMSFEPPKIYEEIPSFDFVRSKVLVFMSQFNEYIRGYNMDLVFFMDALKHLMIVSRIISNPRGNALLVGVGGSGKQSLTRLSSFIAGYKFFQMTLTRSYNTGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILSSGEIANLFAKDELDEMYSELIPVMKKHQPRRPATQDNLYDFFISRARYNLHIALCFSPVGEKFRMRSLKFPGLISGCVIDWFQKWPEDARIAVSRHYLTDYQIVCSEKVKDQVIDIMSWIHESVQETCLSYYDRFRRVTFVTPKSLISFLESYKLLYKDKQDHIVIMSERMSSGLDKLDEAGASVAILKKDLIEMNKVIALASEEAEDVLATVEQSKAAAEIVKVEVAEKKGQAEVLVKNISAVKHVAEAKLEKALPALEEAEAALKTIKAADIATVRKLGKPPYLITLIMDCVCILFRRKVKPIRPDTEKAFIQSSWDESLKVMSDTSFLRKIVEYPTDLINAEMVDMMVPYFQYPQYTFEAAKVACGNVAGLLSWTMAMSKYFEVNKEVLPLKANLAVQEAKYQKASSDLQEAEELLQQKENELAEVQQTLEDAVSKKDAVLDEAKKCQDKMDAATALIGGLAGEKIRWTEQIASFKSETDRLVGDVILLTAFLSYTGPFNQEFRSDLQSIWTKQIIEKMIPISANVNIIESLTDRSQIGEWNIQGLPTDELSIQNGIISTKAMRFPLLIDPQSQGKVWIKNKEKQNKVIVTTLNHKYFRNHLEDSVSMGIPIIIEDVAEELDPCLDNLLDRNLLKVGTQYKIKIGDKEVDWNPAFRCYITTKLPNPAYTPEIFARTSIIDFTVTMRGLEDQLLGRVILAERKELEDERVQLVETVTGNMKKMKELEANLLQKLSTTKGSLLDDVTVIEVLNTSKNTAIEVKEKIEIAKVTEAKINAAREEYRVVATRGSVLYFLVCSMARVNNMYQTSLVQFLERFDASMYNSSKTHITQKRIKRIINYLTFEIYRYKSRGLYEKDKFLFVLLMALSIDRQLELITFDEFQVFIKGGAALNLNDCPPVPFRWTTDETWLNLVQLTNLTPFVNILSKVSGNERAWFTWYKKDAPENEIIPDGYNS-LDPFRKMLLVRSWCMDRTISQCRKYIANSLGDRFAEPVVLNFEELLLESRELMPMICFLSLGSDPSSNIELLAKKNELKCHPISMGQGQEIHARKLILSCLEDGGWVLLQNCHLGLEYMVELTVQILELERQGKDAAVNPNFRIWITTEPHPKFPITLLQMCLKYTNEPPAGIRAGLKRTYTNLSQDFLDYSQSPFYLPLVYSISFLHTVVQERRKFGPLGWNIPYEFNSSDWYASCLFVQNHLDDI-----EQGKGISWVTVRYMLGEVQYGGRVTDDYDKRLLNTFTRVWFHDTLFEDCFQFFKGYKVYSFKEQEAYLAAIDDMANVDPPQVYGFHSNAEITYQTNTMRNILDEIMSIQPKESSAGTGESREDRVARQVKEMLSKTPLAFDLFDVKQHLIAMGATSSMNIFLRQEIDRMQRIIILVRSIFKDLLLAVEGTIIMSENLRDALDNIFNARVPTVFKRGSWVSSSLGFWFTELLERHTQFYNWCFGARPVVFWMSGFFNPQGFLTAMRQEVARAHQGWALDQVTMHNDVLKVGPEECKKPPKEGVFVYGLFVDGAGWDKRTSRLVEATNKVLFTLMPVIHIYAI----FSTAAKNSKLYTCPVYKKINRTDLNYICALWLQSNKHPDHWTLRGVALLCDVK 4593          

HSP 2 Score: 282.722 bits (722), Expect = 3.921e-75
Identity = 216/877 (24.63%), Postives = 425/877 (48.46%), Query Frame = 3
Query:  183 IKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQ-IELMDKFFSSDDTNTLFFHFQEPELEKETGD----QIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGS--NGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEI--DLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKS-KTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQ---LCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ++E R  + S L    +Y+L   AD   ++  E+   I+D ++ +E ++  F  ++   +        +     D    Q ++  T I++S  ++  +         L G+  V  R +    I+  +++ +V   +I+    N  L  ++ +M  V+ P    +   +G  EK++  +    + L  +   L ++  +++ RV   +  E+   L  +R  I+  + +    +L  VE     WL+QI+ +L E  QI+R+  ++GP   L  W++ +A++  + + +           L  ++S K L  W E+D ++T A NEAKDNV+++ +L++   PLY+++P ++I ++P L+ ++R +   + Y+NT   +T L VKI+NQ+  + K YI+++    V                   + Y+  +  T   + N  +ER + +S +YI      F +RL  +  I     TYS+L    I G+E           TI  + Y+ L+ R   F  DF+ F+ +++E    +  F+        S    +  L+RFE L++  L ++ +Y+++     R++  +   Y+  + +P + R++P +AG+I W R +F++I  PM+  +++ Q +L   +A+  ++ YN +   +  +E+ YH+AW   +      LN+ ++  + E     VN D  IL L  ET+ M KL LE+P  A  +   ++ L      L LM+    ++  S+   +  +M  R+ ++  +++P L+T  W S  L++Y++ V   + E+E   +   D+   RI   L+EM +I       +P + PV+  EFV  + +L  +  ++L+ KS  +E +V ++INM 
Sbjct:   46 LREMRQQRISSLGPNQRYVLEICADLLGIDPEEIVTGIVDESKYVENVNGIF--EEKGPMAIMISNATMLGYPTDSGRYQEKLKYTEIQRSVCLRSDL-------VDLIGKWTVVYRLNNEKSIDNRSVSDEVAIFMISAEERNSCLNVVKTFMDHVLKPSIEAVTE-FGLAEKEQTQK--FFHILNMYNTFLKSSEATVSSRVNFDISHELFKGLLLVRWQIEASSKILTRVRL--VERYFEQWLRQIQGILVEGKQIQRDTPDVGPLQMLVNWRRMLARYTTITEFVTSRAFNNHKDCLTLSRSSKLLNRWAEIDNQVTLALNEAKDNVRYISSLQKFWDPLYRSSPNVIISSLPGLMVAIRNVSKTAHYFNTPVNVTGLMVKISNQLTITSKNYITDNEHSKVM------------------ENYKNIYIHTVDEMKNS-NERPWTVSSVYILTCLQKFLQRLEKVKWIANTDITYSILDRIMISGMERFNAMIKGARMTISSQLYDPLNYRIETFDLDFEKFVNEVEEAEVGMQQFVKLLSTECPSAASVMLVLKRFEALSLECLCLDRRYLEVAEMLEREMFLLKDVYNEERGNPFIPRNLPPVAGRIIWIRSIFKKIDLPMQALKLR-QCVLAHKKAQRTVRYYNYMNGIICHYEMAYHKAWFDYVEEVRCLLNAPIMTINKEEAIYIVNIDRAILQLISETEWMWKLNLEVPNMAATITYCKDRLLGPATTLKLMLQRYDRLRTSLTPVFINIMRFRLQEISILLKPSLSTVTWISENLEDYVEKVCMKIKEVETFFNLILDIEDLRI---LQEMYSISDYLYIYVPEE-PVSSYEFVEESNKLRSEIERILEKKSVCMERAVVDIINMF 884          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 5053.42 bits (13107), Expect = 0.000e+0
Identity = 2477/3718 (66.62%), Postives = 2999/3718 (80.66%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAE---ALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A ELL HFNHRN++A++++ RNTLE+LRKRI A +++       S  +P FR    L IPNI+M+P ++EVQH +NR    ++SVSKG+ QWSKER + ++++     AL+ N ++ + E      ++  +   S++S                                   SAN    +Q+KN +K+++ENKE+ K+ S+LST INST+KE+  A+ RFS Y H+W K ++ T+++F++ +P +SEF+  I  Y  LE +INAE ++   G +AL+T  LK+ L +ETK+W + +G+ CN KY+ EME+IFTF ++  K+L+RQIKDLDDIRIAM  LKEIRE++I ID  + PIEESY+ML +Y L + K+E E+VDTLRYTW+KL+SR ++VQ+ L+++QP+FR  LI+NV+ F +DC  FY DYD   P   G    +A  +L         +   +IT++GGEELFGL VT + +L +I+K+L LLQKLY LYN VI++VNGYYDI W D+ I++I+NEL +FQ RCRKLP+GLK+W AF DL+KTID+F+   PLL+LMTN AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLM+L SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL++FDNIK V+FHEK Y+ ILA  S EGE +EL+KPV AE NVE+WL  LL  +QRSLH VIR A  +I D+ F ++EFL+ +PAQVGLLGIQ++WT+DS +AL NA+ DRKIM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF ED D+ +++ITDV F+YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+K F+FTDGD V+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNI LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYP+LE+AI++Q+ EA +I+HPPW LK+IQL+ETQRVRHGMM LGPSGAGKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNI+NASPATVSRNGMV+MSSS L+W P+L+GWL  R++ E  ++ +LF++SFP++YR+SIQ L YKME LEAF++ Q  ++L+GLI  K++    ++SR H ERLY+F++MWS+GALLE++DR KLE ++R++++I LDLP I   SEDTMFD+ V+ +G WVHWN++VEEYIYP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  Y+S  +PE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQL+E  GF+NLEKPG+FTNIVD+QF+AAMIHPGGGRND+PQRLKRQF IFNCTLPSN+SIDKIF +IGTGHYC  RGF++EVR  V  L+P+TRRLW +TK KMLPTPA FHY+FNLRDLSRIWQGM+    +VI+  + LL LWKHEC RVI+DRF   ED++WF  TL + + E L E+      +   D++F+DF+RDA EATG+EP++TDFDMPKVYEPI SFD L +RL MF   +NESIRGA MDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGYK FQITLTRSYN +NL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP+MK+E+PRRPPTN+NL EYF+SR +QNLHVVLCFSP+GE+FRNRALKFP LISGCTMDWF RWPKDALIAV+ H+LS+++I C   VK E++  MG   DGVAE C DYFQR+RR THVTPKSYLSF+  YK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ FQRR++T+  DPE+N   PSW ES+KLM+   FL +L  FPKDTINEE VE +SPY +M DY I+ A+RVCGNVAGL SWT+AM +FF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DAE CR KM  A+ LI GLAGEK RWT  S EF AQ  RLVGDVL ATAFLSY GPFNQEFRN+L T WQ+E++ R+IPF T+LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+R+PLLIDPQ QGKIWIKN+E++ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK G T+KVK+GDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVTM+GLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLVDDE LI VL  TK T+ EV+QKL IA++TEI+IN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS+++S KSP+T KRI NIIE MT+EV KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+    PK   WI D+TWLNLVELS L QFS +LDQ+ R+EKQWR WFD+EAPEEE IP+ Y+  LD FRRLLL+R WCPDRT++QA+KYI  S+GE++AEG ILD +K +EES PRTP++  LSMGSDPT +I  L K+ ++E R +SMGQGQE+H+R+L+ + +  GGW LLQNCHL +D+++EL   I E+ +V+  +RLWMT+E H  FPI  LQ++IKFTNEPP+G++A L+R++  ++QD LD   ++ W+ M Y +AFLH TVQERRK+GPLGWNIPYEFNQADFNA   F+QNHLD I  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   + VD+Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE+IV +   +ML+K+P + +PF+V E++  MG  QPMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W+K SW STTLGFWF EL++RN QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D ++L N VTR+  +++ +PP EGVY+YGL+LEGA WD+RN +LI++KPK+L++ +PVI ++A     +    +D ++Y SPIYKKP RT+L YIA  +L  S   E+WI+RGVA+LCD+K
Sbjct:  868 AKELLSHFNHRNVDALLRLTRNTLETLRKRIHASSLIRQK---GSGPQPIFRAGVCLAIPNIIMVPGLDEVQHALNRAVDYVVSVSKGVGQWSKERISKRKMSERRMAALKQNSQESESEDA----DSTYHSSTSDISA----------------------------------SANQAIPFQIKNYHKSISENKEIVKLVSVLSTSINSTKKEIMNALERFSIYHHIWKKDREETIQKFIQGNPFLSEFESQILYYRDLELEINAEPEFISVGALALYTVDLKLALTAETKSWMVDFGQYCNRKYRMEMEQIFTFIDEASKKLNRQIKDLDDIRIAMATLKEIREHQISIDFQVGPIEESYSMLHKYGLLIAKEEAEKVDTLRYTWEKLLSRSTEVQNELVSLQPKFRGELIKNVETFVEDCQHFYHDYDRVSP--EGQLHFQAQTQLF----SCIYIPLGYITFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNSVIDTVNGYYDISWADIHIDRINNELLDFQARCRKLPRGLKEWQAFMDLKKTIDEFSECCPLLDLMTNKAMMTRHWKRITEVTGHTFEVETDNFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIITNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLEQLEMCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNIFDNIKCVRFHEKMYDKILAISSREGETIELDKPVIAEGNVEVWLNALLKESQRSLHLVIRQAALAIQDSGFELIEFLDSFPAQVGLLGIQMIWTKDSEDALSNARYDRKIMSKTNQFFLELLNNLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIKSPTDFEWLKQCRFYFNEDSDKMMINITDVGFVYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRKNFIFTDGDNVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPNDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPDLESAIDKQVTEAGLINHPPWRLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIENASPATVSRNGMVFMSSSVLNWSPILEGWLKNRSAQEGMVLKDLFSSSFPELYRFSIQSLQYKMEMLEAFIIMQCINMLQGLIQPKEQ--GGELSREHMERLYVFALMWSVGALLELDDRMKLERWLRNHDSIHLDLPNIPPHSEDTMFDFYVTNDGHWVHWNTRVEEYIYPPDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYMSKYDPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQNGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDVPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSHRGFSEEVRNTVGRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLGVTAEVISTPQLLLQLWKHECKRVIADRFTAPEDVAWFDSTLAKLVEEQLGEEEREVVDL-GVDSYFVDFLRDAPEATGDEPEETDFDMPKVYEPIESFDSLMERLNMFLSHFNESIRGASMDMVFFRDAMIHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNTANLMEDLKGLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEIISDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSPVGERFRNRALKFPALISGCTMDWFSRWPKDALIAVSEHFLSTYDIDCTLEVKSEVVQCMGSFQDGVAEKCADYFQRYRRSTHVTPKSYLSFIHDYKTIYKEKHSEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANAKADMVLKEVTVKAQAAEKVKVEVQKVKDKAQAIVDSISADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNTVKTDPEKNCTMPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVEFLSPYFDMVDYNIETAKRVCGNVAGLCSWTKAMAAFFSINKEVLPLKANLAVQENRLTIANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDAERCRHKMQTASSLISGLAGEKERWTQLSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLTDWQREMKFRQIPFRTNLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIKNKESKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGFTYKVKIGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKERTDLLEDVTANKRKMKELEDNLLFRLTSTQGSLVDDESLITVLGNTKRTAEEVTQKLQIAAETEIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLTKSSKSPITSKRIANIIEYMTFEVHKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPPKAAKWILDITWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDREAPEEEPIPNAYDQALDCFRRLLLIRSWCPDRTIAQARKYITQSMGERYAEGVILDLEKTWEESEPRTPLICFLSMGSDPTDSIIALGKRQRIETRYVSMGQGQEVHARKLLQHSMANGGWALLQNCHLGLDFMDELMDTITETDSVHDTFRLWMTTEVHKHFPITLLQMSIKFTNEPPQGLKAGLKRTYGGISQDLLDVSNMVQWRPMLYGVAFLHSTVQERRKYGPLGWNIPYEFNQADFNATIQFVQNHLDDIDIKK-----GVSWNTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFSPDFHFYKGYSIPKCSNVDQYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSTGGGETREAIVGRLADDMLEKLPPDFVPFEVRERLMSMGPLQPMNIFLRQEIDRMQRVIVLVRNTLNDLKLAIDGTIIMSENLRDALDCMYDARIPARWKKASWASTTLGFWFTELLERNRQFHSWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPAEGVYVYGLYLEGAGWDRRNCKLIDSKPKVLFEMMPVIRMYA-----ENNGVKDARLYSSPIYKKPVRTDLNYIAAVDLRTSHPPEYWILRGVALLCDVK 4525          

HSP 2 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 416/869 (47.87%), Postives = 575/869 (66.17%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPEL-EKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            K+KEER AKR++LD RH Y+L  V+    LE +EVE++IL+G QIE M++FF+ D    L  ++Q+ E  E    +Q +         R+ K KVF+T+G +  L G CV F R++    I    I +DVNF +++ +  G+L+ +E+ +S + +P  R +  GWG+L   +    ++  ++SL++FV VLS A+ES+ E+V L+ C   DLK ++ P D   + N+ + L K+E C+  W+KQIEQVLAESDQ+R+EAD++GPRAELD+WKKRM++FNYLLDQLK PEVKA +G+L  AKSK +K W E+D RITDAANEAKDNVK+LYTLE+ C PLY +NP  M++ IP LI+++RMIHSIS+YYNTSEK+TSLFVK+         +Y SND+                                   RL            EMYIFGKFDTF RRLS I+ +F  I TY+ L D+ IEGLE+M  +F  IV T+KKK Y+FLDQRRT+F QD+++F +Q  ELHN +  FMD  FD I +T RA+  L++FERL IPDLGI +KY +IL ++GRD+E + + Y++ K DPP+A D+P  AGKI WARQL+ RIQ PM++F+ Q   LL TP+AK II+NYN++A+ L+ FE++YH +W+ Q  +   GL +SL+++ PET +L+VNFDP IL   RETD M+ + L+IPP A  L+ K+   K+ +NKL L      +V  S    +EQL++  +AK+   I PGLT+ NWTS+ + +Y+  +   L  LELLL R  DL ++RID VL+EMST  LC LP D P T +EFV  T+ELCIK A++L +KS  VE++ NELINML
Sbjct:   13 KLKEEREAKRAQLDSRHDYVLSIVSSCVGLEKSEVEDAILEGTQIERMEQFFAVDGLPHLILYYQDTEATEAGYNNQTQC------PHRIKKAKVFVTEGTDVALTGICVFFTRANTSKPITSENIHRDVNFNMLDTTGVGLLKSVEQLLSEIFIPTLRKMNYGWGELASPQAQAVKQDFISSLDSFVSVLSGAQESLQEKVNLQECETFDLKTLKGPSDYTAVANSADALEKIEACMKTWIKQIEQVLAESDQLRKEADDLGPRAELDHWKKRMSRFNYLLDQLKSPEVKAVLGVLLVAKSKLIKVWRELDIRITDAANEAKDNVKYLYTLEKFCDPLYNSNPVSMVEAIPGLINAIRMIHSISRYYNTSEKITSLFVKVR-------VSYKSNDH-----------------------------------RL------------EMYIFGKFDTFQRRLSKILNLFSTITTYNALQDSKIEGLETMATRFQAIVLTMKKKQYSFLDQRRTDFDQDYEEFCKQTSELHNQLKTFMDNTFDKIQNTERALYVLKKFERLGIPDLGISDKYQRILQNFGRDIEMISRIYNKQKTDPPIAPDLPPTAGKILWARQLYSRIQEPMDLFQ-QLPGLLSTPDAKPIIRNYNRVAKVLLEFEVLYHHSWMAQTEAVKAGLQASLLVKSPETGQLFVNFDPQILTQIRETDCMLGMGLDIPPFAAILQQKKEVFKKNYNKLQL--KRFDRV--SWKPAFEQLLMPHVAKVDEAILPGLTSLNWTSLNIDKYLCRITAALDNLELLLHRVNDLVEFRIDAVLQEMSTATLCVLPEDEPCTCEEFVQTTKELCIKGAQMLHTKSSLVEEAANELINML 816          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 4615.06 bits (11969), Expect = 0.000e+0
Identity = 2278/3713 (61.35%), Postives = 2849/3713 (76.73%), Query Frame = 3
Query: 2994 HRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSA--KPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPKE---GVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
             RN EA+V   +++L +L +R+ A +      S   +    P FR +  L IPNIV  P+ E +Q  +N+   M++S++K I  W+       QL AE + + E           DE V++                       KP                          +++  ++V E+K+V K  S L   ++S + +    +   S +S LW +     ++ FL+ +P +++F   +  Y   E QI+   Q    GPI   TE LK+ L+ E   W+  +G A N +  A M +I +F + + ++L R I DLDD+R +MGAL+E+RE EIRI+  + P+EES+A+L R++L       ER+D + Y W++L     + Q  L  ++P  ++ LI  V++F+K  + FY DYDNSGP V GLPPREASDRL ++Q ++D L R+++T+S GEELFGL V +Y  L  IK+ELNLL KLYSLYN VI+SV+GYYDILW D++IEKI+NEL +FQNR RKLP  LK+W AF DL+KTIDDFN   PLL +M N AM  RHW+R++DLT H F+VE+  F+LRN++EAPLLK KE+IED+CISAVKE+DIEAKLK V  EWS H+  F TF+NRGELLL+G  TSE +++MEDSLM+L SL+SNRYN PFK  IQ  V KLSNSSE+IE+W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW +IM RAHE   V+QCCVGDETL QLLPHLLEQLE+CQKSL+GYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL++FDN+  V FHEK Y+ IL+  S EGE + + +P+ A+ NVE WL  LL+  +++LH +IR A   I D  F ++EF +M+PAQVGLLGIQ +WTRD+ EAL  +K+D+KIMQ TN++FL LLN LI  TT DL K+ERTK+ETLITIHVHQKDIFD LV+  ++SP DF+W KQ+RFYF++D DRCI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQL+   GFY+LE+PG+FT +VD+Q +AAMIHPGGGRNDIPQRLKRQFC+FNCTLPSNSSIDKIF  + +G++C ERGF +EV  L   L+P TR++W   K KMLP+PAKFHY+FNLRDLSRIWQG++    +V    + L  L++HEC RVI+DRF+  +D   F   L+R  ++D    ++ Q        +F+DF+RDA E TGEEP+D + + PKVYEPI +F  L +RL MF+  YNE++RGA MD+VFF DAM HL+KISRIIRT RGNALLVGVGGSGKQ+LT+LAS+IAGY+ FQITLTR+YN+SNL+EDLK LYR AG +GKG+TF+FTD +IKDE FLEYMNNVL+SG VSNLFARDE+DEI Q LIP MKK+ PR PPT DNL  YFLSR + NLHV LCFSP+GEK R+RALKFPGLISGCT+DWFQRWP+DAL+AVA H+LS++ + C+  VK+ ++ +MG   D VAE C +YFQRFRRQT+VTPKSYL+F+ GY+ IY EK ++   LA+RM++GL++L+EA+ SV EL+  L EKEK L +A ++A EVL  VT +  AA +VK +VQ VKDKAQ+IV+EIE DKK+AESKLEAA+PAL  +E AL TIKPADIATVRKLG+PPHLIMRIMDCVL+ FQRR+D +  DPER   KPSWGE++KLM+N+ FL+ L+NF KDTI EE VEL+SPYL MEDY ++ A+R CGNVAGL SWT AM+ FF INKEVLPLK NL  Q+ R   + ++L+ AQ  LD KQKEL   QA+YD A+++KQ LLDDAE C++KM+ A  LI+GL GEK+RWT  S++F+ QI  +VGDVL AT FLSY GPFNQE+R +L   W+KE+ +R IP+S +LN+I+ML D   +GEW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQGQGKIWIKNRE   +LQVTSLNHKYFR HLED LS G+PLL+ED+GEELDP LDN+LEKNFIK G T KVKVGDKEVDVM+ F LYITTKL NP+Y+PEI A+T ++DFTVTMKGLEDQLLG VI  EK+E+EA+R++L+E+V  NK+KM+ELE NLL+RLTS +GSLV+DE LI+VLK TK T+ EVSQKL +A++TEI IN AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD+SM +S KS VT KR++NI+E +T+EV++Y  RGLYE  K  FTLL+ALK+D++   I   E  TFIKGGASLD+N V+ KPK WI D TWLNLV+LS+LH F+ +L QV RN++ W+ WFD+  PEE  +PDGY + LD FR+LLL+R WCPDRT++QA+KYI +S+G K+AEG ILD + +  E+  R P+V  LSMGSDPT  I+ LAK   + CR ISMGQGQE+H+RRL+A  +  GGW+LLQNCHL +D+++E  + +  + N++  +RLW+T++ H +FPINFLQ +IKFTNEPP+G++A L+R++  +TQ+ L+   +  W+ +FY++AFLH TVQERRKFGPLGWNIPYEFNQADF +   F+QNHLD I  K+     G++W C+RYM+ E+QYGGRVTDD D RLL    + +F E MF   F       I     + +Y  +I  LP  D P  FGLH NADI+Y T      L TIL+IQPKDS  GEGETRES V K   EML+K+P++++P +V   + KMGAFQPM IFLRQE+DR+ +VI  VR TLTDLKLAIDG ++M++ LRDALD ++DA++P  W+KISWE+ +LGFWF EL++RN QF  W  +GRP+ FW+TGFFNPQGFLTAMRQE TR +   GWA D+VIL N VTR   E++  PP     GVYIYGL+L+GA WDKRN +L E+ PK+L++ LPV++++A+   T+ K+     +Y  P+YKKPRRT+LTYI +  L  S++ +HW +RGVA+LCD K
Sbjct:  801 QRNTEALVTATKSSLNALHRRLLAASSSYRSSSPSGATIQVPLFRVSVELAIPNIVFRPSFEHIQGILNKGVNMVLSMAKDIPLWNYFHLQQDQLQAEQVAAREHG---------DETVVS-----------------------KP------------------------ILLRSLDRHVTEHKDVNKSLSQLVPLVSSLKADAGDILEDLSQFSALWNQDPAEQVKAFLQTNPILADFSTQLSLYSAYETQIHELPQTCTVGPILFETESLKMSLIQECHTWKREFGAALNQQASAGMTEISSFVDGVNRQLQRPISDLDDVRESMGALRELREEEIRIETIMGPVEESFALLNRHDLFFNDGNAERIDGVVYAWKELKVMAKETQKKLSDVEPHMKAELIAGVEVFQKSVESFYGDYDNSGPGVTGLPPREASDRLQVYQAKFDELWRKYVTFSSGEELFGLPVGEYPDLHRIKRELNLLSKLYSLYNSVIDSVSGYYDILWADLNIEKINNELLDFQNRIRKLPAALKEWQAFNDLKKTIDDFNETCPLLYMMANKAMMARHWERITDLTKHKFEVEAPNFSLRNVMEAPLLKCKEDIEDVCISAVKERDIEAKLKDVVTEWSGHQFTFATFRNRGELLLKGSDTSEKVALMEDSLMVLGSLMSNRYNAPFKPTIQQWVQKLSNSSEVIEKWLTVQNLWLYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQRIMQRAHEIPGVVQCCVGDETLQQLLPHLLEQLEVCQKSLSGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNLFDNVNRVVFHEKNYDQILSFQSQEGETVNMSEPINAQGNVEAWLGMLLDGVKKTLHSIIRQAAMVIGDQGFKLVEFQSMFPAQVGLLGIQFIWTRDAEEALQQSKADKKIMQTTNQKFLDLLNELIDMTTHDLTKMERTKYETLITIHVHQKDIFDDLVQMNIRSPLDFEWQKQSRFYFIDDTDRCIIQITDVEFDYCNEYLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQG---PWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKR-----GVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTESKKPA-MNLYSCPVYKKPRRTDLTYIFSLFLRSSQNPDHWTLRGVALLCDCK 4442          

HSP 2 Score: 544.658 bits (1402), Expect = 2.873e-154
Identity = 303/758 (39.97%), Postives = 461/758 (60.82%), Query Frame = 3
Query:  501 CVVFMRSSQGTQINENTIAKDVNFIVINGS-NGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDE--DSRRAMMNSLENFVLVLSNARESINERVALK-VCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNEL 2762
            C+ F+R +    I    I+++VNF +++ S + +L  LE  +++VM    ++ +  WG ++  +     +  + S++ F   LS+   ++ E+  L  + +  DL  I+ P D     NN+E +  +E  +  W KQIEQVL ES++IRRE+D+IGP AEL +WK+RM  F  L+D++K P VK  IGIL AAKSKT+  W E+D  IT  ANEAKDNVK+L TL++    L ++ P  M+ +IPKL++S+ MIH +SQ+YNTSE MTSLFVK+TNQM+T+ KAY+    T+ VW L+ +EL+KR+ +C ELN+ YQ CF++ K ++   PHERQ ELSE YIFGKFDTFC+RL  I  +   ++ +SVL     EG+E + +++  IVSTIK K YN LD R+ EF  D+ +F  QIQ L+ ++   +D       +T + ++ L RFE      + + +KYM +L  Y  D+E V K Y + K D PV++  PL AGKI W++ LF++I+ PM++ +    ++L+ P+ + II++YN+LA  L+ +E+I+ +AWV  +    +GLN+SL+ RHP TKE YVN DP +L + +E + M KL   +P    ++  K+  LKE+  KL +M+     V   IP   +  M   +  +   + PGLT  +WTS+ +  +I  VY  L ELE +L    D+   RI+  LE M +  L  LP + PVT + F+ +T        + L+  SQ VE S+ E+
Sbjct:    1 CLFFLRITDKA-ITTTNISQEVNFGMLDCSESSILHNLEFLLTQVMNQALKS-QEDWGAIKDGQMNPDVQNFLRSVDKFTFTLSSVMRNMEEKFKLHHIPSAPDLSHIQKPEDYSYAANNSELVEDLEAVLVYWAKQIEQVLTESERIRRESDDIGPSAELAHWKRRMITFCSLMDEIKDPYVKKIIGILHAAKSKTMSKWKELDASITIVANEAKDNVKYLSTLDKFFELLEKSTPTSMLKHIPKLMNSIHMIHRVSQFYNTSEHMTSLFVKVTNQMVTTSKAYLCQGVTK-VWELDRKELLKRMKECIELNQEYQQCFRQMKEKIQQNPHERQLELSENYIFGKFDTFCKRLEKITDMATTLEDFSVLQFMKFEGVEKIYMRYQNIVSTIKSKTYNVLDHRKLEFDNDYIEFRNQIQVLYQSVDALIDTWLQRPLTTEQVLELLSRFENGVGRQMDLNQKYMVVLQRYECDLEFVRKCYQKEK-DNPVSQLTPL-AGKIEWSKHLFKKIELPMQILK-DKLDILQMPDRRKIIRSYNRLAAVLLEYEMIHQKAWVEGVELGLSGLNASLLTRHPTTKEFYVNLDPLVLEVLQEANNMYKLGALVPDGIHDMAAKEPQLKEYRYKLQMMLKEFHAVVKKIPGVLKSPMKPFIRSVETALSPGLTILSWTSLNIDYFIGCVYKALQELEQVLKVVTDILDCRINHTLESMCSTTLLTLPENEPVTPEMFLTHTAATISTERETLKVASQQVERSMLEI 752          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 3602.76 bits (9341), Expect = 0.000e+0
Identity = 1742/2682 (64.95%), Postives = 2144/2682 (79.94%), Query Frame = 3
Query: 6081 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPKE---GVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQL+   GFY+LE+PG+FT +VD+Q +AAMIHPGGGRNDIPQRLKRQFC+FNCTLPSNSSIDKIF  + +G++C ERGF +EV  L   L+P TR++W   K KMLP+PAKFHY+FNLRDLSRIWQG++    +V    + L  L++HEC RVI+DRF+  +D   F   L+R  ++D    ++ Q        +F+DF+RDA E TGEEP+D + + PKVYEPI +F  L +RL MF+  YNE++RGA MD+VFF DAM HL+KISRIIRT RGNALLVGVGGSGKQ+LT+LAS+IAGY+ FQITLTR+YN+SNL+EDLK LYR AG +GKG+TF+FTD +IKDE FLEYMNNVL+SG VSNLFARDE+DEI Q LIP MKK+ PR PPT DNL  YFLSR + NLHV LCFSP+GEK R+RALKFPGLISGCT+DWFQRWP+DAL+AVA H+LS++ + C+  VK+ ++ +MG   D VAE C +YFQRFRRQT+VTPKSYL+F+ GY+ IY EK ++   LA+RM++GL++L+EA+ SV EL+  L EKEK L +A ++A EVL  VT +  AA +VK +VQ VKDKAQ+IV+EIE DKK+AESKLEAA+PAL  +E AL TIKPADIATVRKLG+PPHLIMRIMDCVL+ FQRR+D +  DPER   KPSWGE++KLM+N+ FL+ L+NF KDTI EE VEL+SPYL MEDY ++ A+R CGNVAGL SWT AM+ FF INKEVLPLK NL  Q+ R   + ++L+ AQ  LD KQKEL   QA+YD A+++KQ LLDDAE C++KM+ A  LI+GL GEK+RWT  S++F+ QI  +VGDVL AT FLSY GPFNQE+R +L   W+KE+ +R IP+S +LN+I+ML D   +GEW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQGQGKIWIKNRE   +LQVTSLNHKYFR HLED LS G+PLL+ED+GEELDP LDN+LEKNFIK G T KVKVGDKEVDVM+ F LYITTKL NP+Y+PEI A+T ++DFTVTMKGLEDQLLG VI  EK+E+EA+R++L+E+V  NK+KM+ELE NLL+RLTS +GSLV+DE LI+VLK TK T+ EVSQKL +A++TEI IN AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD+SM +S KS VT KR++NI+E +T+EV++Y  RGLYE  K  FTLL+ALK+D++   I   E  TFIKGGASLD+N V+ KPK WI D TWLNLV+LS+LH F+ +L QV RN++ W+ WFD+  PEE  +PDGY + LD FR+LLL+R WCPDRT++QA+KYI +S+G K+AEG ILD + +  E+  R P+V  LSMGSDPT  I+ LAK   + CR ISMGQGQE+H+RRL+A  +  GGW+LLQNCHL +D+++E  + +  + N++  +RLW+T++ H +FPINFLQ +IKFTNEPP+G++A L+R++  +TQ+ L+   +  W+ +FY++AFLH TVQERRKFGPLGWNIPYEFNQADF +   F+QNHLD I  K+     G++W C+RYM+ E+QYGGRVTDD D RLL    + +F E MF   F       I     + +Y  +I  LP  D P  FGLH NADI+Y T      L TIL+IQPKDS  GEGETRES V K   EML+K+P++++P +V   + KMGAFQPM IFLRQE+DR+ +VI  VR TLTDLKLAIDG ++M++ LRDALD ++DA++P  W+KISWE+ +LGFWF EL++RN QF  W  +GRP+ FW+TGFFNPQGFLTAMRQE TR +   GWA D+VIL N VTR   E++  PP     GVYIYGL+L+GA WDKRN +L E+ PK+L++ LPV++++A+   T+ K+     +Y  P+YKKPRRT+LTYI +  L  S++ +HW +RGVA+LCD K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQG---PWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKR-----GVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTESKKPA-MNLYSCPVYKKPRRTDLTYIFSLFLRSSQNPDHWTLRGVALLCDCK 2685          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 2040 bits (5284), Expect = 0.000e+0
Identity = 1224/3569 (34.30%), Postives = 1967/3569 (55.11%), Query Frame = 3
Query: 3516 YKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHEL----HFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILA--CYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFVVRQACDLLEGLIPRKDEK-DSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR--SNNNIKLDLPKIEKDSE-----DTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPE--YGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIIS-MGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQE---PMFQPDFFINPIQ---KIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMG-AFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTE-ELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN---LTYIANAELVCSKSAEHWIMRGVAMLC 14102
            Y ++ +  ++ +  + +S  I      +   +  + +Y  LW   K   +E+F    P    +D   + Y+ + +++  +        I L  E L   +    + W    GK  N   + E+  +      L + L R    L+D++  +  + +IR+  + ++M I   +E Y  L  Y +   ++E +    +   W  L     QV   L+ ++  F    +  ++ +K++   F E ++  GP   G    +    +  ++     +E R    +  E+LF L +T Y +L +++KE+  L+++Y ++     +   +   LW ++DI+ +   +  F    RKLPK  +  P    L   + +F   +PLL  + N A++ RHW+ + + T  +F++  + F L N+    L K+   I +I  SAVKE  IE  +K V+  W + +     +F   +  G +L   D   +I+  ++D  M L S+  + +  PF   +Q     LS  SE IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F NIDK++ KIM+   ++  + +CC+    L+ L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI  ++F       ++A    S EGE +EL++PV AE  VE W+  +L   +R+   + + A    +  +  V   L+ Y   V L   Q+ WT +  +      + +++ ++Q  ++    +N L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+V++ D   V      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+I  GL+Q G+WGCFDEFNRID  VLSV + QI  + +      ++F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E   I  P  V K++Q++ET   RH  M +GP+G GK+  I+ L ++ T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   K   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P      +  ++   + E L+  +++   +++  L    D   ++        E  ++ ++  S+GA L  + R K +A+I+  S+ N   D   +    E      T++D+       +WV W+S V +YI+     PE  +  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT  I  +LS+ N +  +  ++NFSS T     QRT+E+ V+KR   T+GPP G+++ VF+DD+NMP ++E+G Q    +++ LL+  G Y+  K  ++  I D+ F+AAM   GGGRN++  R    F +FN   P   S+  I+S I  GH    + F + +R +   L   T  L+      + PTP+KFHY+FNLRDLSR++ G+  T  +        + +W++EC RV  DR +   D       +K  + E    D+ S          F D+    K              P+VYE I  +D  K   +     YNE+     M++V F DA+ HL  I RIIR  RG+ALLVGVGGSGKQ+LTKLA++ AGY++F+I L+R Y+ +N  +DLK LY   G + K + FLFTD  + +EGFLE +NN+L+SG+V  LFA DE + +  +L     K      P+ +++ +YF++++  NLH+VL  SP+G+  R R   FPGL++  ++DWF  WP  AL AVA  +L    ++  P    E +I  + +VH  V +    + Q  RR  +VTPK+YL F+  Y ++ ++K  +     +R++ GL KL EA   +AEL   L E++  LA      E +L+ +      A E K   +    + +   + I  +KK AES L  A PAL  A  AL  +  +D+  +R   +PP  +  + +C+L+              R   + +W  +  +MS   FL +L+    D+IN   V+ +  YL   + +++  + +    +G+L +  A+M + E+ +++ P ++ + + +  + +S  +L   Q+ L   QKEL  +   Y+ A+ +KQ L ++AE   R++ AA +LI GLA E  RW     E K +  RL+GD L   AFLSY G F+ +FRN ++   WQ ++  R IP S    I ++LTD   +  W  +GLP DELSVQNGI+ T++SR+PL IDPQ Q   W+K +E +  L+++S N   F + LE ++  G P L +D+ E +DP +DNVLEKN         V +GDKEVD    F+LY+ TKL NP + P +F +  +I++TVT+KGLEDQLL +++  E++ELE QR +L+ +   NK+ +K+LED+LL  L ++ G+++D+ +LI+ L  TK  + EV +KL +A  T + I++ R+ YRP A RG++L+F++ EM+LV+ MYQ SL  FL +FDLS+S+S  +P+   R++NII+ +T  V+ Y   GL+E  K+ F+  M +K++   G+   +E   F KG  SL+ +  + K   W+ D  W +++ L  L  ++F  + D + +N ++W+ W+D +APE+   P  Y  NL  F++LLL+RC+  DR       Y+  ++GEK+ +  ++  + +F++S P +P+V +LS GS+P   +  LAK         + ++MGQGQE  + +L+   +  G W++LQNCHL + ++ +L + ++  T  +  +RLW+T+E    FPI  LQ ++K   EPP G++ N++ ++  ++ D L +     ++ + Y LAF H  VQERRK+G +GWN+PY+FN++DF  C   +  +L   T  ++     I W  ++Y+I E+ YGGRV D FD R+L V T  Y  +     FQP  F +      KI        Y + I +LP  +    FGLH NA+I Y T+  + +   ++ +QP+    G G +R+  + +   ++  K+P     F +     K+G    P ++ L QE++R +K+   +  +L +L+ A+ G V M+  L +    +F+ +IP +W K++ ++  +LG W I    R+ Q+  W+N+G P   W++G   P+ +LTA+ Q   R  +GW  D   L  +VT++ +E +++E P +G ++ GL+LEGA WD  NG L+ +KP++L   LP++ I  ++ +  K Q        +P+Y    R N   +  +  A+L  +K   HW++ GV  LC
Sbjct: 1115 YSDICQLPQINEQATAVSQTIQRLLNGISVYLKSWMSYRSLWKLDKAIVMEKFAAKKPSCVMYDEKFQFYVKVSNEVAKQPMVKHEHIIRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFNLRNELLILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMYIVETTEEEMQLSANISILWNDLFMESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAVD---DILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLD-YQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHF-EGQEISLDNRIGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIH----NPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGH---TKPFEECIRNICDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDS---AMRDPILFGDYRTALKSE------------PRVYEDILDYDASKALFQEILEEYNEN--KTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGC--GPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGESPMI--PKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVI-------------RGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKS-KRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYL---TKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPE---VFDLDVIRKKLGLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYVMWLSGLHIPESYLTALVQATCRK-NGWPLDHSTLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQ----NTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVC-LC 4622          

HSP 2 Score: 166.392 bits (420), Expect = 8.275e-40
Identity = 149/688 (21.66%), Postives = 317/688 (46.08%), Query Frame = 3
Query:  696 RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQN-NPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKT---YQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKF-------NVIVSTIKKKNYNFLDQRR-TEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMK----ILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGL-NSSLII-------------RHPETKE--------LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP 2645
            R  +++S   F+ V+      +     L +  EIDL+      +    ++N+  + K+E CV  W  QI  V+ E  Q R++    GP AE+++W++R+A F+ L++QL L  VK  + ++  A S  ++   +    +    +E+  NV+FL T+E H   L    +  ++++ IP+LI+ +RMI  +S+ YNT E+M +L  +I  ++       +       V  L  E+ +    K  +  +    ++AC+ E + R+ N   + ++E +   +F K D        +  + + +  + ++    ++ +     +        N +V  I++  ++  D R+ T +     +F  ++Q +    + F+D  F  + S++ A   L +F+ +   D  I ++ MK    IL  Y +++  +   + + K++PP++++ P +AG I W R L  +++ PM+ F  + ++L+   E K +   + ++A  +  +E+  +  W    N T   L   SL++             RH    E          VNF P++  +  E   + ++ + +P    N+ +++     + N L  +V     + +++      LM  ++ +LR+++  G    NW ++ + ++I       ++ E L ++ Q   +  ID  L+ + +  L + P
Sbjct:  284 RDDLLHSTHKFLQVIDQTLRQLEGEFKLHM-PEIDLEG-----EVELFLSNSVMVDKLEQCVMNWHTQITIVIEE--QKRKKPQGPGPLAEIEFWRERVAVFSSLIEQLNLQAVKKILEVMTRADSFIMQELEKTTAELRKYYDESVSNVQFLTTVERHFRNLVTGVDFKVVLETIPELINGLRMIWILSRCYNTDERMEALMERIAWELSERVARVVD------VHVLFKEKRVVAKAKVQDGKRVLDIWKACYFEVRARIENSERDPRWEFNRRKLFEKTDYMASICQDLYSVLQTLDEFYIIFGPELKAVTGDPKRIDDVLHCVNSLVKPIEEVTFDPFDNRKMTSWKMVMQEFNNEVQVIEREAITFIDHSFKTLRSSSAAFDLLLKFKNIRCRD-AINDQLMKKFSDILAQYCKEMVLINDIFVKFKDNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFR-EDRDLMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTVCADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQK-NERDIDDKLKSIESANLFKFP 954          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 2040 bits (5284), Expect = 0.000e+0
Identity = 1224/3569 (34.30%), Postives = 1967/3569 (55.11%), Query Frame = 3
Query: 3516 YKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHEL----HFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILA--CYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFVVRQACDLLEGLIPRKDEK-DSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR--SNNNIKLDLPKIEKDSE-----DTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPE--YGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIIS-MGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQE---PMFQPDFFINPIQ---KIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMG-AFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTE-ELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN---LTYIANAELVCSKSAEHWIMRGVAMLC 14102
            Y ++ +  ++ +  + +S  I      +   +  + +Y  LW   K   +E+F    P    +D   + Y+ + +++  +        I L  E L   +    + W    GK  N   + E+  +      L + L R    L+D++  +  + +IR+  + ++M I   +E Y  L  Y +   ++E +    +   W  L     QV   L+ ++  F    +  ++ +K++   F E ++  GP   G    +    +  ++     +E R    +  E+LF L +T Y +L +++KE+  L+++Y ++     +   +   LW ++DI+ +   +  F    RKLPK  +  P    L   + +F   +PLL  + N A++ RHW+ + + T  +F++  + F L N+    L K+   I +I  SAVKE  IE  +K V+  W + +     +F   +  G +L   D   +I+  ++D  M L S+  + +  PF   +Q     LS  SE IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F NIDK++ KIM+   ++  + +CC+    L+ L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI  ++F       ++A    S EGE +EL++PV AE  VE W+  +L   +R+   + + A    +  +  V   L+ Y   V L   Q+ WT +  +      + +++ ++Q  ++    +N L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+V++ D   V      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+I  GL+Q G+WGCFDEFNRID  VLSV + QI  + +      ++F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E   I  P  V K++Q++ET   RH  M +GP+G GK+  I+ L ++ T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   K   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P      +  ++   + E L+  +++   +++  L    D   ++        E  ++ ++  S+GA L  + R K +A+I+  S+ N   D   +    E      T++D+       +WV W+S V +YI+     PE  +  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT  I  +LS+ N +  +  ++NFSS T     QRT+E+ V+KR   T+GPP G+++ VF+DD+NMP ++E+G Q    +++ LL+  G Y+  K  ++  I D+ F+AAM   GGGRN++  R    F +FN   P   S+  I+S I  GH    + F + +R +   L   T  L+      + PTP+KFHY+FNLRDLSR++ G+  T  +        + +W++EC RV  DR +   D       +K  + E    D+ S          F D+    K              P+VYE I  +D  K   +     YNE+     M++V F DA+ HL  I RIIR  RG+ALLVGVGGSGKQ+LTKLA++ AGY++F+I L+R Y+ +N  +DLK LY   G + K + FLFTD  + +EGFLE +NN+L+SG+V  LFA DE + +  +L     K      P+ +++ +YF++++  NLH+VL  SP+G+  R R   FPGL++  ++DWF  WP  AL AVA  +L    ++  P    E +I  + +VH  V +    + Q  RR  +VTPK+YL F+  Y ++ ++K  +     +R++ GL KL EA   +AEL   L E++  LA      E +L+ +      A E K   +    + +   + I  +KK AES L  A PAL  A  AL  +  +D+  +R   +PP  +  + +C+L+              R   + +W  +  +MS   FL +L+    D+IN   V+ +  YL   + +++  + +    +G+L +  A+M + E+ +++ P ++ + + +  + +S  +L   Q+ L   QKEL  +   Y+ A+ +KQ L ++AE   R++ AA +LI GLA E  RW     E K +  RL+GD L   AFLSY G F+ +FRN ++   WQ ++  R IP S    I ++LTD   +  W  +GLP DELSVQNGI+ T++SR+PL IDPQ Q   W+K +E +  L+++S N   F + LE ++  G P L +D+ E +DP +DNVLEKN         V +GDKEVD    F+LY+ TKL NP + P +F +  +I++TVT+KGLEDQLL +++  E++ELE QR +L+ +   NK+ +K+LED+LL  L ++ G+++D+ +LI+ L  TK  + EV +KL +A  T + I++ R+ YRP A RG++L+F++ EM+LV+ MYQ SL  FL +FDLS+S+S  +P+   R++NII+ +T  V+ Y   GL+E  K+ F+  M +K++   G+   +E   F KG  SL+ +  + K   W+ D  W +++ L  L  ++F  + D + +N ++W+ W+D +APE+   P  Y  NL  F++LLL+RC+  DR       Y+  ++GEK+ +  ++  + +F++S P +P+V +LS GS+P   +  LAK         + ++MGQGQE  + +L+   +  G W++LQNCHL + ++ +L + ++  T  +  +RLW+T+E    FPI  LQ ++K   EPP G++ N++ ++  ++ D L +     ++ + Y LAF H  VQERRK+G +GWN+PY+FN++DF  C   +  +L   T  ++     I W  ++Y+I E+ YGGRV D FD R+L V T  Y  +     FQP  F +      KI        Y + I +LP  +    FGLH NA+I Y T+  + +   ++ +QP+    G G +R+  + +   ++  K+P     F +     K+G    P ++ L QE++R +K+   +  +L +L+ A+ G V M+  L +    +F+ +IP +W K++ ++  +LG W I    R+ Q+  W+N+G P   W++G   P+ +LTA+ Q   R  +GW  D   L  +VT++ +E +++E P +G ++ GL+LEGA WD  NG L+ +KP++L   LP++ I  ++ +  K Q        +P+Y    R N   +  +  A+L  +K   HW++ GV  LC
Sbjct: 1115 YSDICQLPQINEQATAVSQTIQRLLNGISVYLKSWMSYRSLWKLDKAIVMEKFAAKKPSCVMYDEKFQFYVKVSNEVAKQPMVKHEHIIRLNLEPLARAVQENIQVWVTSLGKLLNDSAREELFNLRNELLILSENLKRSPNTLEDLKFVLVTITDIRDMSLSVEMRINDAQERYRTLSMYIVETTEEEMQLSANISILWNDLFMESRQVDRSLVKVKKTFAEITLNQIEEYKQELFIFAESFNMHGPGAVGDDLEKGLQIMSTYETELVRVEARRQELAKAEKLFNLPITMYPELLNVQKEMRGLRQIYEIFKSQKEAKTEWSQTLWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAVD---DILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLD-YQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHF-EGQEISLDNRIGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIH----NPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGH---TKPFEECIRNICDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDS---AMRDPILFGDYRTALKSE------------PRVYEDILDYDASKALFQEILEEYNEN--KTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGC--GPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGESPMI--PKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVI-------------RGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKS-KRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYL---TKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPE---VFDLDVIRKKLGLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYVMWLSGLHIPESYLTALVQATCRK-NGWPLDHSTLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQ----NTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVC-LC 4622          

HSP 2 Score: 166.392 bits (420), Expect = 8.275e-40
Identity = 149/688 (21.66%), Postives = 317/688 (46.08%), Query Frame = 3
Query:  696 RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQN-NPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKT---YQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKF-------NVIVSTIKKKNYNFLDQRR-TEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMK----ILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGL-NSSLII-------------RHPETKE--------LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP 2645
            R  +++S   F+ V+      +     L +  EIDL+      +    ++N+  + K+E CV  W  QI  V+ E  Q R++    GP AE+++W++R+A F+ L++QL L  VK  + ++  A S  ++   +    +    +E+  NV+FL T+E H   L    +  ++++ IP+LI+ +RMI  +S+ YNT E+M +L  +I  ++       +       V  L  E+ +    K  +  +    ++AC+ E + R+ N   + ++E +   +F K D        +  + + +  + ++    ++ +     +        N +V  I++  ++  D R+ T +     +F  ++Q +    + F+D  F  + S++ A   L +F+ +   D  I ++ MK    IL  Y +++  +   + + K++PP++++ P +AG I W R L  +++ PM+ F  + ++L+   E K +   + ++A  +  +E+  +  W    N T   L   SL++             RH    E          VNF P++  +  E   + ++ + +P    N+ +++     + N L  +V     + +++      LM  ++ +LR+++  G    NW ++ + ++I       ++ E L ++ Q   +  ID  L+ + +  L + P
Sbjct:  284 RDDLLHSTHKFLQVIDQTLRQLEGEFKLHM-PEIDLEG-----EVELFLSNSVMVDKLEQCVMNWHTQITIVIEE--QKRKKPQGPGPLAEIEFWRERVAVFSSLIEQLNLQAVKKILEVMTRADSFIMQELEKTTAELRKYYDESVSNVQFLTTVERHFRNLVTGVDFKVVLETIPELINGLRMIWILSRCYNTDERMEALMERIAWELSERVARVVD------VHVLFKEKRVVAKAKVQDGKRVLDIWKACYFEVRARIENSERDPRWEFNRRKLFEKTDYMASICQDLYSVLQTLDEFYIIFGPELKAVTGDPKRIDDVLHCVNSLVKPIEEVTFDPFDNRKMTSWKMVMQEFNNEVQVIEREAITFIDHSFKTLRSSSAAFDLLLKFKNIRCRD-AINDQLMKKFSDILAQYCKEMVLINDIFVKFKDNPPLSKNHPPMAGAIIWQRFLLDQMRYPMKRFR-EDRDLMNNQEGKAVESKFIEVASRMRQYEVDLYNKWKADTNQTLPILMRKSLLVMVNSYGTVCADSTRHRTGSEKVLERDVRFSVNFPPELQEIISEAKCLDRIGIVLPDELQNVALQEEVFLRYINGLKKLVRRYHLLMDNLNDAEFLLMADQVQELRQVLSVGCKRINWNNLGIPQFIQRGNQAASKFESLENQIQK-NERDIDDKLKSIESANLFKFP 954          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021690.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 5156.27 bits (13374), Expect = 0.000e+0
Identity = 2535/3723 (68.09%), Postives = 3012/3723 (80.90%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY----DIS-VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAE---ALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+++     IS  K + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER + K +      A++ N  D D E  V+++         N+S   SIS                                + F +  KN +KNV+ENKE+ K+ S+LST INST+KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+N+  +VI +   L+ LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATGEEP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++  ++QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  952 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMISFLDGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKKNILERKITAMRGNSNDSDSE-DVIVE---------NISEVASIS-------------------------------TVAFVHN-KNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGEEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGGVSQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4617          

HSP 2 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 426/867 (49.13%), Postives = 615/867 (70.93%), Query Frame = 3
Query:  189 EERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIG-LTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGS-NGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            EE+ AKR++LD RH Y+L  VA   +LE +EVE++IL+GNQIE +D+FF+      + F++Q+ E   E G     G +T    +R  KPKVF+T+GK+  L G C+ F+RSS    +    + ++V+F +++ S N +L  +E  +S + +P  + +  GWG+L   ++  + ++  + SLE FV VLS A++S+ ++V LK C   DL+ ++ P D + + N++E L ++E  + +W+KQIEQVLAES+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH  +  FMD  F+   +T R+I  L +FERL IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+  + L  M+   +++ + +    EQL+   +AK+   I+PGL + NWTS+ +++Y+ ++    A+LELLLDR  DL  +RID VL++MS   LC+LP + PV+ ++F+  T++LC K A  LQ+KS  VE++ NELINML
Sbjct:   18 EEKEAKRAQLDGRHDYVLGIVAACLNLEKSEVEDAILEGNQIERIDRFFAVGGLRHIMFYYQDVE-AAEAGHLGSFGAVTSTLVARNKKPKVFLTEGKDVALTGVCIFFIRSSSTKPVTMENVHREVHFNMLDTSGNSLLGSVESLLSDIYIPALKTMDNGWGELVDPQQAGNVKQDFLGSLEGFVGVLSGAQQSLMDKVNLKKCETYDLRTLKGPCDYLTVANSSEGLERIEEGMKVWIKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHTQLKTFMDSTFERNYNTERSIIMLEKFERLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQMEVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDNLQFMLMEDKRIKSKVHAPLEQLIAPHIAKIDEAIQPGLLSLNWTSLNIEKYLKNIAEKHADLELLLDRVNDLVVFRIDAVLQDMSITPLCKLPEEEPVSCEQFLQMTKDLCAKGAVTLQAKSCMVEEAANELINML 882          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000035049.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 5114.67 bits (13266), Expect = 0.000e+0
Identity = 2524/3721 (67.83%), Postives = 2996/3721 (80.52%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKS--SAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINR-RQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATG--EEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQ-IDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+  +   K   + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER +   L    L S            +D N+       N+S   SIS                                + F +  KN +KNV+ENKE+ K+ S+LST INST+KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+N+  +VI +   L+ LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATG   EP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT Q+   K +    L GDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++    QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  552 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMINGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKLMLVVLLLGS------------LDMNIFYFCLLENISEVASIS-------------------------------TVAFVHN-KNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQNKLEKYRYFLCLSGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4212          

HSP 2 Score: 551.977 bits (1421), Expect = 2.179e-156
Identity = 276/507 (54.44%), Postives = 371/507 (73.18%), Query Frame = 3
Query:  918 ESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSL----RRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEY 2423
            +S+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH +IL            TT+ + S       F  L IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+ F N   L VN +  V N I  ++
Sbjct:   21 KSNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHVSIL------------TTKVVTSCFFLLILFHLLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDN---LQVNSLGIVFNLIKTKH 511          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021565.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 5045.33 bits (13086), Expect = 0.000e+0
Identity = 2468/3537 (69.78%), Postives = 2910/3537 (82.27%), Query Frame = 3
Query: 3507 KNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATG--EEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            KN +KNV+ENKE+ K+ S+LST INST+KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+N+  +VI +      LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATG   EP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++    QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  720 KNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTT----LWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4236          

HSP 2 Score: 562.762 bits (1449), Expect = 1.378e-159
Identity = 277/506 (54.74%), Postives = 374/506 (73.91%), Query Frame = 3
Query:  909 VLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEY 2423
            VLAES+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH +IL         + ++   +  L    +L IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+ F N   L VN +  V N I  ++
Sbjct:   69 VLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHVSILT------TKVVTSCFFLLILFHLYQLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDN---LQVNSLGIVFNLIKTKH 564          

HSP 3 Score: 107.457 bits (267), Expect = 6.712e-22
Identity = 50/98 (51.02%), Postives = 71/98 (72.45%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKS--SAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKER 3254
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+  +   K   + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER
Sbjct:  605 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMINGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKER 702          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021598.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4997.57 bits (12962), Expect = 0.000e+0
Identity = 2449/3509 (69.79%), Postives = 2882/3509 (82.13%), Query Frame = 3
Query: 3591 KEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATG--EEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+    D       L  LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATG   EP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++    QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  633 KEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMVPQPFD-------LFSLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4118          

HSP 2 Score: 577.015 bits (1486), Expect = 5.077e-164
Identity = 284/519 (54.72%), Postives = 384/519 (73.99%), Query Frame = 3
Query:  885 LWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEYEQLMV 2438
            +W+KQIEQVLAES+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH +IL         + ++   +  L    +L IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+ F N   L VN +  V N I  ++ Q  +
Sbjct:    3 VWIKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHVSILT------TKVVTSCFFLLILFHLYQLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDN---LQVNSLGIVFNLIKTKHCQATI 511          

HSP 3 Score: 109.768 bits (273), Expect = 1.571e-22
Identity = 52/106 (49.06%), Postives = 75/106 (70.75%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKS--SAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAA 3278
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+  +   K   + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER + + L A
Sbjct:  533 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMINGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKEVLTA 638          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 4698.27 bits (12185), Expect = 0.000e+0
Identity = 2312/3544 (65.24%), Postives = 2827/3544 (79.77%), Query Frame = 3
Query: 3504 MKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEF--DFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPKE---GVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTK-MYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            +K   K ++E+K+V KV   LST + S + E    +  F+ +S +W +V+      FL      S F   +I+     LE QI+    +   G +   T+ LK+ L+ E + W+  +G A N K   +M++I+ F ++L KRLSR + DLDD+R AM ALKEIR+ EIRIDM I PIEES ++LL+YEL  Q    ERVD L Y W+ L ++    Q+ LI +QPE +++L++ V+ F  D  +FY++Y+  GP V G+PPREASDRL + Q ++D L R+++T+SGGEELFGL VT+Y +L+ I++EL LLQKLY LYN VI ++NGYY+ILW D+DIEKI+ EL +FQNR RKLPK LK+W AF DL+K IDDF+   PLLE+M N AM  RHW+R+S LT H FDVES+ F+L+NI+EA LLK+KE+IEDICISAVKEKDIEAKLK+V +EWSAH   F  FK+RGELLL+G  TSE I++MEDSLMIL S++SNRYN PFK  IQ  V KLSN++EIIE W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  N++QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLS+FDN+  V FHEK Y+ IL   S EGE + L +PV A+ NVE+WL  LLN  +++LH +IR A+ +I+D+ F + +F  MYPAQ+GLLGIQ++WTRD+ EAL  AK+DRK+MQ TN++FL LLN LI  TT DL ++ERTK+ETLITIHVHQKDIFD LV+  +KS SDF+W KQ+RFYF+ED+D+CI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLK+ FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I HPPW+LKLIQL+ETQRVRHGMMTLGPSGAGKT CI++LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+LK WL    + +  I+   F  +       + + +  KM+ LE   ++QA DLL+        K + Q S+ H  RL+IF+VMWSIGALLE++DR K+E +++ +++  L+LP +  D   T+F++++ ENG+W HW+ KV EY+YPKDS PEY SILVPNVDNVRTDFLM+T+  Q KAVLLIGEQGTAKTVMI  Y S  +PEYH  KSLNFSSAT+P MFQR+IES++DKRMG+TYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQL+E KGFYNLEKPG+FT++VD+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSNSSIDKIF  +  G++C++RGF+  V +L   L+P TR++W  TK KMLPTPAKFHY+FNLRDLSRIWQG++    +V  +   L+ L+KHEC RVISDRF+  +D  WF  T+     ED  ++I++ +     +++F+DF+RDA EATG+EP+D D + PKVYEPI SF+QL DRL ++   YNE++RG+ MD+VFF DAM HL+KISRIIRTP+GNALLVGVGGSGKQ+LT+LASYIAGY+ FQITLTR+Y  +NL++DLK LYRTAGQ+G GITF+FTD EIKDE FLEYMNNVL+SG VSNLFARDE+DEI Q+LIP+MKKE+PRR PT +NL +YFLSR ++NLHVVLCFSP+GEKFR RALKFPGLISGCTMDWFQRWP+DAL+AVA H+LSS++I C   VK+ ++ +MG   D VAE CV+YF+R+RRQT+VTPKSYLSF+ GYK+IY EK ++  NL+ RM +GL KL+EA+ SV +L + LA KEK+LA+A+++A+EVL+ VT + +AA +VK +VQ VKDKAQ+IV+EI  DK  AE KLE A PAL+EAE AL TIKPADIATVRKLGRPPHLIMRIMDC L+ FQR++D +  DPER   KPSWGE++KLM+N+ FLN+L+ FPKD+I EE VEL+ PYL+MEDY ++ A++VCGNVAGL SWT+AM  FF INKEVLPLK NL  Q  +   + ++LN AQS LD KQ+EL  VQA+YD A+R+KQ LLDDAE CRRKM  A  LIEGL GEK+RWT  S  F+ QI RLVGDVL AT FLSY GPFNQE+RN+L   W+KE+ +RKIP S  LN+I ML D   +GEW+LQGLPND+LS+QNGIIVTKASR+PLLIDPQGQGKIWIKNRE   ELQVTSLNHKYFR HLED LSLGRPLLIED+GEELDPALDNVLEKNFIK GSTFKVKVGDKEVDVMKGF LYITTKL NP+YTPEI A+T++IDFTVTMKGLEDQLLG VI TEKQELEA+R++LME+V  NK+KM+ELEDNLLFRLTST+GSLVDDE LI+VL+ TK T+ EVS+KL +A++TE+KIN+AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD+SM RS KS +T KRI NIIE +T+EV+KY  RGLYE  K  FTLLMALK+D++A KI   EF T IKGGA+LD+N V+PKPK WI DMTWLNLV+LSNL  F+ +L QV+RNEK W+ WFD EAPEE  +PDGY+  LDTFRRLLL+R WCPDRT++QA+ YI +SLG K+AEGFILD + ++ ES  RTP+V  LSMGSDPT  IE L+K     CRAISMGQGQE+H+RRL+   +  GGW+LLQNCHL +D+++EL   +  +  V+  +R W+T+E H +FPIN LQ ++KFTNEPP+G++A L+R+++ ++Q+ LD   +  WK + Y +AFLH TVQERRKFGPLGWNIPYEFNQADF A   F+QNHLD +  K+     G++W C+RYM+ E+QYGGRVTDD D  LL    + +F E MF   F       I    T+DEY  YI  LP  D P  FGLH NADI+Y T      L TI++IQPKDS  G GETRES+V +   EML+K+P ++IP +V  ++ KMG  QPMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALD ++DA+IP +W KISWES+TLGFWF EL++RN QF  WL DGRP  FW+TGFFNPQGFLTAMRQE TR +   GWA DSVIL N VTR   E++  PP     GVYIYGLFL+GA WD+RN +L+E+ PK+L+ +LPV++++A+        ++    ++  P+YKKPRRT+LTYI +  L   +  +HW +RG+A+LCD K
Sbjct:  564 LKPLDKQISEHKDVTKVIIQLSTIVLSLKAEAANVLNSFTKFSGIWNQVR-----TFLCSSRTFSLFICCYILFHLQQLETQISELPAHCIVGSVDFTTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFIDNLSKRLSRPVLDLDDVRGAMDALKEIRDAEIRIDMMIGPIEESNSLLLKYELVFQDGNAERVDGLAYAWKNLNTQAVYTQNLLIKVQPEMKTDLLDGVEKFHIDAAEFYKNYELLGPGVEGIPPREASDRLQVFQAKFDELWRKYVTFSGGEELFGLPVTEYPELQRIRRELALLQKLYGLYNAVIENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAWLQTLPAFQHEILWNCFNMA-------NYRAVSPKMQILECMYIKQAIDLLQ------KSKQNKQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQ-DHSAPLELPTVSGDQ--TIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIA---VEDHGQEIMNNAL---KESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTRTYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKR-----GVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNPADLKKQQGYLHACPVYKKPRRTDLTYIFSLFLRSIEVPDHWTLRGIALLCDSK 4075          

HSP 2 Score: 319.701 bits (818), Expect = 5.424e-86
Identity = 190/549 (34.61%), Postives = 296/549 (53.92%), Query Frame = 3
Query:  708 MNSLENFVLVLSNARESINERVALKVCTEID-LKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALK 2351
            ++SL+ F+  LS+AR ++  ++ LK     + L+ +  P D +N   N+E + K+E  + +W+KQIEQVLAES+Q+R+EAD+IGP                                               D  +T+AANEAKDNVK+LYTL++   PL + +P     +   L++S+RMI+S SQYYNTSE MTSLF+K+TNQ +++CK+Y+S+   + +W L+ +EL++R+ +C  LN+ YQ  F + K +L   P+ERQFE SE YIFGK DTFC+RL  I  I   +++ + L    IEG+E + +++  IV+  K K+Y+ LD R+ E                   ++   G    + ST + I  L++FER+    L   EKYM +L  Y RD++ V K Y + KE                      R     +EM              K II++YNK+A  L+ FE++YH+ W +  +    GL++SL++RHP TKELYVN DP ++ +  ET  + K+  E+P   +++  + + +K
Sbjct:   13 LDSLDKFIGTLSSARHNLEGKIELKRVDSGNFLENMHNPSDFINAGGNSEIIEKLEAMLSIWIKQIEQVLAESEQMRKEADDIGPS----------------------------------------------DCNVTNAANEAKDNVKYLYTLDKFFGPLGKASPV----SSHILMNSIRMIYSTSQYYNTSEHMTSLFLKVTNQTVSTCKSYLSHGVIK-IWDLDRQELIRRIKECVFLNEQYQNSFHKVKEKLKETPNERQFEFSENYIFGKLDTFCKRLEKISDISNNLESLADLQTIKIEGVEKISIRYETIVTNTKSKSYDVLDHRKQE-------------------VSITMGLKIVLVSTEQMINLLKKFERIGKDHLDFGEKYMIVLQRYSRDLDMVRKLYQKQKE-----------------NPPTPRNTPPGLEM--------------KKIIRHYNKMASVLMEFELLYHRGWCKCADIAKNGLHASLLVRHPNTKELYVNLDPMVMEVLHETKYLQKMGFEVPDVILSMATRGDHIK 460          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 5849.24 bits (15173), Expect = 0.000e+0
Identity = 2910/4655 (62.51%), Postives = 3612/4655 (77.59%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY-DISVKSSAK----PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++KEE+ AKR+RLD RH YL   VA   DL   EVE+++L+GNQIE MD+ F+      L F++Q+ E   E G     G       ++ KPKVF+T+GK+  L G CV F+RS     I    I ++V+F  ++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV +LS A+ S+ E+V L+ C  I+LK ++ P D + + +N E + KVE C+ +W+KQ+EQ+LAE+ Q+R+EAD++GPRAEL++WK+R+++FNYLLDQLK P+VKAA+ +L AAKSK LK W + D RITDAANEAKDNVK+LYTLE+ C PLY ++P  MID IP LI++++M++SIS YYNTSEK+TSLFVK+TNQMI++CKA+I+N+ T T+W+   E +M+++    +L + YQ+CFQETK +L   P E+QF+ SEMYIFGKF+TF RRL+ I+ IF   KTYSVL D+ IEGLE M  K+  IV+ IKKK YNFLDQR  +F QD+++F ++I ELHN++  FMD  F+ I ST +A+ +L++FERLNIP+LGIEEKY  I  ++  D++ + K Y++ K DPP+AR+ P IAGKI WARQLF R++ PM++F+ QH  +L+T EAK +I++YN++A+ L+ FE++YH+AW++QI   H GL +SL+++ P T EL+VNFDP IL+L RET  M +L L + P A  L  K++  K+  + + +M++  ++V   +P   EQLM   +A++   ++PGL    WTS+ +  Y+++ +  + +LELLLDR  DL ++RI  +LEEMS++ LC+LP D P+T +EF+  T++LC+  A+LL  KS  VE++VNELINML   +   E          ++     S ++     +         + +       K+ +  + E A ELL HFNH+N +A++KV RNTLE++R+RI    M+ + D +  S AK    P FR +  L IPNI M P +E++Q T+N+    IISV KG+ QWS E  + +++    + + + +ED +    ++EN              + E L  +                       S NL    Q +N YKN+++NKE+ K+ S+LST I+ST+KEV T+M RF  Y+H+W K K+ T+  F+  +P + EF+  I  + +LE +INAE +Y   G IAL+T  LK+ L +ETKAW    G+ CN KY+AEME I T  E+ +K+LSR IKDLDDIRIAM ALKEIRE +I  D  + PIEESYA+L +Y L V K+E ++VDTLRY W+KL++R S VQ+ L  +QP FR  LI  V++F +DC +FY DYD +GPM  GL P+EAS RLII QN++DN+ R++ITY+GGEELFGL VT Y +L +IK++LNLLQK+YSLYN+VI +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD TSE+I+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS++S+DKIF +IG G+YC +RGF++EV+  +  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSRIWQGM+N   +VI +   LL LWKHEC RVI+DRF    D++WF K +   + E+  E+   ++ V +   DA+F+DF+RDA EATGE P++ D +MPK+YEPIAS + L++RL +F  LYNESIRG GMDMVFF DAM HL+KISR+IRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIK+E FLEYMNNVLSSG VSNLFARDE+DEI  +L PIMKKE+PRRPPTNDNL EYF+SR + NLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+LSS+ I C   +KKEL+  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK IY+EK     +LA RM++GL+KL EA ESVA L + LA KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKDKAQ+IV+ I +DK IAE KLEAA+PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  D ++    PSW ES+KLM+   FL NL  FPKDTINEE +E ++PY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF   LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E+Q ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GSTFKVKVGDKEVDVM GF+LYITTKLPNP+YTPEI ARTSIIDFTVT+KGLEDQLLG VI TEKQELE +R  L+EDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+ +TEI+INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++   +K EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+SRNEK WR WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GE +AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGWVLLQNCHL +D+++EL  V+ E+  V+  +RLW+T+E H QFPI  LQ++IKF NEPP+G+RA L+R++  ++QD LD  V   WK M Y++AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKDS  G  ETRE++V +   +ML+K+P ++ PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLA+DG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF EL++RN QF  W+++GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT+F  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI IFA     +     D ++Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERMDQLFAVGGLRHLMFYYQDVE-GAEAGHCGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITPENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIRQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIIELKSLKEPTDYLALASNPETVEKVECCMRVWIKQMEQILAENSQLRKEADDVGPRAELEHWKQRLSRFNYLLDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMIDAIPTLINAIKMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQGYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIEGLEDMATKYQDIVAAIKKKEYNFLDQREMDFDQDYEEFCKRINELHNDLQRFMDITFEKIPSTRQALSTLKKFERLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQ-QHPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRVNDLIEFRIHAILEEMSSMALCQLPQDDPLTCEEFLQMTKDLCVSGAQLLHFKSSLVEEAVNELINMLLDVDVPPEEAAENVCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEARELLSHFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSNDASKAKQNHLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHERKMAAVKNNEDSDSDAEVEEN-------------ELQETLEIA-----------------------SINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTFIAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE---KAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARDPRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDVK 4621          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5299.18 bits (13745), Expect = 0.000e+0
Identity = 2671/4663 (57.28%), Postives = 3445/4663 (73.88%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTM---VAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   +     + DI        F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5299.18 bits (13745), Expect = 0.000e+0
Identity = 2671/4663 (57.28%), Postives = 3445/4663 (73.88%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTM---VAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   +     + DI        F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 5299.18 bits (13745), Expect = 0.000e+0
Identity = 2671/4663 (57.28%), Postives = 3445/4663 (73.88%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTM---VAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   +     + DI        F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 2023.44 bits (5241), Expect = 0.000e+0
Identity = 1231/3593 (34.26%), Postives = 1960/3593 (54.55%), Query Frame = 3
Query: 3516 YKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDR-------LIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTD---CGEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE-RPI--MLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHY--ERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGE-WVHWNSKV-EEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSE--DLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKN-------KVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLN-HKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKP-KAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECR--AISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQ-DYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNT--------VDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPK-DSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLT----YIANAELVC-SKSAEHWIMRGVAMLCDI 14108
            Y  V  ++++ K+Q+ +S+ + +    ++  +  +  Y  +W   KD+ +  + + +P VS FD  I  Y  + + +  E    +   + L    LK  L+     W+  +           +  + ++ +D  +++S   + L+++ +++  +  ++ +   ++  I PI E + +L +YE+PV     E +++L   W          +  L   + +F++ LI     FKK      ED++  GP    +    A D+       L+  ++  +NL            +F +       L+ ++KEL+ LQ+++ +  D   S N +    +  +  E + +       R  +L K  KD  W   E  R  I+ F   +PL+  + NPA++ RHW ++ +     FD ES+ F L  I++  + +  E+I +I  SA KE  IE  L+ +   W + +L    +K++G   LRG  T E+   +ED+ + LS++ ++R+   F+KD+      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F  ++ +W  IM R +++ N L+       L  L+       +I QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK +K  +      ++E +   +S +GE ++   PV  E  VE WL  +    + +L  ++R    ++        +++  +  QV +   Q+ WT D T+ L+ AK  SD+KI++ +                    K+ R K   L+TI +H +D+ ++L K  +   S FDWL Q RFY+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +D++ +GR++ GL+QSG+WGCFDEFNRI++ VLSV AQQI  +LS       +F F +G  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF +  +LA+K YTLY L  +QL++Q HYDFGLR + S+LR  G+++R  P  +++  ++  +RDMN++KL   D PLF +++ DLFP I+L    Y +L   I ++I E  +   P  + K++QL+ET+  RH  M +G +G+ KT    +L  +LT     GEP+    RE  +NPKA++  +++G  D++TN+WTDGI S++ R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV N+  ASPATVSR GMVY     L W P ++ WL KR   E  P+  M E F N      + +   L+      E   +   C L   L   ++  + +      +  E  ++FS++WS+ A ++ + R K+++Y+R    I+   P     ++DT+++Y V+     W  +  K+ + + YP ++ P Y  I+VP VD VR ++L++T+ + +  VLL+G  GT KT +    L S          +N S+ T     Q  IES V+KR    Y P  G+ M  F+DD+NMP  + +G Q   E++R  ++  GF+         +I DM  MAAM  PGGGR  I  RL+ +F I N T P+ S I +IF   GT    K + F +EV+ +   +   T  ++     + LPTPAK HY+FNLRD+S+++QGM+    D      ++  LW HEC RV SDR V   D+  F+  L   L    DL+   +  ++       F DF+++                PKVYE +     LK  ++     YN S     M +V F +A+ H+ +I R+I  PRGN LLVG+GGSG+Q+L +LAS I  Y  FQI +T+ Y      +D+K LYR AG + +  +FLF D +I DE FLE +NN+LSSG V NL+  DE +EI   +I   + E  + P ++D+L  Y + R + NLH+VLC SP+G+ FRN   ++P L++  T++WF  WP++AL+ VA  Y+   ++     + +++      +H  VA+         RR  +VTP +YL  ++GYK +  EK     + A ++ +GL K+ E +E V  +   L + +K++A   ++ EE L  +  QK  A+E +        K+ + + K Q++ +  ++D + A        PAL EA  AL ++   DI  ++  GRPP  +  +M  V+I                  +P+W E+ + +    F+ +LINF KD I+++ ++ I  Y    D+  D+  RV      L  W RAM  +  + + V P +  +     + ++    L  AQ  L E  ++L  ++  YDE L +K+ L   +E    K+  A  L+ GLAGEK RW       +  +  LVGD L A AFLSY GPF   +R+ I+N  W +++R  ++P S    I + LT+PT + +W++QGLP+D  S +NGIIVT+ +R+ L+IDPQGQ   WIKN E  + L++  L  H Y R  LE ++  G P+L++++ E LDP L+ VL K+  + G    +++GDKEV+    F  Y+TTKL NP Y PE  A+T+I++F V  +GLE QLLG+V++ E+ ELE Q+  L+ ++   K+K+KELED +L  L    GSL+DD  L+  L+T+K+T+ EV+++L  +  TEI I+ ARE YRP A R S+L+F++ +M  ++ MYQ SL  ++GLF LS+ +S +S   + RI+ + +  TY V++Y  R L+E  K+ F+  M  K+   +GK+ ++E++ F++GG  LD       P  +W+ D  W N+ EL  L  F  +++   +  + W  W+   +PE+ ++P  +    +  +R+L+VR    DR       +I  +LG +F E  +L+   V E+S PR+P+V +LS G DPT  +  LA+   +  R  A+S+GQGQ   + RL+   +  G WV L NCHL + ++  L ++++  +  + +  +RLW++S  H  FPI+ LQ +IK T EPP+G++AN+ R +  +T+  +        +K + ++L F H  + ER+KF  LGWNI Y FN +DF      +  +LD        +     W  ++Y+I+ + YGG VTDD+D RLL      YF +      F+     ++ V +T        +  Y+ YIS LP+ D P +FG H NAD++      + + ET+LS+QP+    +  G++RE  V +   ++  KIP   I ++   K+  +    P+N+ L QEI R +K++  +  +LTDL+  I G++VM+  L +  +CIFDA +P +W K+      L  W  +L  R  QF  W +  R PV FW++GF  P GFLTA+ Q   R ++  + DS+     V+      L  PPK+GV++ GL+LEGA WD++N  L+EA+P  L   +P I+        + +++    MY  P Y  P R   T    ++   +L   S +++HWI RG A+L  +
Sbjct:  960 YVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNL-------GIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRG--TEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDI-QKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAV-GMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSILNKYSEAIRGNLT------KIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYF-EGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNELV---PVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLRE---IEGSFP-----NKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNA-PFY-KIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIF---GTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNK---RPPIFGDFLKE----------------PKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAE--QIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEA-------LPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMIL--------------RGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRV-LEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLD--------EYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFY-----RLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPE-MIDYEGTRKLLALDP-SPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNN-ISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHF----RPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSL 4454          

HSP 2 Score: 91.6633 bits (226), Expect = 3.041e-17
Identity = 73/279 (26.16%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  474 GKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKI 1310
            G     + Q V F+R +      EN   + V +  + G+   +  L   +S V +P    +   W      E  R   ++ L  F+  L++ R  +     L +  E       + +D   +V + E + ++E  +  W +QI++VL+  + +    +N+GP  E+++W  R    + +  QL    VK    IL  AKS  L  + ++ ++I D + +A+ N+ FL  L E    L    P  + + +PKLIS +R+I   S +YNT E++T+LF K+
Sbjct:  164 GMPVQTQNQIVYFIRQAPVPITPEN-FEETVQYGTVRGA--YIPALLRLLSGVYVPQIF-MNKSW-----PESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEA------VQMDPEVVVKDKELVQRLETSMIHWTRQIKEVLSAQESVE-TGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKV 426          

HSP 3 Score: 63.929 bits (154), Expect = 8.005e-9
Identity = 68/294 (23.13%), Postives = 116/294 (39.46%), Query Frame = 3
Query: 1641 FNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDV------EAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTG-LNSSLI-IRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWT 2498
            F+  + T++      LD + T + +D++ F   I++L     N +   F+ +      +  L  F RL        E  M+       D+      E  + +   NK+ P +   M   +G+  W R L RRI   M      H  L      +  I  Y ++A+ +        Q W   ++      L+ SL+ I   +   L VNFD  +LIL  E D   +L  E P   +N+  +   L+     L+L+     ++   +  + + L   R+  L + I PGL   NW 
Sbjct:  466 FHKNLQTLRAVRGGILDVKNTSWHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRL-----ATREAIMRTYEKKAVDLYMLFNSELALVNRELNKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAH-FLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDKDCIRRLDMSLLRISQEKVGMLDVNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWA 753          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q8TE73|DYH5_HUMAN (Dynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3)

HSP 1 Score: 5866.19 bits (15217), Expect = 0.000e+0
Identity = 2917/4663 (62.56%), Postives = 3615/4663 (77.53%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXX---XVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS-----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKE---RKTAKQLAAEALQSNE-KDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSED--IVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++K E+ AKR+ LD RH YL   VA   DL  TEVE++IL+GNQIE +D+ F+      L F++Q+ E E ETG    +G   +   ++ KPKVF+T+G +  L G CV F+R+     I  + I ++V+F +++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV VLS A+ES+ E+V L+ C  ++LK ++ P D + + NN E L K+E C+ +W+KQ EQVLAE++Q+ +EAD++GPRAEL++WKKR++KFNYLL+QLK P+VKA + +L AAKSK LKTW EMD RITDA NEAKDNVK+LYTLE+ C PLY ++P  M+D IP LI++++MI+SIS YYNTSEK+TSLFVK+TNQ+I++CKAYI+N+ T ++W    + + +++L   +L + YQ CF +TK +L   P+ +QF+ SEMYIFGKF+TF RRL+ II IF  +KTYSVL D++IEGLE M  K+  IV+TIKKK YNFLDQR+ +F QD+++F +Q  +LHN +  FMD  F  I +T +A++ L++FERLNIP+LGI++KY  IL +YG D++ + K Y++ K DPP+AR+ P IAGKI WARQLF RIQ PM++F+ QH  +L T EAK II++YN++A+ L+ FE+++H+AW+RQI   H GL +SL+++ P T EL+VNFDP ILIL RET+ M ++ LE+ P A +L  K++  K  F N  M++  Y Q+V + IP   EQL+V  +AK+   ++PGL    WTS+ ++ Y+++ +  + +LELLLDR  DL ++RID +LEEMS+  LC+LP + P+T +EF+  T++LC+  A++L  KS  VE++VNEL+NML   E   E +         V    E     ++       + ++  A+  +     + K+    + E A ELL HFNH+N++A++KV RNTLE++RKRI +   + +  S     +K ++ P FR +  L IPNIVM P +E+VQ T+N+    IISV KG+ QWS E   +K  ++    ALQSNE  D D E+G        N  Q  +  A                                 S NL    Q KN YKNV+ENKE+ K+ S+LST INST+KEV T+M  F  Y+H+W K K+  ++ F+   P +SEF+  I  +  LE +INAE +Y   G IAL+T  LK  L +ETKAW +  G+ CN KY++EME IF   E+  K+L+R IKDLDDIRIAM ALKEIRE +I ID  + PIEESYA+L RY L + ++E ++VDTL Y W+KL++R  +VQ+ L+++QP F+  LI  V++F +DC +FY DYD +GPM  GL P+EASDRLI+ QN++DN+ R++ITY+GGEELFGL  T Y +L +IKK+LNLLQK+Y+LYN VI +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD TSEII+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS +S+DKIF +IG GHYC +RGF++EVR  V  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSR+WQGM+NT  +VI     LL LWKHEC RVI+DRF    D++WF K L   + E+  E+  ++    +   D +F+DF+RDA EA GE  ++ D + PK+YEPI SF  LK+RL MF  LYNESIRGAGMDMVFF DAM HL+KISR+IRTP+GNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +L  +MKKE+PR  PTN+NL +YF+SR +QNLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+L+S++I C+  +KKE++  MG   DGVAE CVDYFQRFRR THVTPKSYLSF+ GYK IY EK      LA RM++GL+KL EA ESVA L + L  KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKD+AQ+IV+ I +DK IAE KLEAA+PAL EAE AL TI+P+DIATVR LGRPPHLIMRIMDCVL+ FQR++  +  D E++   PSW ES+KLM+   FL NL  FPKDTINEE +E +SPY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD+KQ EL  VQA Y++A+ +KQTLL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E++ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLE+NFIK GSTFKVKVGDKEVDV+ GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  LMEDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TE++INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++  ++K EEF T IKGGASLD+    PKP  WI D+TWLNLVELS L QFS VLDQ+SRNEK W+ WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GEK+AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL +D+++EL  +I E+  V+  +RLWMT+E H QFPI  LQ++IKF N+PP+G+RA L+R+++ ++QD LD      WK M Y++AFLH TVQERRKFG LGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  +RYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKD+  G  ETRE++V +   +ML+K+P +++PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLAIDG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF ELI+RN+QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT++  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI I+A     +     D + Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKGEKEAKRALLDARHNYLFAIVASCLDLNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVE-EAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATSHGWGELEGLQDAANIRQEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKEPTDYLTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLLEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASIWNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEFCKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADIDMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQ-QHPAVLSTAEAKPIIRSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGTGELFVNFDPQILILFRETECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEY-QRVKSKIPAAIEQLIVPHLAKVDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPLCQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLPIFRASVTLAIPNIVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVEMGE-------NELQDTLEIA---------------------------------SVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDCFKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTADLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAALKEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKLVSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPATQYPQLLEIKKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDCGI---DTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRDPRFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALLCDVK 4624          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q8VHE6|DYH5_MOUSE (Dynein heavy chain 5, axonemal OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2)

HSP 1 Score: 5849.24 bits (15173), Expect = 0.000e+0
Identity = 2910/4655 (62.51%), Postives = 3612/4655 (77.59%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY-DISVKSSAK----PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++KEE+ AKR+RLD RH YL   VA   DL   EVE+++L+GNQIE MD+ F+      L F++Q+ E   E G     G       ++ KPKVF+T+GK+  L G CV F+RS     I    I ++V+F  ++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV +LS A+ S+ E+V L+ C  I+LK ++ P D + + +N E + KVE C+ +W+KQ+EQ+LAE+ Q+R+EAD++GPRAEL++WK+R+++FNYLLDQLK P+VKAA+ +L AAKSK LK W + D RITDAANEAKDNVK+LYTLE+ C PLY ++P  MID IP LI++++M++SIS YYNTSEK+TSLFVK+TNQMI++CKA+I+N+ T T+W+   E +M+++    +L + YQ+CFQETK +L   P E+QF+ SEMYIFGKF+TF RRL+ I+ IF   KTYSVL D+ IEGLE M  K+  IV+ IKKK YNFLDQR  +F QD+++F ++I ELHN++  FMD  F+ I ST +A+ +L++FERLNIP+LGIEEKY  I  ++  D++ + K Y++ K DPP+AR+ P IAGKI WARQLF R++ PM++F+ QH  +L+T EAK +I++YN++A+ L+ FE++YH+AW++QI   H GL +SL+++ P T EL+VNFDP IL+L RET  M +L L + P A  L  K++  K+  + + +M++  ++V   +P   EQLM   +A++   ++PGL    WTS+ +  Y+++ +  + +LELLLDR  DL ++RI  +LEEMS++ LC+LP D P+T +EF+  T++LC+  A+LL  KS  VE++VNELINML   +   E          ++     S ++     +         + +       K+ +  + E A ELL HFNH+N +A++KV RNTLE++R+RI    M+ + D +  S AK    P FR +  L IPNI M P +E++Q T+N+    IISV KG+ QWS E  + +++    + + + +ED +    ++EN              + E L  +                       S NL    Q +N YKN+++NKE+ K+ S+LST I+ST+KEV T+M RF  Y+H+W K K+ T+  F+  +P + EF+  I  + +LE +INAE +Y   G IAL+T  LK+ L +ETKAW    G+ CN KY+AEME I T  E+ +K+LSR IKDLDDIRIAM ALKEIRE +I  D  + PIEESYA+L +Y L V K+E ++VDTLRY W+KL++R S VQ+ L  +QP FR  LI  V++F +DC +FY DYD +GPM  GL P+EAS RLII QN++DN+ R++ITY+GGEELFGL VT Y +L +IK++LNLLQK+YSLYN+VI +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD TSE+I+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS++S+DKIF +IG G+YC +RGF++EV+  +  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSRIWQGM+N   +VI +   LL LWKHEC RVI+DRF    D++WF K +   + E+  E+   ++ V +   DA+F+DF+RDA EATGE P++ D +MPK+YEPIAS + L++RL +F  LYNESIRG GMDMVFF DAM HL+KISR+IRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIK+E FLEYMNNVLSSG VSNLFARDE+DEI  +L PIMKKE+PRRPPTNDNL EYF+SR + NLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+LSS+ I C   +KKEL+  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK IY+EK     +LA RM++GL+KL EA ESVA L + LA KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKDKAQ+IV+ I +DK IAE KLEAA+PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  D ++    PSW ES+KLM+   FL NL  FPKDTINEE +E ++PY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF   LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E+Q ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GSTFKVKVGDKEVDVM GF+LYITTKLPNP+YTPEI ARTSIIDFTVT+KGLEDQLLG VI TEKQELE +R  L+EDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+ +TEI+INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++   +K EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+SRNEK WR WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GE +AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGWVLLQNCHL +D+++EL  V+ E+  V+  +RLW+T+E H QFPI  LQ++IKF NEPP+G+RA L+R++  ++QD LD  V   WK M Y++AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKDS  G  ETRE++V +   +ML+K+P ++ PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLA+DG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF EL++RN QF  W+++GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT+F  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI IFA     +     D ++Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERMDQLFAVGGLRHLMFYYQDVE-GAEAGHCGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITPENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIRQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIIELKSLKEPTDYLALASNPETVEKVECCMRVWIKQMEQILAENSQLRKEADDVGPRAELEHWKQRLSRFNYLLDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMIDAIPTLINAIKMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQGYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIEGLEDMATKYQDIVAAIKKKEYNFLDQREMDFDQDYEEFCKRINELHNDLQRFMDITFEKIPSTRQALSTLKKFERLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQ-QHPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRVNDLIEFRIHAILEEMSSMALCQLPQDDPLTCEEFLQMTKDLCVSGAQLLHFKSSLVEEAVNELINMLLDVDVPPEEAAENVCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEARELLSHFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSNDASKAKQNHLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHERKMAAVKNNEDSDSDAEVEEN-------------ELQETLEIA-----------------------SINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTFIAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE---KAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARDPRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDVK 4621          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q96JB1|DYH8_HUMAN (Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2)

HSP 1 Score: 5301.49 bits (13751), Expect = 0.000e+0
Identity = 2647/4557 (58.09%), Postives = 3397/4557 (74.54%), Query Frame = 3
Query:  456 KVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL ++++ EL + +  +   +  +R+W+T+E HD+FPI  LQ ++KFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  YI +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P ++IP +V  ++ KMG    MNIFLRQEIDR+ +VI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GA+WD+RNG+L+E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:    3 KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4490          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q91XQ0|DYH8_MOUSE (Dynein heavy chain 8, axonemal OS=Mus musculus OX=10090 GN=Dnah8 PE=1 SV=2)

HSP 1 Score: 5299.18 bits (13745), Expect = 0.000e+0
Identity = 2671/4663 (57.28%), Postives = 3445/4663 (73.88%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTM---VAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   +     + DI        F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGSQGRRRSEDIV------SFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|M0R8U1|DYH5_RAT (Dynein heavy chain 5, axonemal (Fragment) OS=Rattus norvegicus OX=10116 GN=Dnah5 PE=1 SV=1)

HSP 1 Score: 4275.32 bits (11087), Expect = 0.000e+0
Identity = 2131/3494 (60.99%), Postives = 2687/3494 (76.90%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS-----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQ 10628
            ++KEE+ AKR+RLD RH YL   VA   DL   EVE+++L+GNQIE +D+ F+      L F++Q+ E   E G     G       ++ KPKVF+T+GK+  L G CV F R+     I    I ++V+F  ++ ++G +L  +   +S + +P  R    GWG+LE  +D+   ++  ++SLE FV +LS A+ S+ E+V L+ C  ++LK ++ P+D + + +N E + KVE C+ +W+KQ+EQ+LAE++Q+R+EAD++GPRAEL++WKKR++KFNYLLDQLK P+VKA + +L AAKSK LK W + D R+TDAANEAKDNVK+LYTLE+ C PLY ++P  M+D IP LI++++MI+SIS YYNTSE++TSLFVK+TNQMI++CKA+I+N+ T T+W+   + +M+++    +L + YQ CFQETK +L   P E+QF+ SEMYIFGKF+TF +RL+ I+ IF   KTYSVL D+ IEGLE M  K+  +V+ IKKK YNFLDQR+ +F QD+D+F +Q  ELH+ +  FMD  F+ I ST +A+ +L++FERLNIP+LGIE KY  +  ++G D++ + K Y++ K DPP+ARD P IAGKI WARQLF R++ PM++F+ QH  +L+T EAK +I++YN++A+ L+ FE++YH+AW++QI   H GL +SL+++ P T +L+VNFDP ILIL RET  M ++ L + P A  L  K++  K+  + + +M++  Q+V   +P   EQLM+  +A++   ++PGL    WTS+ +  Y+++ +  + +LELLLDR  DL ++RI  +LEEMS++ LC+LP D P+T +EF+  T++LC+  A+ L  KS  VE++VNELINML   +   E          ++     S        +         + +       K+ +  + E A ELL +FNH+N +A++KV RNTLE++R+RI    M+ +  S     VK +  P FR +  L IPNI M P +E++Q T+N+    IISV KG+ QWS E  + +++    + + + +ED +    ++E+              + E L  +                       S NL    Q +N YKN+++NKE+ K+ S+LST I+ST+KEV T+M RF  Y+H+W K K+ T+  F+  +P +SEF+  I  + +LE +INAE +Y   G IAL+T  LK  L +ETKAW +  G+ CN KY++EME IFT  E+ +K+L+R IKDLDDIRIAM ALKEIRE +I  D  + PIEESYA+L +Y L V K+E ++VDTLRY W+KL++R S VQ+ L  +QP FR  LI  V++F +DC +FY DYD +GPMV GL P+EASDRLII QN++DN+ R++ITY+GGEELFGL VT Y +L +IKK+LNLLQK+YSLYN+VI +VN Y D LW +V+IEKI++EL EFQNRCRKLP+ LKDW AF D++KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+E PLLK+KEEIEDICISAVKE+DIE KLK V  EW    L F +FK RGELLLRGD TSE+I+ MEDSLM+L SLLSNRYN+PFK  IQ+ V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I ++ F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+ TDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT+CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  +  +   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D  DTMFDY V+ +G W HW+  + EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE H  K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS++S+DKIF +IG G+YC +RGF+ EV+  V  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSRIWQGM+N   +VI +   LL LWKHEC RVI+DRF    D++WF K +   + E+  E+   ++ V +   DA+F+DF+RDA EATGE P++TD +MPK+YEPIAS + L++RL +F  LYNESIRG GMDMVFF DAM HL+KISR+IRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIK+E FLEYMNNVLSSG VSNLFARDE+DEI  +L  IMKKE+P+RPPTNDNL EYF+SR + NLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+LSS+ I C   +KKEL+  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK IY+EK     +LA RM++GL+KL EA ESVA L + LA KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKDKAQ+IV+ I +DK IAE KLEAA+PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ F RR++ +  D +++   PSW ES+KLM+   FL NL  FPKDTINEE +E +SPY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD+KQ EL  VQA Y++A+ +KQ
Sbjct:   21 RLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERIDQLFAVGGLRHLMFYYQDVE-GAEAGQFGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFTRADPSKAITAENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIQQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIVELKSLKEPMDYLALASNPETVEKVECCMRVWIKQMEQILAENNQLRKEADDVGPRAELEHWKKRLSKFNYLLDQLKSPDVKAVLAMLAAAKSKLLKVWRDADIRVTDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMVDAIPTLINAIKMIYSISHYYNTSERITSLFVKVTNQMISACKAHITNNGTATIWSQPQDIVMQKIAAAIKLKQGYQCCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHQRLAKIMDIFTTFKTYSVLQDSKIEGLEDMVTKYQDVVAGIKKKEYNFLDQRKMDFDQDYDEFCKQTNELHSELQRFMDTTFEKIQSTRQALSTLKKFERLNIPNLGIEAKYQIVFQNFGTDIDMISKLYTKQKYDPPLARDQPPIAGKILWARQLFHRLEQPMQLFQ-QHPFVLRTVEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHVGLEASLLVKAPGTGQLFVNFDPQILILFRETQCMSQMGLPVSPFAAALFEKRDMYKKNFSDMKMMLSEYQRVKLKMPPAIEQLMLPHLARVDEALQPGLAVLTWTSLNIGTYLENAFEKIKDLELLLDRINDLIEFRIHAILEEMSSVALCQLPQDDPLTCEEFLQMTKDLCVNGAQKLHFKSSLVEEAVNELINMLLDVDVLPEEASEKVRHENASPNGDTSGGGEGCAEALASSFNAGTSSLPLTTIARKKKEMEVLEEARELLSYFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSKGASKVKQNHLPIFRASVTLAIPNISMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMRERKMAAVQSNEDSDSDTEVEES-------------ELQETLELA-----------------------SVNLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKCYNHIWQKEKEDTIMTFIAQNPLLSEFESRILYFQSLEQEINAEPEYICVGSIALYTADLKFSLTAETKAWMMVLGRHCNRKYRSEMENIFTVVEEFQKKLNRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMVSGLKPQEASDRLIIFQNQFDNIYRKYITYTGGEELFGLPVTQYPQLLEIKKQLNLLQKIYSLYNNVIETVNSYQDTLWSEVNIEKINSELLEFQNRCRKLPRALKDWQAFLDMKKTIDDFSECCPLLEYMASNAMVERHWQRITTLTGHSLDVGNETFKLRNIMEVPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTLTFSSFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQNWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQESGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALQNAKFDKKIMQKTNQSFLELLNMLIEMTTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFTYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASHTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTSCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEILEAFVITQSTHMLQGLIPTKEQ--AGDVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDPGDTMFDYYVAPDGTWRHWSMCIPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHTVKNLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGEGYYCAQRGFSKEVQDAVIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE---KTPVVDCGVDAYFVDFLRDAPEATGETPEETDAEMPKLYEPIASLNHLQERLSVFLQLYNESIRGTGMDMVFFRDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTSIMKKEHPKRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYNIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHVEVQSLANRMNTGLEKLKEASESVAALSQELAVKEKELQVANEKADMVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFHRRVNAVKIDLDKSCTVPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHALAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQ 3470          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A267H528 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018625g1 PE=4 SV=1)

HSP 1 Score: 6578.04 bits (17065), Expect = 0.000e+0
Identity = 3222/4660 (69.14%), Postives = 3817/4660 (81.91%), Query Frame = 3
Query:  132 RVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKG-GWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDI 14108
            RV  L   EN+ EKQ K+KEER A+R RLDERH +LL QVADFY +E +EVE+ ILDGN ++ M+ FF++  T  +  H+QEP+L+KE  DQIRIG  G K +R  KP++F++ G  AP++G C VFMR      + E  I++DV F  I+GS+G+L+G+E+ +S V++P  R L+G GWGQLE  E +R   +N LENFV +L+ A+E+IN+RV LK CT  DLKR++   D     +  + L  VE C   W+KQIEQVLAE++QIRREADN+GPRAELDYWK+RMAKFNYLLDQLK  +VK  +G+L AAKSK+LKTW EMDRRITD ANEAKDNVKFLYTL+EHC PLY ++P  M+D IPKLI+ +RMIHSIS+YYNTSE+MTSLFVK+TNQMIT+CK+YIS   +ET+W+    +++ +L  C  LN+ YQACFQ TK +L   P E++FE SEMYIFGKFDTFCRRL  II++F+ ++ ++ L+D+ IEG+E M  KFNVIV  +KKK Y+FLDQRRT+F  DF+DF RQIQEL  +I  FMD  F+ +TS+ RAIQ+L+RFERL IP LGI+EKY KIL  YG+++EA ++ Y++NK+DPP+ARD+P I GKI WARQLFRRI+ PM +F+ +  +LL++ + K ++KNYNKLAE L++FE++YH+AW++Q+ +   GL +SL++RHPE+K L+VN DP+IL L RET++M++L +++P AA +L+ +Q  +K  +++L  ++    +V +++PQEYE LM  R+ +LRR +EPGLT+ NW S+    YI  V   + ELELLL RA+DLR++RID VLEEM+ ++LCELP+  P T+D FV  TQ LC K A+LLQ KS NVE++VNELINML GEE                 ++R  +    S+  +  ++           ++ K+ K  I EAA ELL HFNHRN++AIVKV +NTLE+LRKRI+A T+++YD    ++ +PFFRC A L IP + M P  EEVQ  VN++ Y IISVSKG+SQWSKERKT +    E    +E+D D +  V    +   R     S A +   G SD  T R   +   G       E+G S       Q  N +K+V+ENKEVAK+ SLLS  INS +K V++AM RF  Y ++W + ++  L+EF++  P++ E++  I ++   E  INAE   YDCGPIA+FTE LK+GLL+ETKAWR+ +G++CN+KYK+EME  F F +D+EK+LSR IKDLDDIRIAM ALK+IRENEIRIDM I+PIEESYAML +++LPV K+E ERVDTLRYTW+KL + G +VQ++L+TIQ +FR NL+  V +FK+DC  FY DY  SGPMVPG+PPREASDRL+I QNR+DNL R+FITY+GGEELFGL V++Y +L  IKKELNLL KLYSLYNDVIN+VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDHT EIIS MEDSLM+LSSLLSNRYN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQL+E  GFYNLEKPGDFT +VDMQFMAAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS+IG GHYC+ERGF+DEVR L+  L+P+TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQGMINT  DV+ +  T+  LWKHECCRVISDRF   +D++WF +T+ R + ED+ E++    ++ E   +F+DF+RDA EATG+EPDD DF+MP+VYEPI +FD L +RL+ F G YNE+IRGAGMD+VFF DAMTHL+KISRII TPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN+ NL+EDLKFLYRTAGQQGKGITF+FTD EIKDE FLEY+NNVL+SGVVSNLF RDEMDEICQELI +MKKE+PRRPPTN+NLQEYFLSRT+QNLHVVLCFSP+GEKFR+RALKFP LISGCTMDWFQRWP+DAL+AVA H+LS F +VC+  VK++LI +MGVVHDGVAE+C +YF R+RR THVTPKSYLSFL GYK IY+EK + +  LA RMDSGL+KL+EAQESV  L E L  KEKEL +ANREAEEVLK V VQ+ AA E+KN+VQVVKD+AQ+IV+ I +DK IAE KLEAA+PAL  AE+ALNTIKPADIATVRKLG+PPHLIMRIMDCVLI FQRRLD +A DPER   KPSW ES+KLMSN  FL+ L  F KD++NEE++E + PY++MEDY ++ A+RVCGNVAGLLSWT+AM  FF INKEV+PLKDNL KQ+VR +K+ +DL AAQ+ LDEK+ EL KV+A+Y+EA+RKKQ L DDA  CRRKM+AA +LI GLA EK RWT QS E+K+QI RLVGDVL ATAFLSY GPFNQ+FR +LN +WQK ++ +KIP+S +LN+I+ML + T + EW+LQGLPNDELS +NGIIVT+ASRYPLLIDPQGQGKIWIKNREA +ELQ+TSLNHKYFRQHLED+LSLGRPLLIEDI EELDPALDNVLEKNFIKQGST KVKVGDKEVDV+KGF LY+TTKLPNP+YTPE++ARTSIIDFTVTMKGLEDQLLG VI+TEK ELE QR+QLMEDV  N K MK LED LLFRLTST+GSLVDDE+LI VLK TKVTSA+V QK+  A DT+IKI SAREEYRPVA+RGSILYFLI EMS+VN+MYQTSLRQFLGLFDLSM RS KSP+T KRI NII+ MT+EVWKYAVRGLYE DK+TFTLL+ LK+DM   K+K EEF T IKGGASLD+NVVQPKP  WI D TWLNLVELSNLHQFS +LDQ++R+EK W+QWFDKEAPEEE+IPDGYNTNLD FRRLLL+R WCPDRT+SQAK+YI DSLGEKFAEG ILD + V+EES PRTPMVGLLSMGSDPT +IE+LAKKHK EC+AISMGQGQEIH+RRLM+N L  GGWVLLQNCHL +DY+ E+   + E+  V+  + LW+T E H +FPI+FLQ +IKFTNEPP+G++A L+R+F   TQD+LD   +  W+ M Y +AFLH  VQERRKFGP+GWNIPYEFN AD NA   F+QNHLD +  KK     G++W  VRYM+SEIQYGGRVTDD+D  LL    K +F E MF+P F       I  F  ++EY  YI NLP  D P  FGLH NADISY  +TTK IL+ ILSIQPKDS  G GETRES+VYKQ  ++L+K+P +++PF+V E++ KMG  QPMNIFLRQE+DR+ +VI  VR TLTDLKLAIDG ++MN+ LRDALD ++DAKIP +W KISW+S+ LGFWF ELI+RN QF  W+  GRP CFW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N VT+    ++  PP EGVY++GLFLEGA WD+RN RL EA+ KIL + LPV++I+A+         +D K+Y+ PIYKKPRRT+LTY+A  +L  S+ A+HW++RGVA+LCD+
Sbjct:   21 RVSVLTSGENIKEKQQKLKEEREARRHRLDERHHHLLAQVADFYCIEKSEVEDGILDGNNVDQMELFFAAGGTCKILVHYQEPDLDKEGPDQIRIGQPGSKSTRAQKPRIFVSDGSSAPIRGPCAVFMRPDSQQAVTEANISRDVTFFSIDGSDGILRGVEQVLSTVLVPQLRELQGSGWGQLECQEHAREQFLNGLENFVNMLNTAQETINDRVVLKPCTGFDLKRLKTITDINQAASQADSLAAVEECAASWMKQIEQVLAETEQIRREADNVGPRAELDYWKRRMAKFNYLLDQLKSNDVKQVLGVLNAAKSKSLKTWFEMDRRITDNANEAKDNVKFLYTLDEHCMPLYHSDPVKMVDMIPKLINGIRMIHSISRYYNTSERMTSLFVKVTNQMITACKSYISQGGSETIWSQPTADVISQLKDCIRLNEEYQACFQRTKQKLEQMPGEKRFEFSEMYIFGKFDTFCRRLKKIIEMFQTMELFAHLSDSKIEGMEMMAAKFNVIVVGLKKKPYDFLDQRRTDFDNDFEDFKRQIQELQGSIQGFMDSRFEKLTSSQRAIQTLKRFERLKIPRLGIDEKYQKILAFYGKELEAAVRIYNKNKDDPPIARDLPPIGGKICWARQLFRRIEEPMVLFK-KMPHLLQSADGKKLVKNYNKLAEALVAFEMLYHRAWIKQLQTAQDGLKASLLVRHPESKRLFVNLDPEILTLIRETELMVRLGMDVPLAAQHLRARQATIKRHYDELNSLLEDYSRVLSTVPQEYEPLMGPRLGRLRRALEPGLTSLNWMSLATDSYIRDVRADMCELELLLARAKDLREFRIDRVLEEMANVRLCELPDSEPWTIDSFVERTQSLCQKGAQLLQVKSVNVEEAVNELINMLVGEEL--------------DDDDRSEMGAEESEERQREVESAGERPAQLGGRRKKDEKEQIEEAAMELLNHFNHRNMDAIVKVTKNTLEALRKRISASTLISYD-KAANTQRPFFRCFATLSIPQVAMHPTTEEVQQCVNKSCYCIISVSKGVSQWSKERKTTR----EKFSYDEEDFDFDGEVTTARSDARRPSIAASVAHTDISGQSDGATSRAGFRSHRGRTES---EEGTS-QYAVQMQANNYFKSVSENKEVAKLASLLSAAINSQKKAVQSAMERFYIYRYIWEQNREEALQEFVQQSPRLGEYEAKILDFEQKEETINAEPPSYDCGPIAIFTERLKLGLLTETKAWRLMFGRSCNLKYKSEMEDFFAFMDDIEKKLSRPIKDLDDIRIAMAALKDIRENEIRIDMGISPIEESYAMLFKHDLPVPKEEAERVDTLRYTWEKLRAHGIEVQNHLVTIQTDFRDNLVHEVVVFKQDCADFYSDYGGSGPMVPGVPPREASDRLVIFQNRFDNLHRKFITYTGGEELFGLPVSEYPELHKIKKELNLLTKLYSLYNDVINTVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDHTGEIISFMEDSLMVLSSLLSNRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEV---GKLVEPTHYFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKK-----GVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAI-----NGPTKDEKLYVCPIYKKPRRTDLTYVAAIKLRTSQPADHWVIRGVALLCDV 4639          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A1I8J1U1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 6567.25 bits (17037), Expect = 0.000e+0
Identity = 3214/4644 (69.21%), Postives = 3808/4644 (82.00%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKG-GWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDI 14108
            K+KEER A+R RLDERH +LL QVADFY +E +EVE+ ILDGN ++ M+ FF++  T  +  H+QEP+L+KE  DQIRIG  G K +R  KP++F++ G  AP++G C VFMR      + E  I++DV F  I+GS+G+L+G+E+ +S V++P  R L+G GWGQLE  E +R   +N LENFV +L+ A+E+IN+RV LK CT  DLKR++   D     +  + L  VE C   W+KQIEQVLAE++QIRREADN+GPRAELDYWK+RMAKFNYLLDQLK  +VK  +G+L AAKSK+LKTW EMDRRITD ANEAKDNVKFLYTL+EHC PLY ++P  M+D IPKLI+ +RMIHSIS+YYNTSE+MTSLFVK+TNQMIT+CK+YIS   +ET+W+    +++ +L  C  LN+ YQACFQ TK +L   P E++FE SEMYIFGKFDTFCRRL  II++F+ ++ ++ L+D+ IEG+E M  KFNVIV  +KKK Y+FLDQRRT+F  DF+DF RQIQEL  +I  FMD  F+ +TS+ RAIQ+L+RFERL IP LGI+EKY KIL  YG+++EA ++ Y++NK+DPP+ARD+P I GKI WARQLFRRI+ PM +F+ +  +LL++ + K ++KNYNKLAE L++FE++YH+AW++Q+ +   GL +SL++RHPE+K L+VN DP+IL L RET++M++L +++P AA +L+ +Q  +K  +++L  ++    +V +++PQEYE LM  R+ +LRR +EPGLT+ NW S+    YI  V   + ELELLL RA+DLR++RID VLEEM+ ++LCELP+  P T+D FV  TQ LC K A+LLQ KS NVE++VNELINML GEE                 ++R  +    S+  +  ++           ++ K+ K  I EAA ELL HFNHRN++AIVKV +NTLE+LRKRI+A T+++YD    ++ +PFFRC A L IP + M P  EEVQ  VN++ Y IISVSKG+SQWSKERKT +    E    +E+D D +  V    +   R     S A +   G SD  T R   +   G       E+G S       Q  N +K+V+ENKEVAK+ SLLS  INS +K V++AM RF  Y ++W + ++  L+EF++  P++ E++  I ++   E  INAE   YDCGPIA+FTE LK+GLL+ETKAWR+ +G++CN+KYK+EME  F F +D+EK+LSR IKDLDDIRIAM ALK+IRENEIRIDM I+PIEESYAML +++LPV K+E ERVDTLRYTW+KL + G +VQ++L+TIQ +FR NL+  V +FK+DC  FY DY  SGPMVPG+PPREASDRL+I QNR+DNL R+FITY+GGEELFGL V++Y +L  IKKELNLL KLYSLYNDVIN+VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDHT EIIS MEDSLM+LSSLLSNRYN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQL+E  GFYNLEKPGDFT +VDMQFMAAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS+IG GHYC+ERGF+DEVR L+  L+P+TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQGMINT  DV+ +  T+  LWKHECCRVISDRF   +D++WF +T+ R + ED+ E++    ++ E   +F+DF+RDA EATG+EPDD DF+MP+VYEPI +FD L +RL+ F G YNE+IRGAGMD+VFF DAMTHL+KISRII TPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN+ NL+EDLKFLYRTAGQQGKGITF+FTD EIKDE FLEY+NNVL+SGVVSNLF RDEMDEICQELI +MKKE+PRRPPTN+NLQEYFLSRT+QNLHVVLCFSP+GEKFR+RALKFP LISGCTMDWFQRWP+DAL+AVA H+LS F +VC+  VK++LI +MGVVHDGVAE+C +YF R+RR THVTPKSYLSFL GYK IY+EK + +  LA RMDSGL+KL+EAQESV  L E L  KEKEL +ANREAEEVLK V VQ+ AA E+KN+VQVVKD+AQ+IV+ I +DK IAE KLEAA+PAL  AE+ALNTIKPADIATVRKLG+PPHLIMRIMDCVLI FQRRLD +A DPER   KPSW ES+KLMSN  FL+ L  F KD++NEE++E + PY++MEDY ++ A+RVCGNVAGLLSWT+AM  FF INKEV+PLKDNL KQ+VR +K+ +DL AAQ+ LDEK+ EL KV+A+Y+EA+RKKQ L DDA  CRRKM+AA +LI GLA EK RWT QS E+K+QI RLVGDVL ATAFLSY GPFNQ+FR +LN +WQK ++ +KIP+S +LN+I+ML + T + EW+LQGLPNDELS +NGIIVT+ASRYPLLIDPQGQGKIWIKNREA +ELQ+TSLNHKYFRQHLED+LSLGRPLLIEDI EELDPALDNVLEKNFIKQGST KVKVGDKEVDV+KGF LY+TTKLPNP+YTPE++ARTSIIDFTVTMKGLEDQLLG VI+TEK ELE QR+QLMEDV  N K MK LED LLFRLTST+GSLVDDE+LI VLK TKVTSA+V QK+  A DT+IKI SAREEYRPVA+RGSILYFLI EMS+VN+MYQTSLRQFLGLFDLSM RS KSP+T KRI NII+ MT+EVWKYAVRGLYE DK+TFTLL+ LK+DM   K+K EEF T IKGGASLD+NVVQPKP  WI D TWLNLVELSNLHQFS +LDQ++R+EK W+QWFDKEAPEEE+IPDGYNTNLD FRRLLL+R WCPDRT+SQAK+YI DSLGEKFAEG ILD + V+EES PRTPMVGLLSMGSDPT +IE+LAKKHK EC+AISMGQGQEIH+RRLM+N L  GGWVLLQNCHL +DY+ E+   + E+  V+  + LW+T E H +FPI+FLQ +IKFTNEPP+G++A L+R+F   TQD+LD   +  W+ M Y +AFLH  VQERRKFGP+GWNIPYEFN AD NA   F+QNHLD +  KK     G++W  VRYM+SEIQYGGRVTDD+D  LL    K +F E MF+P F       I  F  ++EY  YI NLP  D P  FGLH NADISY  +TTK IL+ ILSIQPKDS  G GETRES+VYKQ  ++L+K+P +++PF+V E++ KMG  QPMNIFLRQE+DR+ +VI  VR TLTDLKLAIDG ++MN+ LRDALD ++DAKIP +W KISW+S+ LGFWF ELI+RN QF  W+  GRP CFW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N VT+    ++  PP EGVY++GLFLEGA WD+RN RL EA+ KIL + LPV++I+A+         +D K+Y+ PIYKKPRRT+LTY+A  +L  S+ A+HW++RGVA+LCD+
Sbjct:    2 KLKEEREARRHRLDERHHHLLAQVADFYCIEKSEVEDGILDGNNVDQMELFFAAGGTCKILVHYQEPDLDKEGPDQIRIGQPGSKSTRAQKPRIFVSDGSSAPIRGPCAVFMRPDSQQAVTEANISRDVTFFSIDGSDGILRGVEQVLSTVLVPQLRELQGSGWGQLECQEHAREQFLNGLENFVNMLNTAQETINDRVVLKPCTGFDLKRLKTITDINQAASQADSLAAVEECAASWMKQIEQVLAETEQIRREADNVGPRAELDYWKRRMAKFNYLLDQLKSNDVKQVLGVLNAAKSKSLKTWFEMDRRITDNANEAKDNVKFLYTLDEHCMPLYHSDPVKMVDMIPKLINGIRMIHSISRYYNTSERMTSLFVKVTNQMITACKSYISQGGSETIWSQPTADVISQLKDCIRLNEEYQACFQRTKQKLEQMPGEKRFEFSEMYIFGKFDTFCRRLKKIIEMFQTMELFAHLSDSKIEGMEMMAAKFNVIVVGLKKKPYDFLDQRRTDFDNDFEDFKRQIQELQGSIQGFMDSRFEKLTSSQRAIQTLKRFERLKIPRLGIDEKYQKILAFYGKELEAAVRIYNKNKDDPPIARDLPPIGGKICWARQLFRRIEEPMVLFK-KMPHLLQSADGKKLVKNYNKLAEALVAFEMLYHRAWIKQLQTAQDGLKASLLVRHPESKRLFVNLDPEILTLIRETELMVRLGMDVPLAAQHLRARQATIKRHYDELNSLLEDYSRVLSTVPQEYEPLMGPRLGRLRRALEPGLTSLNWMSLATDSYIRDVRADMCELELLLARAKDLREFRIDRVLEEMANVRLCELPDSEPWTIDSFVERTQSLCQKGAQLLQVKSVNVEEAVNELINMLVGEEL--------------DDDDRSEMGAEESEERQREVESAGERPAQLGGRRKKDEKEQIEEAAMELLNHFNHRNMDAIVKVTKNTLEALRKRISASTLISYD-KAANTQRPFFRCFATLSIPQVAMHPTTEEVQQCVNKSCYCIISVSKGVSQWSKERKTTR----EKFSYDEEDFDFDGEVTTARSDARRPSIAASVAHTDISGQSDGATSRAGFRSHRGRTES---EEGTS-QYAVQMQANNYFKSVSENKEVAKLASLLSAAINSQKKAVQSAMERFYIYRYIWEQNREEALQEFVQQSPRLGEYEAKILDFEQKEETINAEPPSYDCGPIAIFTERLKLGLLTETKAWRLMFGRSCNLKYKSEMEDFFAFMDDIEKKLSRPIKDLDDIRIAMAALKDIRENEIRIDMGISPIEESYAMLFKHDLPVPKEEAERVDTLRYTWEKLRAHGIEVQNHLVTIQTDFRDNLVHEVVVFKQDCADFYSDYGGSGPMVPGVPPREASDRLVIFQNRFDNLHRKFITYTGGEELFGLPVSEYPELHKIKKELNLLTKLYSLYNDVINTVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDHTGEIISFMEDSLMVLSSLLSNRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEV---GKLVEPTHYFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKK-----GVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAI-----NGPTKDEKLYVCPIYKKPRRTDLTYVAAIKLRTSQPADHWVIRGVALLCDV 4604          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: K1PX83 (Dynein heavy chain 5, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10017921 PE=4 SV=1)

HSP 1 Score: 6362.71 bits (16506), Expect = 0.000e+0
Identity = 3175/4703 (67.51%), Postives = 3774/4703 (80.25%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQG-TQINENTIAKDVNFIVI----NGSNG--VLQGLEEYMSRVMLPHFRNLKGGWGQL--EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXT-----PMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY--DIS----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSED---IVSQSQVF---------ETDAW--------------------------FMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSH-QGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            K+KEER AKR+ LDERH Y+L+ VAD   LE TEVE++IL+GNQIE+MD+F S +  + L F++QEPE   E  D +R+G    K S+  KPKVF+T G++ PL+G  +VF + ++    I E  I K+V F  +    NG NG  +L  +E  +S + +P  +NL  GWG L     E  R+  +N+L++FV VL  A+ES+ E+V LK C   DL +I+ P D   + N++E L  +E+C+ +WLKQ+EQVLAES+Q+R+EAD+IGPRAELD+WKKRM++FNYLLDQ+K P+VKA +G+L A++SK +K W E DRRITD ANEA+DNVKFLYTLE+ C PLY ++P  M++ IP LI+++RMIHSIS+YYNTSE+MTSLFVKITNQMIT+CK+YIS   TETVWT    +++++L  C +LN+ YQ CF +TK +L   P+ER FE SEMYIFGKFDTF RRL  II++FE I  YS L+++ IEG+E    +FNVIV+ +KKK Y+FLDQR+TEF  DFD+F R + ELH NI  FMD  F+ I STTRA+  L+RFE+LN+P LGI +KY +IL+HYG+D+E V K Y +NK DPPVARD+P IAGKIAWARQL+RRIQ PME+F+ Q   LL+ PEAK IIKN+NKLA+ L+ FE++YH+ W+RQI +  +GL +SL+I+HPET EL+VNFDP IL + RET+ M +L LEIPP AI ++ KQ   K+ ++ L +++   ++V N IP  +E LM   ++K+ + +EPGL+  +WTS+ +QEYI  VY  L ELELL+DRA DL ++RID VL+EMST +LC+LP D P   D F+ NTQ LC K A  LQ+KS  VE++ NELINMLC  + + E ++   E+    Q  +            +     P+   AH       KK +E++ +I EAA+ELL HFNHRN +A++KV +NTLESLRKRI + +MV Y  D       K  + PFF+  A L IPNIVM P ++EVQ TVN+ A MIISVSKG+++WS+ERK  ++ A           D E  V  D     RRQS VS A       SD+               +  +E+    N     Q KN +K V+ENKEV K+ SLLST INST+KEV TA+ RFS Y  +W K ++  L EF K+DPK+SE++  IK Y  LE +IN   ++YD GPIAL+TE LK+GL +ETKAW++ YGKACN KY  EME+IFTF EDL KRLSR +KDLDDIR AM ALKEIR++EIRIDM I PIEESYAML++++LPV K+ETE+ DTLRY+W+KL  + S+VQ  L+ +QP+F+S LIENV+ F  DC  FY  YD  GPM  G+PPREASDRLII QN +D L ++FITY+GGEELFGL V+DY KL  IKKELNLLQKLYSLYN+V+ +V+GYYDILW D++IEKI+NEL EFQN+CRKLP+ LKDWPAFEDL+KTID+FN MVPLLELMTN AMKPRHW RM+++TSH FDVESD FAL+NILEAPLL+FKEEIEDICISAVKEKDIEAKLK V A+W+  E  F  FKNRGELLLRGD+TSEI+S+MEDSLM+LSSLLSNRYN PFKK+IQ  V  L+NSSEIIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE  NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDN+KTVKFHEK Y+ ILA YS E E ++LEKPVKAE NVE WLM L+ MAQ+SLHGVIR A  SI D+ F +LEFLNM+PAQVG+LGIQ++WTRDSTEAL +A+ DRKIMQQTN+ FL LLN+LI QTT DL KVERTKFETLITIHVHQKDIFD L +  VKSP+DF+WLKQ+RFYF+ED D+C +S+TDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL  KKERKK F+FTDGD V ++PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GF+DNI LARKFYTLYKLCEEQLTKQVHYDFGLRNILS LRTLG  KR N  D E  +VMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDKGGYP+LE AI RQIDEA +++HPPW LKLIQLFETQRVRHGMMTLGPSGAGKT CIH+LMKA+TDCGEPH+E+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTL+ KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMVYMSSS LDW P+L+ WL  R  NE+ I+++LF  SFP + +Y++Q L +KME LEAF++ QAC LLEGLIP KD+KDS  +S+ HYE LYIF++MW+IGA LE +DR K+E ++RSN++I LDLP   +D+++TMFDYMV  NG+W HW++KVE Y YP DSTPEYGSILVP VDNVRT+FL+NT++ Q KAVLLIGEQGTAKTVMIN Y+   NPEYH+ +SLNFSSAT P MFQRT+ES+VDKR+GSTYGPPAG+KMT+F+DDINMPVINEWGDQIANEIVRQL+E KGFYNLEKPGDFTNI D+QF+AAMI PGGGRNDIPQRLKRQF I NCTLPSN SIDKIFS IG GHY  +RGF  +V  +   L+PITRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGMINT+  VI + K LL LWKHEC RVI+DRF   ED +WF KT+ R ++E+LSE    +V  +  F         E   W                          F DFMRDA EATG+EP+DTDFDMPK+YEPI SF+ L++RL+MF   YNE IRG+GMD+VFF DAM HL+K+SRIIRTPRGNALLVGVGGSGKQ+LTKLAS+IAGYK FQITLTRSYN+SNLLEDLK+LYRTAG QGKGITF+FTDQEIKDE FLEY+NNVLSSG+V+NLFARDEMDEI  ELIPIMKKE+PRRPP+N+NL +Y+L+R + NLHVVLCFSP+GEKFR RALKFPGLISGCTMDWFQRWPKDALIAVA H+LS+F I C   VKK++I +MG++HDGVAE+CV YFQR+RR THVTPKSYLSF+ GYK+IY +K +    LA+RM++GL+KLIEA + VA LKE LA KEKELAIA+ +A++VLK VTV+  AA +VK +VQ VKDKAQ IV+ IE DK IA  KLE A PAL EAE ALNTIKPADIATVRKLG+PPHLIMRIMD VL+ FQ+R++T+  DPER   KPSWGE++KLMS   FL  LINFPKD+IN+ETVEL+ PYL  EDYT++VA+RVCGNVAGLLSWTR+M  FFEINKEVLPLK NL  Q+ R + +M DL  AQ+ LDEK+ EL KV+ +YD+A+R+KQTLLDDAETCRRKMTAAA LI GL GE+ RWT QS EF+AQI RLVGDVL  TAFLSY GPFNQ+FR +LN  W KEL+ RKIP + +L++IDMLTDPT++GEW+LQGLPNDELS QNGIIVTKASRYPLLIDPQGQGK WIKNREA  ELQ+TSLNHKYFR HLEDS+SLGRPLLIED+ EELDPALDNVLEKNFIK GST KVKVGDKE D+MKGF LYITTKL NPSYTPE+ A+TSIIDFTVTMKGLEDQLLG VI TEK ELE++R++LMEDVQ NKKKMKELEDNLL+RLTSTKGSLVDDEDLI VL TTK T+ +VSQKL +A++T+ KI  AREE+RPVA RGSILYFLIVEM LVN MYQTSL+QFL LFDLSM+RS KSP+TQKRIQNII+ MT+EV+KYAVRGLYE DK TFTLL+ LK+D+ AGKIK EEF T IKGGASLD+NVVQPKP  WI D+TWLNLVELSNLHQFS +L+QVSRNEKQWRQWFDKEAPEEEVIPDGYN +LD FRRLLLVR WCPDRT+SQA+KYI D+LG+K+AEG ILD +K++ ES  RTPMV LLSMGSDPT  IE LAKK K+ECR ISMGQGQE+H+RRLMA  +  GGW+LLQNCHL +DY+ E+   + E+  ++  +RLW+T+E H +FPINFLQI+IKFTNEPP+GI+A L+R++A L+QD+LD   +  WK M Y +AF+H  VQERRKFGPLGWNIPYEFN ADFNA   F+QNHLD +  KK     G++W CVRYM  EIQYGGRVTDD+D RLL    K +F E MFQ +F       I     + EY +YI+NLP TD P +FGLH NADI+Y +K+ K +L+TIL IQPKDS   G GETRESIVY+ C +ML+K+P+++ PF+V  ++ KMG  QPMNIFL+QEIDR+ +VI  VR TL+DLKLAIDG ++M++ LRDALDC++DA+IP +W+KISW+S+TLGFWF ELIDRN QF  W  DGRPV FW+TGFFN QGFLTAMRQEVTR+H GWA D VIL N VTR   +++  PP EGVY+YGLFLEGA WDKR  +LIE KPK+L++ +PVI+I+A+        +EDT+MY  PIYKKPRRT+LTYIA   L  +++ +HW++RGVA+LCDIK
Sbjct:   17 KLKEEREAKRAHLDERHFYILQTVADSLGLELTEVEDAILEGNQIEMMDQFLSPNSVSQLLFYYQEPE-HVEPVDHLRVGPPQAKVSKTSKPKVFVTNGRDTPLRGVALVFTKVAEADVTITETNIMKEVTFTRLDTSGNGKNGSGLLHAVETLLSSIFIPALKNLDKGWGALGTPSGEQVRQDFLNTLDSFVSVLVGAQESLEEKVTLKPCETYDLSKIQTPADYQAVANSSEALEGIENCMNVWLKQLEQVLAESEQMRKEADDIGPRAELDHWKKRMSRFNYLLDQIKGPDVKAVLGVLHASQSKLIKQWQEHDRRITDLANEARDNVKFLYTLEKFCDPLYNSDPVGMLEGIPGLINAIRMIHSISRYYNTSERMTSLFVKITNQMITACKSYISCQKTETVWTQNQADVVRKLNDCIKLNEEYQRCFHKTKEKLEKMPNERPFEFSEMYIFGKFDTFTRRLKKIIEMFETISMYSHLSESKIEGIEQSATRFNVIVTNMKKKPYDFLDQRKTEFELDFDEFKRMVAELHQNIQMFMDQKFEKIVSTTRALVLLQRFEKLNLPGLGIYDKYQRILSHYGKDIENVSKLYQKNKNDPPVARDLPPIAGKIAWARQLYRRIQEPMEVFK-QQGKLLEMPEAKRIIKNFNKLAKVLLEFEMLYHRGWLRQIEAARSGLQASLLIKHPETAELFVNFDPQILTMVRETECMARLGLEIPPLAITMRAKQTEYKDNYSALQMLLQENKRVRNKIPTAFESLMGPHVSKVDKRLEPGLSKLSWTSLNIQEYIQEVYSVLGELELLMDRAHDLMEFRIDAVLKEMSTTKLCQLPEDEPWLCDAFLENTQMLCAKGAVALQTKSLVVEEAANELINMLCPVDFEDEDEKIEMEEDEEEQRSQAGSPTGSQGARTSSRKSRPVSSKAH----LVAKKKREMRENIEEAANELLAHFNHRNQDALMKVTKNTLESLRKRITSSSMVHYLGDSGGFGDAKKDSGPFFKTFATLAIPNIVMQPALDEVQQTVNKAAQMIISVSKGVAKWSEERKRPQKSAV----------DREHAVAAD-----RRQSVVSAA-------SDAA-------------GEKKEEETEMKNYTITQQAKNYFKAVSENKEVTKLVSLLSTSINSTKKEVTTALDRFSGYHPIWEKDREDDLVEFNKEDPKLSEYEAKIKHYEELEVEINGLPEFYDVGPIALYTENLKLGLTTETKAWKLHYGKACNQKYSMEMERIFTFIEDLTKRLSRPLKDLDDIRFAMAALKEIRDDEIRIDMLIGPIEESYAMLIKHDLPVNKEETEKCDTLRYSWEKLQVQTSEVQTELLQVQPQFKSELIENVKTFNTDCSDFYSTYDTQGPMCAGVPPREASDRLIIFQNNFDVLYKKFITYTGGEELFGLPVSDYPKLGQIKKELNLLQKLYSLYNNVLETVHGYYDILWADINIEKINNELLEFQNKCRKLPRALKDWPAFEDLKKTIDNFNEMVPLLELMTNKAMKPRHWNRMAEVTSHVFDVESDNFALKNILEAPLLEFKEEIEDICISAVKEKDIEAKLKQVIADWNNKEFTFAQFKNRGELLLRGDNTSEIVSLMEDSLMVLSSLLSNRYNAPFKKNIQLWVQNLTNSSEIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETPNVVQCCVGDETLMQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNLKTVKFHEKFYDQILAIYSSENETIDLEKPVKAEGNVENWLMSLMLMAQKSLHGVIRTAAMSIQDSSFQLLEFLNMFPAQVGILGIQMIWTRDSTEALTHARYDRKIMQQTNQAFLDLLNILINQTTQDLTKVERTKFETLITIHVHQKDIFDDLCRMHVKSPTDFEWLKQSRFYFLEDQDKCQISVTDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLGAKKERKKAFIFTDGDNVTLSPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFLDNITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSCLRTLGTVKRQNKDDPEAMSVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKGGYPDLEGAIARQIDEAKLVAHPPWTLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHILMKAMTDCGEPHKELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLRAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVYMSSSGLDWKPILQCWLNSRPVNEQAIIMDLFERSFPLVLQYAVQNLTFKMEVLEAFIISQACKLLEGLIPSKDDKDSGSVSQSHYEHLYIFTLMWTIGAFLEWDDRIKVEEFMRSNDDIVLDLPPTNRDADETMFDYMVDTNGQWQHWSNKVEPYHYPTDSTPEYGSILVPMVDNVRTEFLINTISKQGKAVLLIGEQGTAKTVMINGYMGKYNPEYHLGQSLNFSSATTPLMFQRTVESYVDKRVGSTYGPPAGKKMTIFVDDINMPVINEWGDQIANEIVRQLMEYKGFYNLEKPGDFTNIADVQFLAAMIQPGGGRNDIPQRLKRQFVIINCTLPSNPSIDKIFSCIGCGHYITDRGFAKDVIDMTAKLVPITRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMINTECSVIKSEKELLWLWKHECSRVIADRFTNFEDQAWFNKTMSRVINEELSETHGAMVDSTHYFVDFMKFTTAEDGHWFEKTLLRVIGDELGEDFLEIVKPTYYFGDFMRDAPEATGDEPEDTDFDMPKIYEPIPSFEVLEERLQMFLQQYNEGIRGSGMDLVFFKDAMIHLVKVSRIIRTPRGNALLVGVGGSGKQSLTKLASFIAGYKTFQITLTRSYNVSNLLEDLKYLYRTAGAQGKGITFIFTDQEIKDEAFLEYLNNVLSSGIVANLFARDEMDEIMGELIPIMKKEFPRRPPSNENLYDYYLTRVRNNLHVVLCFSPVGEKFRARALKFPGLISGCTMDWFQRWPKDALIAVADHFLSNFNIECTAEVKKQVIQTMGLIHDGVAESCVSYFQRYRRSTHVTPKSYLSFINGYKTIYSDKKNEIGELAERMNTGLEKLIEAGQQVALLKEELAVKEKELAIASEKADKVLKEVTVKAQAAEKVKEQVQKVKDKAQGIVDAIESDKVIAYEKLEKARPALEEAEAALNTIKPADIATVRKLGKPPHLIMRIMDSVLLLFQKRVNTVEMDPERPCIKPSWGEALKLMSGTNFLQTLINFPKDSINDETVELLDPYLSQEDYTLEVAKRVCGNVAGLLSWTRSMAVFFEINKEVLPLKANLAVQEARLQVAMGDLQKAQAQLDEKEAELAKVREMYDQAMREKQTLLDDAETCRRKMTAAAALINGLQGERDRWTEQSKEFRAQIGRLVGDVLVCTAFLSYSGPFNQDFRLLLNQKWFKELKNRKIPCTLNLSVIDMLTDPTVIGEWNLQGLPNDELSTQNGIIVTKASRYPLLIDPQGQGKNWIKNREAHSELQLTSLNHKYFRTHLEDSMSLGRPLLIEDVAEELDPALDNVLEKNFIKVGSTLKVKVGDKECDIMKGFSLYITTKLGNPSYTPEVSAKTSIIDFTVTMKGLEDQLLGRVILTEKAELESERVKLMEDVQSNKKKMKELEDNLLYRLTSTKGSLVDDEDLINVLNTTKTTAQDVSQKLQVAAETQTKITVAREEFRPVAARGSILYFLIVEMGLVNCMYQTSLKQFLYLFDLSMARSAKSPITQKRIQNIIDFMTFEVFKYAVRGLYEEDKNTFTLLLTLKIDLAAGKIKHEEFMTLIKGGASLDLNVVQPKPHKWIVDLTWLNLVELSNLHQFSGILEQVSRNEKQWRQWFDKEAPEEEVIPDGYNNSLDVFRRLLLVRSWCPDRTMSQARKYIADTLGDKYAEGVILDLEKMWSESNSRTPMVCLLSMGSDPTNNIEALAKKLKLECRNISMGQGQEVHARRLMAQGMANGGWLLLQNCHLSLDYVEEVLDQLIETETIHQEFRLWVTTEVHKKFPINFLQISIKFTNEPPQGIKAGLKRTYAGLSQDFLDISNMPQWKPMLYGVAFMHTVVQERRKFGPLGWNIPYEFNAADFNASVQFVQNHLDDMDIKK-----GVNWTCVRYMFGEIQYGGRVTDDYDKRLLNTFCKVWFGENMFQSNFCFYKGYIIPKCAKMQEYMDYINNLPGTDTPEAFGLHANADITYQSKSAKTVLDTILEIQPKDSSGGGSGETRESIVYRICDDMLEKLPNDYDPFEVKARLEKMGRLQPMNIFLKQEIDRMQRVISLVRSTLSDLKLAIDGTIIMSESLRDALDCMYDARIPKLWQKISWDSSTLGFWFTELIDRNGQFHTWCFDGRPVTFWMTGFFNAQGFLTAMRQEVTRAHKGWALDGVILHNDVTRQMKDDITTPPSEGVYVYGLFLEGAGWDKRGSKLIEPKPKVLFEPMPVIHIYAI---NTTSDKEDTRMYKCPIYKKPRRTDLTYIAAVFLKTNQNPDHWVLRGVALLCDIK 4670          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A2R2MTI0 (dynein heavy chain 5, axonemal OS=Lingula unguis OX=7574 GN=LOC106169088 PE=4 SV=1)

HSP 1 Score: 6312.64 bits (16376), Expect = 0.000e+0
Identity = 3093/4540 (68.13%), Postives = 3703/4540 (81.56%), Query Frame = 3
Query:  534 QINENTIAKDVNFIVI--NGSN---GVLQGLEEYMSRVMLPHFRNLKGGWGQLE-KDEDSRRA-MMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLC--GXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAH----TGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY-DISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            Q + N+  K+VNF V+  NG +   G+L  +E  ++ + +P  + L+ GWGQLE K  D  +A  MN L++FV VL+ A+ES+ ++V L  C + DL +I+ P +   I N+TE L  +E  + +W+KQIEQVLAES+Q+R+EAD+IGPRAELD+WKKRM+KFNYLLDQ+K PEVKA +G+LQAAKSKT+KTW E+DRRITDAANEAKDNVK+LYTL++ C PLY ++P  M++ IP LI+++RM+HSIS+YYNTSE+MTSLFVK TNQMIT+CK YI+    ET+WT   +E++K+L  C +LN  YQ CFQ TK +L   P+ERQFE SEMYIFGKFDTF RRL  I ++F  ++ YS L ++ IEG+E M  KF+VIV+++KKK Y++LDQR+ +F QDF+DF RQIQELH+ I+ FMD  F+ ITST RA+  LRRFERLN+P+LGI EKY KIL  YGRD+E+V K Y R+K +PP+ RD+P IAGKIAWARQL+RRIQ PME+F+ QH  +L+ PEAK IIKN+NKLA+ L+ +E++YH+ W+RQ+ +  +GL +SLI+RHPET+ELYVNFDP I+ L RET+ M++L LEIPPAA NL+ KQ   KE +N L LM+   ++V + IP  +E LM     K+  +IEPGLTT  WTSM +  ++  VY  L ELELL+DRA DL ++RID +L EMST  LCE P++VP TVDEF+  TQ+LC   A  L SKS NVED+ NELINMLC  G EE     E  E+   + ++   +   +PS+ S+T   Q +      G    + K KE++ S+ E A ELL HFNHRNL++++KV RNTLESLRKRI + + V+Y D+   + ++PFF+ +A L IPNIVM P ++EVQ TVN+ A  I+SVSKG++QWSKER+   +    +   +E   D             RR S  S A S    +   G     G+   G +           +L    Q KN YK V+ENKEVAK+  LL T INST+KE+ TA+  F  Y  +W K  +  L+EF+K +PK+SEF+  I  Y  LE  +NAE  +YD G IAL+TE LK+GL +ETKAWRI YGKACN KY  EM++IF F E+  KRLSR IKDLDDIR  M  LKEIRE EIR+DM I PIEESYAML+++ELPV+++E ERVDTLRY+W+++ ++  ++  YL+ IQP+FRS LI+NVQ+F +DC  FY DY  +GPMV G+PPREAS+RL+I QNR+D L R++ TY+GGEELFGL VT Y +L  IKKELNLLQKLY LYN VI +VN YYDILW +V+IEKI+ EL +FQN+CRKLP+ LK+WPAFEDLRKTIDDFN MVPLLELMTN AMKPRHWQRM++LT H FDVE++ F LRNILEAPLLK+KEEIEDICISAVKEKDIEAKLK V AEW++H+ HFG FKNRGELLLRGD+TSEI+++MEDSLMILSSLLSNRYN PFKK IQ  V  LSNS+EIIE WMTVQNLWVYLEAVFVGGDIAKQLP+EAKRFSNIDKSWI+IM RAHE  NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDN K VKFHEK Y+ IL+  S EGE ++LEKPVKAE NVE+WLM L+ MAQ+SLHGVIR A  +I D+ FN+LEFLNM+PAQVGLLGIQL+WTRD+ EAL NAK D+K+M  TN+ FL LLNLLI QTT +L KVERTKFETLITIHVHQ+DIFD L +  +KSP DF+WLKQTRFYF+ED D+ ++SITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKK F+FTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFI+NIVLARKFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KRANP DTEQT VMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE A+  +++E  ++ H PWVLK IQLFETQRVRHGMMTLGPSGAGKT CI+ LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT + KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+  CKIIFE HNIDNASPATVSRNGMVYMSSS +DW P+L GWL  R+  E  I++ LF +SFP+++R++ Q L++KM+T+EAFV+ QAC+LL+GLIP +++K +  +S+ HYE LY+F++MWSIGA LE +DR K+E ++R+N  I+LDLP ++   + TMFD++V ENG W HWN+KVE Y YP D+TPEYGSILVPNVDNVRT+FL++T++ QEKAVLLIGEQGTAKTVMIN Y+   NPE HM KSLNFSSAT P+MFQRT+ES+VDKRMGSTYGPPAG+KM+VFIDD+NMP+INEWGDQ+ANEIVRQL+E+KGFY+LEKPGDFT IVDMQF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS IG GHYC+ERGF++ VR+L+  L+P+TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGMINT+ +V+ + KT++ LWKHECCRVISDRF   +D +WFV T+ R + ED+ E   ++  + E + WF DF RDA EATG+EP+D DFDMPK+YEPI SF+ L++RL+ F   YNESIRGA MD+VFF DAMTHL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLAS+IAGYKIFQITLTRSYN+SNL+EDLK+LYRTAGQQG+GITF+FTDQEIKDEGFLEY+NNVLSSGVVSNLFARDEMDEI  ELIP+MKKE+PRRPP+N+NL +YFLSRT+ NLHVVLCFSP+GEKFR+RALKFPGLISGCTMDWFQRWPKDALIAVA H+LS F+I C P VKK+LI +MG  HDGVAE+CV+YFQR+RR THVTPKSYLSFL GYK+IY +K      L+QRM +GL+KL+EA E+V EL + L  KEKELAIA+ +AEEVLKTVT +  AA +VKN+VQ VKDKAQ+IV+ IE DK IAE KLEAA PAL EAE AL TIKPADIATVRKL  PPHLIMRIMDCVLI FQRR++ +  D +R   KPSWGES+K+M+    L  L+ FPKD+INEETVEL++PYL+MEDY ++ A++VCGNVAGL SWT+AM  FF INKEVLPLK NL  Q+ R   +M DLNAAQ+ LDEK+ EL +VQA+YD+A+R+KQ L+DDAE CRRKM+AA+ LI GL GEK+RWT Q+ EFKAQI RLVGD+L +TAFLSY GPFNQ+FR +L+ +WQKE +TRKIPF+ +LN+IDML  PT + EW+LQGLPND+LSVQNG+IVTKASRYPLL+DPQGQGK WIKNRE   ELQ+++LNHKYFRQHLED+LSLGRPL+IEDIGEELDPALDNVLEKNFIK G T KVKVGDKEVDVM GF LYITTKLPNPSYTPE+ A+TSIIDFTVTMKGLEDQLLG VI TEK ELE++R++LMEDV  NK+KMKELEDNLLFRLTST+GSLVDDEDLI VL TTK T+ +VSQKL IA++TE+KI +AREEYRPVATRGSILYFLI +MS+V+ MYQT+L+QFLGLFDLSM RS KSP+TQKRI NIIE MT+EVWKYA RGLYE  K+ FTL +ALK+DM+AGKIK EE+ TFIKGGA+LD+NVV PKP  WI D+TWLNLVELSNLHQFS +LDQVSRNEKQW+QWFDK+APEEEVIPDGYN +LD FRRLLLVR WCPDRTL  AKKYI D+LGEK+AEG ILD +K++EES PRTP++GLLSMGSDPT +IE LAKKHK+EC AISMGQGQE+H+R+L+   +  GGW LLQNCHLC+ Y+ EL  ++ E+ N++  +RLW+T+E H +FPI FLQI+IKF+NEPP+GI+A L+RS+A  TQD+LD   +  WK M Y +AFLH TVQERRKFGPLGWNIPYEFN +DFNA   F+QNHLD +  K+     G+ W  VRYM  EIQYGGRVTDD+D RLL    + +F + MF  +F       I     +D+Y  +I NLP  D P +FGLH NADI+Y TKT K IL+ ILSI PKDS  G GETRES+V++   +ML+K+P+++IPF+V  ++ KMGA QPMNIFLRQEIDR+ KVI  VR TLTDLKLAI+G ++M++ LRDALDC++DA+IP  W+KISWES+TLGFWF ELI+RNNQF  W  +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V+L N VTR+  +++ +PP EGVY+ GLFLEGASWD+R  +LIE KPK+LY+ +PVI+I+A+          D +MY+SPIYKKPRRT+LTYIA  EL  +++ +HWI+RGVA+LCD+K
Sbjct: 1174 QTSINSTKKEVNFTVMETNGQSNGCGLLSAIEYLLTTIFIPVLKRLEKGWGQLEGKTGDMVKADFMNHLDSFVSVLAGAQESLEDKVNLTPCEKYDLSKIQSPAEFQAIANSTEALEGIEETIAVWIKQIEQVLAESEQMRKEADDIGPRAELDHWKKRMSKFNYLLDQIKGPEVKAVLGVLQAAKSKTIKTWQELDRRITDAANEAKDNVKYLYTLDKFCDPLYNSDPVGMLEAIPGLINAIRMVHSISRYYNTSERMTSLFVKCTNQMITACKGYITCGGIETIWTQATDEVLKKLQDCIKLNDEYQRCFQRTKQKLETMPNERQFEFSEMYIFGKFDTFTRRLKKITEMFNTMEMYSHLAESKIEGMEIMANKFSVIVTSLKKKPYDYLDQRKMDFDQDFEDFKRQIQELHSGIIMFMDQRFEKITSTARALWMLRRFERLNLPNLGIPEKYAKILNKYGRDIESVSKSYQRDKTEPPIGRDLPPIAGKIAWARQLYRRIQEPMEVFQ-QHPTILQGPEAKRIIKNFNKLAKVLLEYEVLYHRGWIRQVEAAKSGLQASLIVRHPETQELYVNFDPQIITLIRETECMVRLGLEIPPAAKNLRAKQEQFKENYNMLTLMLAENKRVRDKIPASFEPLMTPHTNKVDDVIEPGLTTLTWTSMNIDLFVKDVYAALEELELLIDRANDLTEFRIDAILHEMSTTTLCEFPDEVPWTVDEFMQRTQQLCSAGALTLNSKSINVEDAANELINMLCDFGPEESEAEPEEDEDKDENGEKGSRAGSPTPSRSSQTGSRQGSQRPISQGAKKHRNKKKEMRESMEETAMELLSHFNHRNLDSLLKVTRNTLESLRKRIISSSTVSYIDLGDSTKSRPFFKTDAVLAIPNIVMQPALDEVQQTVNKVALTILSVSKGVAQWSKERRKTVKKTERSGSFSEHHND-------------RRSSIGSIAASEVSHVGAGGRRGSRGRLEAGESM---------TSLTVQQQPKNYYKQVSENKEVAKMVGLLQTSINSTKKEITTALDTFKHYHVIWEKDMEEDLKEFMKQEPKLSEFEAKILHYNELEAMVNAEPDFYDVGAIALYTEKLKLGLTTETKAWRIHYGKACNHKYATEMQEIFDFIEETTKRLSRPIKDLDDIRFVMAGLKEIREKEIRLDMNIGPIEESYAMLVKHELPVEREEMERVDTLRYSWERMNAQAVEMSHYLVKIQPDFRSELIDNVQVFAEDCKDFYGDYATAGPMVAGVPPREASERLLIFQNRFDTLFRKYTTYTGGEELFGLPVTPYPELLQIKKELNLLQKLYGLYNAVIETVNSYYDILWQEVNIEKINTELLDFQNKCRKLPRALKEWPAFEDLRKTIDDFNEMVPLLELMTNKAMKPRHWQRMAELTGHVFDVENENFTLRNILEAPLLKYKEEIEDICISAVKEKDIEAKLKQVIAEWNSHDFHFGNFKNRGELLLRGDNTSEIVALMEDSLMILSSLLSNRYNAPFKKQIQTWVQNLSNSTEIIENWMTVQNLWVYLEAVFVGGDIAKQLPQEAKRFSNIDKSWIRIMQRAHETPNVIQCCVGDETLMQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNTKLVKFHEKNYDQILSIVSSEGETVDLEKPVKAEGNVEVWLMALMLMAQKSLHGVIRTAAMAIQDSGFNLLEFLNMFPAQVGLLGIQLIWTRDADEALKNAKYDKKVMAGTNQAFLELLNLLIAQTTRELTKVERTKFETLITIHVHQRDIFDDLCRMHIKSPQDFEWLKQTRFYFIEDQDKTLISITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVDMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIENIVLARKFYILYKLCEEQLTKQVHYDFGLRNILSVLRTLGTNKRANPNDTEQTIVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPELENALKIRVEEVGLVYHAPWVLKCIQLFETQRVRHGMMTLGPSGAGKTKCIYSLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHRAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMATLCKIIFEPHNIDNASPATVSRNGMVYMSSSGMDWNPILSGWLNTRSVGESSILMSLFESSFPEVWRFATQNLVFKMDTMEAFVINQACNLLQGLIPNREDKQT--LSKEHYEHLYVFTLMWSIGAYLEWDDRAKMEEFLRNNEEIRLDLPNLDGFPDSTMFDFLVEENGTWSHWNTKVEPYHYPPDTTPEYGSILVPNVDNVRTEFLIHTISKQEKAVLLIGEQGTAKTVMINGYMGKYNPEEHMAKSLNFSSATTPYMFQRTVESYVDKRMGSTYGPPAGKKMSVFIDDVNMPIINEWGDQVANEIVRQLMEMKGFYSLEKPGDFTTIVDMQFLAAMIHPGGGRNDIPQRLKRQFTIFNCTLPSNPSIDKIFSCIGEGHYCQERGFSEAVRKLIARLVPVTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMINTEFEVVKDEKTVMALWKHECCRVISDRFTSYDDYTWFVSTVSRVVREDIGE---AKVPMVELEPWFGDFFRDAPEATGDEPEDADFDMPKIYEPIPSFEALEERLRFFMAQYNESIRGANMDLVFFRDAMTHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASFIAGYKIFQITLTRSYNVSNLMEDLKYLYRTAGQQGQGITFIFTDQEIKDEGFLEYLNNVLSSGVVSNLFARDEMDEITMELIPVMKKEFPRRPPSNENLYDYFLSRTRANLHVVLCFSPVGEKFRSRALKFPGLISGCTMDWFQRWPKDALIAVADHFLSKFDIECTPEVKKQLIQAMGTFHDGVAESCVEYFQRYRRSTHVTPKSYLSFLAGYKTIYSDKRGEIGELSQRMQTGLEKLVEASEAVGELSKELEVKEKELAIASAKAEEVLKTVTSKAQAAEKVKNQVQKVKDKAQAIVDSIEADKAIAEGKLEAARPALEEAEAALKTIKPADIATVRKLLNPPHLIMRIMDCVLILFQRRVNPVEVDKDRPCVKPSWGESLKMMAGGGLLTQLVEFPKDSINEETVELLAPYLDMEDYNLETAKKVCGNVAGLCSWTQAMAYFFTINKEVLPLKANLVVQEARLNVAMTDLNAAQAQLDEKEAELREVQAMYDKAMREKQALIDDAENCRRKMSAASALITGLGGEKVRWTEQNKEFKAQIGRLVGDILMSTAFLSYSGPFNQDFRQLLSKNWQKECKTRKIPFTANLNVIDMLVLPTTIAEWNLQGLPNDDLSVQNGLIVTKASRYPLLVDPQGQGKNWIKNREGGNELQISNLNHKYFRQHLEDALSLGRPLIIEDIGEELDPALDNVLEKNFIKSGKTLKVKVGDKEVDVMDGFTLYITTKLPNPSYTPEVSAKTSIIDFTVTMKGLEDQLLGRVILTEKAELESERVKLMEDVTANKRKMKELEDNLLFRLTSTQGSLVDDEDLINVLHTTKATAQDVSQKLQIAAETEVKITAAREEYRPVATRGSILYFLITDMSMVSCMYQTALKQFLGLFDLSMERSMKSPITQKRISNIIEYMTFEVWKYAARGLYEEHKLMFTLQLALKIDMQAGKIKHEEYQTFIKGGAALDLNVVTPKPCRWILDLTWLNLVELSNLHQFSGILDQVSRNEKQWKQWFDKDAPEEEVIPDGYNNSLDVFRRLLLVRSWCPDRTLPMAKKYIADTLGEKYAEGVILDVEKMWEESDPRTPLIGLLSMGSDPTNSIEALAKKHKLECGAISMGQGQEVHARKLLTKLMSQGGWALLQNCHLCLVYVMELLDLMTETENIHEDFRLWVTTEVHPKFPIGFLQISIKFSNEPPQGIKAGLKRSYAGFTQDFLDVSNMPQWKPMLYGVAFLHTTVQERRKFGPLGWNIPYEFNTSDFNASVQFVQNHLDDMDIKR-----GVSWNTVRYMFGEIQYGGRVTDDYDKRLLNTFCRVWFGDHMFGANFNFYKGYTIPKCTKLDDYMTFIQNLPLADTPEAFGLHPNADITYQTKTAKNILDCILSIMPKDSGGGSGETRESVVFRLSDDMLEKLPNDYIPFEVKARLQKMGALQPMNIFLRQEIDRMQKVITTVRTTLTDLKLAIEGTIIMSESLRDALDCMYDARIPAAWKKISWESSTLGFWFTELIERNNQFSNWCFEGRPNTFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVVLHNDVTRYMKDDINQPPAEGVYVQGLFLEGASWDRRGCKLIEPKPKVLYEPMPVIHIYAI----NSTGGHDPRMYLSPIYKKPRRTDLTYIAEVELKTTQNPDHWILRGVALLCDVK 5676          

HSP 2 Score: 1142.1 bits (2953), Expect = 0.000e+0
Identity = 610/1201 (50.79%), Postives = 816/1201 (67.94%), Query Frame = 3
Query:  129 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKE----------------TG--DQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVI--NGSN---GVLQGLEEYMSRVMLPHFRNLKGGWGQLE-KDEDSRRA-MMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLC--GXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAH----TGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY-DISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSH 3635
            +R+ GL   EN+  KQ ++KEER A+R++LD+RH Y+L  VAD   LE  EVE++IL+G QIE+MD FF +D TN L F +QEP+LEK+                +G  D +R+G  G    +  KPKVF+   K  PL G C+ F+R      I E  I ++VNF V+  NG +   G+L  +E  ++ + +P  + L+ GWGQLE K  D  +A  MN L++FV VL+ A+ES+ ++V L  C + DL +I+ P +   I N+TE L  +E  + +W+KQIEQVLAES+Q+R+EAD+IGPRAELD+WKKRM+KFNYLLDQ+K PEVKA +G+LQAAKSKT+KTW E+DRRITDAANEAKDNVK+LYTL++ C PLY ++P  M++ IP LI+++RM+HSIS+YYNTSE+MTSLFVK TNQMIT+CK YI+    ET+WT   +E++K+L  C +LN  YQ CFQ TK +L   P+ERQFE SEMYIFGKFDTF RRL  I ++F  ++ YS L ++ IEG+E M  KF+VIV+++KKK Y++LDQR+ +F QDF+DF RQIQELH+ I+ FMD  F+ ITST RA+  LRRFERLN+P+LGI EKY KIL  YGRD+E+V K Y R+K +PP+ RD+P IAGKIAWARQL+RRIQ PME+F+ QH  +L+ PEAK IIKN+NKLA+ L+ +E++YH+ W+RQ+ +  +GL +SLI+RHPET+ELYVNFDP I+ L RET+ M++L LEIPPAA NL+ KQ   KE +N L LM+   ++V + IP  +E LM     K+  +IEPGLTT  WTSM +  ++  VY  L ELELL+DRA DL ++RID +L EMST  LCE P++VP TVDEF+  TQ+LC   A  L SKS NVED+ NELINMLC  G EE     E  E+   + ++   +   +PS+ S+T   Q +      G    + K KE++ S+ E A ELL HFNHRNL++++KV RNTLESLRKRI + + V+Y D+   + ++PFF+ +A L IPNIVM P ++EVQ TVN+ A  I+SVSKG++QWSKER+   +    +   +E   D             RR S  S A S    +   G     G+   G +           +L    Q KN YK V+ENKEVAK+  LL T INST+KEV   +M  +  S+
Sbjct:   19 SRLAGLAPGENIALKQQRLKEEREARRAKLDDRHYYMLVTVADRLGLERNEVEDAILEGKQIEMMDDFFCADGTNHLTFFYQEPDLEKDGVTVDFQLPKEESRRKSGAIDHMRLGPPGQPTKKASKPKVFVADAKSTPLHGTCLFFIRVDPKKAITEANIVQEVNFTVMETNGQSNGCGLLSAIEYLLTTIFIPVLKRLEKGWGQLEGKTGDMVKADFMNHLDSFVSVLAGAQESLEDKVNLTPCEKYDLSKIQSPAEFQAIANSTEALEGIEETIAVWIKQIEQVLAESEQMRKEADDIGPRAELDHWKKRMSKFNYLLDQIKGPEVKAVLGVLQAAKSKTIKTWQELDRRITDAANEAKDNVKYLYTLDKFCDPLYNSDPVGMLEAIPGLINAIRMVHSISRYYNTSERMTSLFVKCTNQMITACKGYITCGGIETIWTQATDEVLKKLQDCIKLNDEYQRCFQRTKQKLETMPNERQFEFSEMYIFGKFDTFTRRLKKITEMFNTMEMYSHLAESKIEGMEIMANKFSVIVTSLKKKPYDYLDQRKMDFDQDFEDFKRQIQELHSGIIMFMDQRFEKITSTARALWMLRRFERLNLPNLGIPEKYAKILNKYGRDIESVSKSYQRDKTEPPIGRDLPPIAGKIAWARQLYRRIQEPMEVFQ-QHPTILQGPEAKRIIKNFNKLAKVLLEYEVLYHRGWIRQVEAAKSGLQASLIVRHPETQELYVNFDPQIITLIRETECMVRLGLEIPPAAKNLRAKQEQFKENYNMLTLMLAENKRVRDKIPASFEPLMTPHTNKVDDVIEPGLTTLTWTSMNIDLFVKDVYAALEELELLIDRANDLTEFRIDAILHEMSTTTLCEFPDEVPWTVDEFMQRTQQLCSAGALTLNSKSINVEDAANELINMLCDFGPEESEAEPEEDEDKDENGEKGSRAGSPTPSRSSQTGSRQGSQRPISQGAKKHRNKKKEMRESMEETAMELLSHFNHRNLDSLLKVTRNTLESLRKRIISSSTVSYIDLGDSTKSRPFFKTDAVLAIPNIVMQPALDEVQQTVNKVALTILSVSKGVAQWSKERRKTVKKTERSGSFSEHHND-------------RRSSIGSIAASEVSHVGAGGRRGSRGRLEAGES---------MTSLTVQQQPKNYYKQVSENKEVAKMVGLLQTSINSTKKEVNFTVMETNGQSN 1196          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: V3ZZA4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_192667 PE=4 SV=1)

HSP 1 Score: 6285.29 bits (16305), Expect = 0.000e+0
Identity = 3116/4632 (67.27%), Postives = 3744/4632 (80.83%), Query Frame = 3
Query:  321 MDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQ-GTQINENTIAKDVNFIVIN----GSNG--VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIR--HPET--KELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVI--------STQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY---DISV---KSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKT-AKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPER-NSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYT-EELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVC----SKSAEHWIMRGVAMLCDIK 14111
            MDKF   +    L F++QEPE EKE  D +R+G    K  +  KPKVFI +G + PL+G  ++F + +Q G  I +  I K+VNF  ++    G+NG  +L+ +E+ +SR+ +P  + +  GWGQL         R   +NSL++FV VL  A+ES+ ++V LK C   DL +I  P D M + N+TE L  +E C+ +W+KQIEQVLAES+Q+RREAD+IGPRAELD+WKKRM+KFNYL+DQ+K  +VKA +G+L AAKSK +KTW E+DRRITD ANEAKDNVKFLYTLE+ C PLY ++P  M+D IP LI+++RMIHSISQYYNTSE+MTSLFVKITNQMIT+CKAYI+ND +ETVW+   + + K+L  C  LN  YQ CF +TK +L   P+ER F+ SEMYIFGKFDTF RRL  II++F+ ++ YS L ++ IE +E+   KFNVIV+ +KKK Y++LDQR+ EF QDF+DF RQIQ+LH+NIL FMD  F+ I+ST RA+  LR+FERLN+P+LGI +KY +IL+HYG+D+E V + Y +NK DPPVARD+P IAGKIAWARQLFRRIQ PME+F+ +H  +L+T EAK IIKN+NKLA+ L+ FE++YH+ W+RQ+ +  +GL +SL+++  HPE+  KEL++NFDP IL + RETD M +L L+IPP AI ++ KQ   K+ +N L +M++  Q+V   IP  +E LM   +A +   IEPG+TT NW S+ + +YI +VY  LA+LELL+DRA D+ ++RID +L+EM++ +LCELP D P TV++F+ NTQ LC K A++LQ+KSQ VE++ NELINML   E +    +  EE+          + +E   S   + S+ S  P+   A +      KK +E++ ++ E+A ELL+HFN+RNL+A+++  R TLESLRKRI + +M  Y   D S    K  ++PFFR +A L IPNIVM P ++EVQ  +N+T   IISVSKG+SQWSKERK  AK    +A  S            + E    RR S +S        +   G+ R  G+ T             + +L    Q KN +K+V++NKE+AK+ SLLST INST+KE+ TA+ +FS Y  +WAK +D  LEEF+KDDPK+SEF+  I  Y  LE QI +E +YYD G IAL+TE LK+GL +ET+AWR+ YGKAC+ KY+ EME+IF F ED+ KRL+R IKDLDDIR +M ALKEIRENEIRIDM++ PIEESYA++ +++LPV K++ E+ DT+RY+W+KL ++ S VQ +L+ IQP FR NLIENV+IF +DCD FY+DYD +GPMVPG+ PREASDRLI+ QN++D L R++ TY+GGEELFGL VT+Y +L  I+KELNLLQKLY LYNDVI++V+GYYDILW +V+IEKI+ EL +FQ RCRKLPK LKDWPAF+DL+KTIDDFN MVPLLELM N AMK RHWQRMSDLTSH FD+ES+ F LRNILEAPLLK+KEEIEDICISAVKEKDIEAKLK V A+WS+ E  FG+FK RGELLLRGD TSEI+SIMEDSLM+LSSLLSNRYN PFKK+IQ  V  L+NSSEIIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM++AHE   V+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDPHTIQ+HLLS+FDN K VKFH+K  + IL+  S E E +ELEK VKAE NVE+WLM LL M+Q+S+HGVIR A  +I D+ FN+LEFLNM+PAQ+GLLGIQ++WTRDSTEAL N K D+KIM QTN+ FL LLN LI QTT +L K +RTKFETLITIHVHQ+DIFD+L +  +KSP DF+WLKQ+RFYF+ED D+C++SITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VLS KKERKK F+FTDGD V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLA+CGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR NPTDTEQT VMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE AI   + +A +I+HP W LKL+QLFETQRVRHGMM LGPSGAGKT CIH+LMKA++D GEPH+E RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT + KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMVYMSSS L W P+LKGWLL R S E  I+LELF  SFP I RY++Q L++KM+ LEAF++ QA  L+ GLIP KDEK+    S+ HYERLYIF+VMWS+GA LE++DR KLE +IR N + KLDLP I   S+ T+FDY V  +G W+HWN KV++Y YP D TPEY +ILVPNVDNVRT+FL++T+  QEKAVLLIGEQGTAKTVMI  Y++  NPE H+ +S+NFSSAT P +FQRTIES+VDKR+G+TYGPPAG+KMTVFIDDINMPVINEWGDQIANEIVRQL+E  GFYNLEKPGD  N+VDMQF AAMI PGGGRNDIPQRLKRQF IFNCTLPSNSSIDKIFS+IG GH+C ERGF + VR LV+ L+P+TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGM+NT+  VIT+ + L+GLWKHECCRVI+DRFV  ED +W  KTLKR ++EDL ED +    +     +F DF+RDA EATG+EPDD DFDMPKVYEPI S DQLK+RL MF   YN+SIRGAGMD+VFF DAM HLLK+SRIIRTPRG+ALLVGVGGSGKQ+LT+LAS+IAGYK FQITLTRSYN+SNLLEDLK+LYRTAGQQGKGITF+FTDQEIKDEGFLEY+NN+LSSGVV+NLFARDEMDEI  EL+PIMKKE+PRRPP+N+NL EY+LSR + NLH+ LCFSP+GEKFR RALKFPGLISGCTMDWFQRWPKDALIAVA H+LS FEIVC+  VK ++I SMG +HDGVAENC DYFQR+RR THVTPKSYLSF+ GYK+IY  K      LA+RM++GL KLIEA E+VAELK  LAEKEKELAIA+ +AE+VLK VTV+  AA +VKN+VQ VKDKAQ+IV+ I+RDK++AE KLEAA PAL EAE ALNTIKPADIATVRKLGRPPHLIMRIMDCVL+ FQ ++  +  D ++    KPSWGES+KLM+   FL  L+ FPKD+IN+ETVE ++PY + EDYT++ A+RVCGNVAGL +WT+AM  FFEINKEVLPLK NL  QQ +   +M DLNAAQ  LD K+KEL  V+A Y++A+ +KQ L++DAETCRRKM AA+ LI+GLAGEK RWT QS EFKAQI RLVGDVL  TAFLSY GPFNQ+FR +LN +W KEL+TRKIP+S +LN+  MLTDPT +GEW+LQGLP+DELS+QNGIIVTKA+RYPLLIDPQGQGK WIKNRE + E+Q+TSLNHKYFRQHLEDS+SLGRPL+IED+GEELDPALDNVLEKNFIK GST KVKVGDKE D+MKGF LYITTKLPNPSYTPEI A TSIIDFTVTMKGLEDQLLG VI TEK ELE++R+ LME+V  NK+KMKELEDNLLFRLTST+GSLVDDEDLI VL  TKVT+ +VSQKL  A++TEIKIN+AREE+RPVATRGSILYFLI EMSLVN+MYQTSLRQFLGLFD S++RS KSP+TQKRI NIIE MTYEV++YAVRGLYE DK+TFTLL+ALK+D++AGKIK EEF T IKGGASLD+NVV PKP  WI D+TWLNLVELSNLHQFS +LDQVSRNEK W+QWFDK++PEEE+IPDGYN +LD FRRLLLVR WCPDRTL QAKKYI D+LG+K+AEG ILD +K+++ES  R P+V LLSMGSDPT +IE LAKKH++EC+AISMGQGQE+H+RRL +  +  GGW+LLQNCHL +D++ E+   I E+ +++  +RLW+T+E+H +FPI+FLQ+AIKFTNEPP+GI+A L+R++ ++TQD+LD   +  WK M Y++ FLH  VQERRKFGPLGWNIPYEFN AD+NA   F+QNHLD +  K+     G+ W CVRYM+ EIQYGGRVTDDFD RLL      +F E MF  +F  +    I     + EY  +I++LP  D+P  FGLH NADI+Y + T K  L+TILSIQPKDS  G GETRESIV +   +MLDK+P +++PF+V+  + KMG +QP+NIFLRQEIDR+ +VI  VR TL DLKLAI+G ++M++ LRDALD ++DA+IP  W K+SW+S+TLGFWF ELIDRN QF  W  DGRP+ FW+TGFFNPQGFLTAMRQEVTR+H GWA DSVIL N VT++   E++  PP EGVY+YGLFLEGA WDKRN +L E +PK L+D++P+I+I A+        +  T MY+ PIYKKPRRT+LTYIA+  L C    S+S  HWIMRGVA+LCDIK
Sbjct:    1 MDKFMGENGMKRLMFYYQEPEAEKE-HDHVRLGPPTTKVVKSTKPKVFIAEGSDIPLRGIGLIFTKCTQTGVAITDINITKEVNFTRLDANTEGANGRGLLKAVEDILSRIFIPALKKIDNGWGQLNDKRAGNQVRTDFLNSLDSFVSVLVGAQESLQQKVELKPCEGYDLNKIHTPNDYMTVANSTESLESIEACMRVWIKQIEQVLAESEQMRREADDIGPRAELDHWKKRMSKFNYLVDQIKGHDVKAVLGVLMAAKSKMIKTWQELDRRITDTANEAKDNVKFLYTLEKFCDPLYNSDPVGMLDGIPGLINAIRMIHSISQYYNTSERMTSLFVKITNQMITACKAYITNDRSETVWSQPIDIVKKKLNDCIRLNAEYQDCFHKTKAKLEKMPNERPFDFSEMYIFGKFDTFTRRLKKIIEMFDTMEMYSHLAESKIEDMETQASKFNVIVTAMKKKPYDYLDQRKMEFDQDFEDFKRQIQQLHSNILQFMDNRFEKISSTQRALMLLRKFERLNLPNLGISDKYQRILSHYGKDIENVSRLYQKNKTDPPVARDLPPIAGKIAWARQLFRRIQEPMEVFQ-EHPQILQTNEAKKIIKNFNKLAKVLLEFEVLYHRGWIRQVEAIKSGLQASLLVQVVHPESTSKELFLNFDPQILSMIRETDCMGRLGLDIPPMAIKMRAKQAEYKDHYNALQMMLDENQRVRAKIPVAFESLMGQHLAHVDEAIEPGITTLNWMSLGIDDYIKNVYAALADLELLMDRAHDVTEFRIDAILKEMASTKLCELPEDEPWTVEKFLENTQMLCAKGAQILQTKSQTVEEAANELINMLVNSEPEAVEGDESEEEEGRQFFRTKQTGEETERSKSAAGSRQSARPLSSKALS----VAKKKREMRENLEESAMELLIHFNNRNLDALLRATRYTLESLRKRITSSSMAHYIGMDTSYGDSKKDSRPFFRTSAVLAIPNIVMQPALDEVQQALNKTVQTIISVSKGVSQWSKERKRRAKPQLLDASMSG-----------VGEYSFERRASAIS--------MMSEGSKRLEGEAT-------------ATSLTIQQQNKNYFKSVSDNKEIAKLASLLSTSINSTKKEITTALEKFSHYHSIWAKDRDDELEEFMKDDPKLSEFEAKIHHYNELEKQIMSEPEYYDVGAIALYTEKLKLGLTTETRAWRLHYGKACDNKYQNEMEEIFNFIEDMTKRLNRPIKDLDDIRFSMQALKEIRENEIRIDMSLAPIEESYALMNKHDLPVVKEDAEKCDTMRYSWEKLNAQASTVQSHLLEIQPNFRGNLIENVKIFIEDCDNFYDDYDKNGPMVPGVEPREASDRLIVFQNQFDTLYRKYQTYTGGEELFGLPVTEYPQLHTIRKELNLLQKLYGLYNDVIDTVHGYYDILWQEVNIEKITQELQDFQTRCRKLPKALKDWPAFDDLKKTIDDFNEMVPLLELMANKAMKNRHWQRMSDLTSHVFDIESEAFTLRNILEAPLLKYKEEIEDICISAVKEKDIEAKLKQVIADWSSKEFTFGSFKTRGELLLRGDTTSEIVSIMEDSLMVLSSLLSNRYNAPFKKNIQQWVQNLTNSSEIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTKAHETPQVVQCCVGDETLMQLLPHLLEQLELCQKSLTGYLEKKRLSFPRFFFVSDPALLEILGQASDPHTIQAHLLSIFDNTKRVKFHDKFVDNILSIISSEEEVIELEKHVKAEGNVEVWLMSLLQMSQKSVHGVIRTAAMAIQDSSFNLLEFLNMFPAQIGLLGIQMIWTRDSTEALTNVKYDKKIMAQTNQAFLDLLNKLIAQTTQELSKRDRTKFETLITIHVHQRDIFDELCRRNIKSPMDFEWLKQSRFYFIEDQDKCLISITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLSSKKERKKNFIFTDGDNVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLAACGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGANKRLNPTDTEQTIVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPELEKAIADNVADAKLINHPAWSLKLVQLFETQRVRHGMMALGPSGAGKTCCIHMLMKAMSDIGEPHKEWRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTTRVKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVYMSSSGLHWEPILKGWLLSRPSFETNIILELFQTSFPAILRYAVQNLVFKMDVLEAFIIAQATKLMSGLIPVKDEKEG-HYSQEHYERLYIFTVMWSVGAFLELDDRAKLEEFIRKNEDFKLDLPDIPSGSDATIFDYCVDADGNWIHWNQKVKDYTYPSDYTPEYCNILVPNVDNVRTEFLIHTICKQEKAVLLIGEQGTAKTVMITNYMNQYNPEEHLAQSVNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGKKMTVFIDDINMPVINEWGDQIANEIVRQLMETHGFYNLEKPGDIINLVDMQFCAAMIQPGGGRNDIPQRLKRQFAIFNCTLPSNSSIDKIFSVIGCGHFCAERGFTENVRNLVKQLVPVTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLNTESSVITSPELLMGLWKHECCRVIADRFVNPEDTAWIDKTLKRIVAEDLGEDHLD---LVNPTLYFSDFLRDAPEATGDEPDDADFDMPKVYEPIESLDQLKERLSMFLQQYNDSIRGAGMDLVFFNDAMIHLLKVSRIIRTPRGHALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNVSNLLEDLKYLYRTAGQQGKGITFIFTDQEIKDEGFLEYLNNMLSSGVVANLFARDEMDEILGELVPIMKKEFPRRPPSNENLYEYYLSRVRNNLHISLCFSPVGEKFRQRALKFPGLISGCTMDWFQRWPKDALIAVAHHFLSEFEIVCSEEVKLQIIHSMGTIHDGVAENCTDYFQRYRRSTHVTPKSYLSFINGYKTIYANKKMEIGELAERMNTGLSKLIEASEAVAELKVELAEKEKELAIASEKAEKVLKEVTVKAQAAEKVKNQVQKVKDKAQAIVDMIDRDKEVAERKLEAARPALEEAEAALNTIKPADIATVRKLGRPPHLIMRIMDCVLLLFQNKVLPVTVDADKPEYIKPSWGESLKLMAGTNFLQALVTFPKDSINDETVEFLAPYFDSEDYTLETAKRVCGNVAGLAAWTKAMSYFFEINKEVLPLKANLIVQQSKLNSAMADLNAAQETLDAKEKELAVVRAEYEKAMSEKQALVEDAETCRRKMNAASALIDGLAGEKERWTEQSREFKAQIGRLVGDVLICTAFLSYSGPFNQDFRILLNKNWMKELKTRKIPYSANLNVTTMLTDPTTIGEWNLQGLPSDELSIQNGIIVTKAARYPLLIDPQGQGKSWIKNREGKNEMQITSLNHKYFRQHLEDSMSLGRPLVIEDVGEELDPALDNVLEKNFIKVGSTLKVKVGDKECDIMKGFTLYITTKLPNPSYTPEISAGTSIIDFTVTMKGLEDQLLGRVILTEKAELESERVNLMEEVTSNKRKMKELEDNLLFRLTSTQGSLVDDEDLINVLNITKVTADDVSQKLKNAAETEIKINTAREEFRPVATRGSILYFLITEMSLVNVMYQTSLRQFLGLFDRSLARSIKSPITQKRILNIIEFMTYEVYRYAVRGLYEKDKLTFTLLLALKIDLQAGKIKHEEFMTLIKGGASLDLNVVTPKPHKWIVDLTWLNLVELSNLHQFSGILDQVSRNEKLWKQWFDKDSPEEEIIPDGYNNSLDVFRRLLLVRSWCPDRTLPQAKKYIADTLGDKYAEGVILDTEKMWQESDNRNPLVCLLSMGSDPTTSIEALAKKHRIECKAISMGQGQEVHARRLTSFGVQNGGWLLLQNCHLSLDFVVEVMDTIIETESIHDEFRLWVTTEEHLKFPISFLQMAIKFTNEPPQGIKAGLKRTYTNITQDFLDISNMPQWKPMLYAVGFLHTIVQERRKFGPLGWNIPYEFNTADYNASVQFVQNHLDDMDIKR-----GVTWTCVRYMLGEIQYGGRVTDDFDKRLLNTFCTEWFDEKMFNSNFSFSKGYVIPKCQKIAEYHEFINDLPNNDSPEVFGLHGNADITYQSNTAKTSLDTILSIQPKDSSSGGGETRESIVSRLADDMLDKLPPDYVPFEVSNALKKMGEYQPINIFLRQEIDRMQRVISLVRTTLQDLKLAIEGTIIMSENLRDALDSMYDARIPKSWSKVSWDSSTLGFWFTELIDRNQQFHTWCFDGRPLSFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVILSNDVTKYQNKEDIPAPPTEGVYVYGLFLEGAGWDKRNNKLCEPRPKQLFDNMPIIHITAVNSTGGPTYDVRT-MYVCPIYKKPRRTDLTYIADVTLKCAQSQSQSPAHWIMRGVALLCDIK 4584          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4907.04 bits (12727), Expect = 0.000e+0
Identity = 2406/3560 (67.58%), Postives = 2882/3560 (80.96%), Query Frame = 3
Query: 3441 GSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSE---DIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            GS S  +    +SA+    +Q KN YK+V+ENKE+ K+ S+LST INS++K ++ A+ RFS Y H+W K +++T++EF + +P ++EF+  I  Y  LE +INAE ++   G +AL+T  LK+ L +ETK W + +G  C  KY+ EME++FTF ++  K+L+R IKDLDDIRIAM ALKEIRE++I ID  + PIEESYAML +YEL V K+E E+VDTLRYTW+KL++R S+VQ+ L+++QP FR  LI NVQ F +DCD FY++YD  GPMV GL P++ASDRLI+ QNR+DNL R+F+T++GGEELFGL VT + +L +I+K+L LLQKLY LYN+VI +VNGYYD+LW DV IE+I+NEL +FQ RCRKLP+ LK+W AF DL+KTIDDF+   PLLELM N AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD TSEIIS MEDSLM+L SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V FH+K                                        R ++ V+ +     +   F V+       AQVGLLGIQ++WT+DS EAL NA+ DRKIM +T + FL LLN LI  TT DLG +ERTK+ETLITIHVHQKDIFD L    ++SPSDF+WLKQ RFYF+ED+DR +++ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  KD+    ++SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQL+E KGF+NLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IGTGHYC +RGF ++VR++V  L+P+TRRLW +TK KMLPTPA FHY+FNLRDLSRIWQGM+N   DVI   K LL LWKHEC RVI+DRF   ED++WF   L   + E+L E   D+V      E DA+F+DF++DA EATGEEP++ DFDMPKVYEPIASF  L+DRL MF GLYNESIRGAGMD+VFFTDAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY IFQITLTRSYN +NL+EDLK LYRTAGQQGKGI+F+ TD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  +LIP+MK+E+PRRPPTN+NL EYF+SR +QNLHVVLCFSP           FP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P VK E++  MG   DGVAE CVDYFQR+RR THVTP SYLSF+ GYK+IYKEK  H  ++   M++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+ +AA +VK +VQ VKDKAQ+IV+ I  DK IA+ KLEAA+PAL EAE AL TIKP+DIATVR L RPPHLIMRIMDCVL+ FQRRL+ +  D E+N   PSW ES+KLM+   FL +L  FPKDTINEE VEL++PY +M DY I+ A+RVCGNVAGL SWT+AM +FF IN+EVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQ LL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN+L + WQKE+R R IPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+R+PLLIDPQ QGKIWI+N+EA+ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVTM+GLEDQLLG VI TEKQELE  R+ L+EDV  NK+KMKELED+LL+RLTSTKGSLVDDE LI VL  TK TS EV+QKL IA++TE+KIN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV  YA RGLYE  K  FTLL+ LK+DM++ +IK EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+ R+EKQWR WFDKEAPEEEVIP+ Y+ +LD F+RLLL+R WCPDRT++QA+KYI DS+GE++AEG ILD ++ +EES PRTP++ LLSMGSDPT  I  L K+ KVE   +SMGQGQE+H+R+L+  F+  GGW LLQNCHL +D+++EL   + E+ +++  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + Q+ LD   ++ W+ M YS+AFLH TVQERRK+GPLGW+IPYEFNQADFNA   F+QNHLD +  K+     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I    +VD+Y  YI  LP  D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++ PF+V +++  MG  +PMNIFLRQEIDR+ +V+  VR TLTDLKLAIDG +VM++ LRDALDC++DA+IP  W+K SW S+TLGFWF EL++RN QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D ++L N VTR+  +++ +PP+EGVY+YGL+LEGA WD+RN RL+++KPK+L++ +PV+ ++A     +    +D+++Y  PIYKKP RT+   IA  +L  S+  E+WI+RGVA+LCD+K
Sbjct:  687 GSTSDIS----VSAHQVLPFQAKNYYKSVSENKEIVKLVSVLSTSINSSKK-MKNALERFSRYHHIWRKDRESTIQEFSQGNPLLAEFESQILYYKDLELEINAEPEFITVGALALYTADLKLALTAETKGWMLDFGHHCKRKYRTEMEQVFTFVDEASKKLNRPIKDLDDIRIAMAALKEIREHQITIDFQVGPIEESYAMLNKYELSVAKEEMEKVDTLRYTWEKLLARSSEVQNELVSLQPNFRGELISNVQTFVEDCDHFYQEYDKDGPMVMGLAPQDASDRLIMFQNRFDNLYRKFVTFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIETVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVFHDKT---------------------------------------RRVNHVLISKQVKHHCILFKVMFKFVFLLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPKDQ--GGELSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKP----EVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEK--HLESVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKR-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKDSRLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGVALLCDVK 4173          

HSP 2 Score: 610.912 bits (1574), Expect = 1.704e-174
Identity = 312/653 (47.78%), Postives = 435/653 (66.62%), Query Frame = 3
Query:  594 GVLQGLEEYMSRVMLPHFRNLKGGWGQLE--KDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLA 2546
            G+L+  E+ +S V +P  RN+  GWG+L   + +  ++  ++SLE+FV VL+ A+ES+ E    KV                 I + + QL +  H V       EQVLAESDQ+R+E D++GPRAELD+WKKRM++FNYLLDQLK P+VK+ +G+L  AKSK +KTW E+D RITD+ANEAKDNVK+LYTLE    PLY +NP  M++ I  LI+++RMIHSIS+YYNTSEK+TSLFVK+TNQMIT+CKAYI+N+ + T+W    + + +++     LN+ YQ CF +TK +L   P ERQF+ SEMYIFGKFDTF RRL+ I+ +F  I TYS L D+ IEGLE+M  +   IV T+KKK Y+FLDQRRT+F QD+++F +Q  EL                              L+IPDLGIEEKY K   +Y RD+E V + Y++ K +PP+ R++P +AGKI W+RQL+ RI+ PM++F+ QH N+L TPEAK II+NYN++A+TL+ +E+IYH+ W+ Q+     GL +SL++R P+T+ELYVNFDP IL   RETD + ++ LEIPP A  L+ KQN LK  +N L + +  IQ         +EQ++   +AK+   I PGLT+ NW+S+ + +++  V   L 
Sbjct:    8 GLLKSTEQLLSEVFIPTLRNMNHGWGELASPQAQTVKQDFISSLESFVSVLAGAQESLEE----KVTHLNTHHTHTHAHLHTYIRSISIQLCEF-HGVA------EQVLAESDQLRKEGDDLGPRAELDHWKKRMSRFNYLLDQLKSPDVKSVLGVLLMAKSKLIKTWRELDIRITDSANEAKDNVKYLYTLERFFDPLYNSNPVSMVEAIAGLINAIRMIHSISRYYNTSEKITSLFVKVTNQMITACKAYITNNGSATIWDQPQDVVAEKIRAAIRLNEEYQKCFHKTKQKLEQSPSERQFDFSEMYIFGKFDTFQRRLNKILTMFSTISTYSALQDSKIEGLETMATRLQNIVVTMKKKPYSFLDQRRTDFDQDYEEFCKQTTEL------------------------------LSIPDLGIEEKYQKAFQNYSRDIEMVSRIYTKQKMEPPIGRNLPPVAGKILWSRQLYLRIEEPMKLFQ-QHPNVLATPEAKRIIRNYNRVAKTLVEYEVIYHRGWMSQL--VRIGLQASLLVRCPDTRELYVNFDPQILTQIRETDCISRMGLEIPPFAAVLRQKQNVLKTHYNNLQVTLCGIQPA-------FEQMLTPHVAKVDEAILPGLTSLNWSSLNIDKFLSRVTAALG 609          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 3801.52 bits (9857), Expect = 0.000e+0
Identity = 1860/2680 (69.40%), Postives = 2198/2680 (82.01%), Query Frame = 3
Query: 6081 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSE---DIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  K       +SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQL+E KGF+NLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF   GTGHYC +RGF ++VR++V  L+P+TRRLW +TK KMLPTPA FHY+FNLRDLSRIWQGM+N   DVI   K LL LWKHEC RVI+DRF   ED++WF   L   + E+L E   D+V      E DA+F+DF++DA EATGEEP++ DFDMPKVYEPIASF  L+DRL MF GLYNESIRGAGMD+VFFTDAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY IFQITLTRSYN +NL+EDLK LYRTAGQQGKGI+F+ TD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  +LIP+MK+E+PRRPPTN+NL EYF+SR +QNLHVVLCFSP           FP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P VK E++  MG   DGVAE CVDYFQR+RR THVTP SYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+ +AA +VK +VQ VKDKAQ+IV+ I  DK IA+ KLEAA+PAL EAE AL TIKP+DIATVR L RPPHLIMRIMDCVL+ FQRRL+ +  D E+N   PSW ES+KLM+   FL +L  FPKDTINEE VEL++PY +M DY I+ A+RVCGNVAGL SWT+AM +FF IN+EVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQ LL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN+L + WQKE+R R IPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+R+PLLIDPQ QGKIWI+N+EA+ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVTM+GLEDQLLG VI TEKQELE  R+ L+EDV  NK+KMKELED+LL+RLTSTKGSLVDDE LI VL  TK TS EV+QKL IA++TE+KIN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV  YA RGLYE  K  FTLL+ LK+DM++ +IK EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+ R+EKQWR WFDKEAPEEEVIP+ Y+ +LD F+RLLL+R WCPDRT++QA+KYI DS+GE++AEG ILD ++ +EES PRTP++ LLSMGSDPT  I  L K+H    R +SM     IH+     +    GGW LLQNCHL +D+++EL   + E+ +++  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + Q+ LD   ++ W+ M YS+AFLH TVQERRK+GPLGW+IPYEFNQADFNA   F+QNHLD +  K+     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I    +VD+Y  YI  LP  D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++ PF+V + +N MG  +PMNIFLRQEIDR+ +V+  VR TLTDLKLAIDG +VM++ LRDALDC++DA+IP  W+K SW S+TLGFWF EL++RN QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D ++L N VTR+  +++ +PP+EGVY+YGL+LEGA WD+RN RL+++KPK+L++ +PV+ ++A     +    +D+++Y  PIYKKP RT+   IA  +L  S+  E+WI+RGVA+LCD+K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPK-------LSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF---GTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKP----EVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRHISTSRLLSMLFFSYIHTH---THTHEQGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKR-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEV-KGLNTMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKDSRLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGVALLCDVK 2659          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3496.06 bits (9064), Expect = 0.000e+0
Identity = 1705/2683 (63.55%), Postives = 2116/2683 (78.87%), Query Frame = 3
Query: 6081 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVS-QKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPK---EGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP+++E+T VMRVLRDMN+SKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+H PWVLKL+QL+ETQRVRHGMMTLGPSG GKT CIH L+KA+TDCG PH+E+RMNPKAITA QMFG LDV+TNDWTDG+FSTLWR+TLK KKGE+ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L+W P+L+ WL K  +++  ++L  F N+F     YS    IY  E +                                 RL++F+VMWS+GALLE+EDR ++E ++R N+   LDLP  ++D   T+F+++V+E GEW  W+ KV EY YPKDS P+Y SILVPNVDN RTDFL+ T+  Q KAVLLIGEQGT KTVMI  Y +  +PE H+ KSLNFSSAT+P MFQ+TIES++DKRMGSTYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQL+E  GFY+LE+PG+F ++VD+Q +AAMIHPGGGRNDIPQRLKRQFC+FNCTLPSNSSIDKIF  + +G++C ERGF + V  L + L+P  RR+W   K KMLP+PAKFHY+FNLRDLSRIWQGM+    +V  + + L+ L++HEC RVI+DRF+   D + F   L++  +E+   D+V   +    + +F+DF+RDA E TG+EP+DT+  +PK+YEPI SF  L +RL +F   YNES+RG+ MD+VFF DAM HL+KISRIIRTP+GNALLVGVGGSGKQ+LT+LAS+IAGY+ FQI LTR+YN +NL+EDLK LYR AG QGKG+TF+F D +IKDE FLEYM NV++SG VSNLF RDE+ EI Q+LIP MK+++PR PPT DNL  YFLSR + NLHVVLCFSP+GEK  +RA+KFPGLISGCT+DWFQRWPKDAL+AVA H+LS + + C+  VK+ +I +MG   D VA+ C +YFQRFRRQT+VTPKSYLSF+ GY++IY EK  +   LA+RM++GL +L EA+++V EL + LA KEKEL +A+++A+ VL+ V V+  AA +VK +VQ VKDKAQ+IV+EIE DKK+AESKLEAA+PAL  AE AL TIKPADIATVRKLG+PPHLIMRIMD VL+ FQRR+D++  DPER   +PSW E++KLM+N+ FL+ L+NF KDTINEE VEL+ PYL MEDY ++ A+R+CGNVAGL SWT AM  FF INKEVLPLK NL  Q+ R   + ++L  AQ  LD KQKEL + Q +YD A+ +KQ+LL+DAE CRRKM+ A  LI+GL GEK+RWT  S+EF+ QI  L GDVL AT FLSY GPFNQE+RN+L   W+KE+    IP+S S N+I ML D   LGEW+LQGLPND+LS+QNGIIVT ASRYPLLIDPQGQGK WIKNREA  +LQVTSLNHKYFR H+ED LSLG+PLLIED+GEELDP LDN+LEKNFI+ GST+KVKVGDKEVDVMK F LYITTK+ NP+Y+PE+ A+T+I+DFTVT+KGLEDQLLG VI TEKQELE++R++++ +V  NK+KM+ELEDNLL+RLTST+GSLV+DE LI+VL+ TK T+ EVS +KL++A++TEIKIN AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD S+ +S KS +T KR+ NI++ +TYEV++Y VRGLYE  K  FTLL+ LK+D++A  I   EF   IKGGASLD+N V+PKP+ WI DMTWLNLV LS+LH FS +  QVS+N++ W+ WFD+ APEE  +PDGY + L  F +LLL+R WCPDRT++QA+ YI +S+G+++AEG ILD D +  E+  RTPM   LSMGSDPT  IE LAK     CR ISMGQGQE+H+RRL+A  +  GGW+LLQNCHL +D+++EL + I  S N+   +R+W+T+E H +FPINFLQ ++KFTNEPP+GI+A L+R+++ +TQD L+   +  W+ + +++AFLH TVQERRKFGPLGWNIPYEFNQADF +   F+QNHL+ +  K      G++W C+RYM+ E+QYGGRVTDD D RLL   T+ +F E MF   F       I    T+ EY ++I  LP  D P   GLH NADIS  T     IL TI++IQPKDS  G  ETRES V +   EML+K+P +++  +V   + KMG  QPM IFLRQE+DR+  +I  VR TLTDLKLAIDG ++M++ LRDALD ++DA++P +W++ SW+S TLGFWF EL++RN QF  W  +GRP  FW+TGFFNPQGFLTAMRQE TR +   GW  D+V+L N VTR   E++  PP     GVYIYGLFL+GA WDKRN +++E+ PK+L+  LPV++++A+   T  K+ +   +Y  P+Y+KPRRT+LT+I    L   ++ +HW +RG+A+LCD K
Sbjct:   12 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKPQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPSESEKTVVMRVLRDMNISKLVDEDEPLFMSLINDLFPGIVLDKAGYPDLEAAIVKQAEEAGLIAHQPWVLKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLLKAMTDCGTPHKELRMNPKAITASQMFGTLDVATNDWTDGVFSTLWRKTLKAKKGEYTWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIPMAPTCKVVFEPHNIDNASPATVSRNGMVFMSSSVLNWKPILQAWLKKLPASQAELILNFF-NTF-----YSRLKYIYLTEKVIG-------------------------------RLFVFAVMWSVGALLELEDRSRMEMFLR-NHPAALDLPNTQQDQ--TIFEFVVNEAGEWDPWSVKVPEYHYPKDSVPDYSSILVPNVDNTRTDFLLQTIMKQGKAVLLIGEQGTGKTVMIKGYTTKYDPETHLSKSLNFSSATLPSMFQQTIESYIDKRMGSTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQGGFYSLERPGEFVSVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCSERGFTESVSSLAKALVPTIRRVWQTVKAKMLPSPAKFHYIFNLRDLSRIWQGMLTVGAEVCRDPEVLVSLFRHECTRVIADRFIDQNDRNVFDGILEKISTEEHGSDLV---KGVAWEEYFVDFLRDAPEITGDEPEDTEVVIPKIYEPIPSFSALSERLTLFLQQYNESVRGSAMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASFIAGYQSFQIVLTRTYNATNLMEDLKTLYRIAGLQGKGVTFIFADNDIKDESFLEYMTNVVASGEVSNLFTRDEISEITQDLIPTMKQQHPRLPPTIDNLYSYFLSRVRSNLHVVLCFSPVGEKLGSRAVKFPGLISGCTVDWFQRWPKDALVAVAQHFLSGYSLQCSEEVKQSVIGTMGTFQDLVAQTCTEYFQRFRRQTYVTPKSYLSFIKGYQTIYSEKIGNVRTLAERMNTGLDRLKEAEQAVNELSKALAVKEKELEVASKKADAVLQEVAVKAQAAEKVKTQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALAAAEAALQTIKPADIATVRKLGKPPHLIMRIMDAVLLLFQRRVDSVTMDPERPCLRPSWAEALKLMNNSGFLSMLLNFNKDTINEEMVELLLPYLSMEDYNLEAAKRICGNVAGLCSWTEAMADFFGINKEVLPLKANLKLQEARLAVAQDELAKAQEQLDAKQKELDEAQELYDGAVSEKQSLLEDAEACRRKMSNAMALIDGLGGEKIRWTESSTEFQRQIKHLPGDVLLATGFLSYAGPFNQEYRNLLLQQWKKEMSGNHIPYSQSFNLITMLVDNATLGEWNLQGLPNDDLSIQNGIIVTSASRYPLLIDPQGQGKTWIKNREANHDLQVTSLNHKYFRAHIEDCLSLGKPLLIEDVGEELDPVLDNILEKNFIRSGSTYKVKVGDKEVDVMKEFTLYITTKMANPAYSPEVSAKTAIVDFTVTVKGLEDQLLGRVILTEKQELESERVKMLAEVTSNKRKMQELEDNLLYRLTSTQGSLVEDESLIEVLRVTKSTAEEVSLKKLLVAAETEIKINEAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDSSIEKSPKSQITSKRLINIMDFLTYEVFRYTVRGLYEDHKFLFTLLLTLKIDLQAKNISHPEFQALIKGGASLDLNSVEPKPRRWILDMTWLNLVHLSSLHPFSRLPSQVSQNDRGWKSWFDEAAPEEAPLPDGYESLLGAFHKLLLIRSWCPDRTIAQARHYITESIGQRYAEGVILDMDSMCTENDKRTPMTCFLSMGSDPTENIERLAKSKGFPCRPISMGQGQEVHARRLLAQSMADGGWLLLQNCHLGLDFLDELLETINTSENIAESFRVWVTTEVHPKFPINFLQSSVKFTNEPPQGIKAGLRRTYSSITQDQLEITNMPQWRPLLFAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLEDVDVKL-----GVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFTRIWFSENMFGEKFCFYRGYTIPNAKTLPEYHSHIDALPLVDTPEVLGLHPNADISCQTNMASEILSTIINIQPKDSSGGGDETRESTVLRLANEMLEKLPPDYVAHEVRTHLQKMGLVQPMTIFLRQELDRMQNIIGCVRSTLTDLKLAIDGTIIMSEDLRDALDSVYDARVPKLWQRSSWDSATLGFWFTELLERNQQFHSWTFNGRPHQFWLTGFFNPQGFLTAMRQETTRMNLAKGWTLDTVVLLNDVTRMMREDVTGPPTGDVGGVYIYGLFLDGAGWDKRNCKILESLPKVLFTPLPVVHVYAVSSATDPKRPQGVSLYPCPVYRKPRRTDLTFIFTLFLRTVQNPDHWTLRGLALLCDCK 2646          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2045.4 bits (5298), Expect = 0.000e+0
Identity = 1232/3580 (34.41%), Postives = 1959/3580 (54.72%), Query Frame = 3
Query: 3501 QMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEE-YIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSE--DLS-EDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXX---XXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKP-KAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV--ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLD--SFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFF---INPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPK---DSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN----LTYIANAELVCSK-SAEHWIMRGVAMLCDI 14108
            Q K  +  + +++E+ K+Q+ ++  + +    ++  +  +  +  +W   KD+ +  +   +P VS FD  I  Y  + + +  E        + L    LK  L+     W+  + +  ++     ++++ +F +D   RLS+  + L ++   +  L+ ++ +  +I+  I PI E +A+L +YE+ V+++  + ++ L   WQ            L   + +F+S L  + + FKK      +D++++GP    +    A +++ + + + ++L+    T   G  +F         +++++K+++ L +++ +        + +    +  +  E + +          KL + LKD  W   E  +  I+ F   +P++  + +PAM+ RHW ++       FD  S  F L  I+   L +  E I +I  +A KE  IE  L+ +   W    L    +K++G        T E+   +ED+ + LS++ ++R+   F+K++      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F +I+ SW  IM R +++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++ +     A   +S +GE +E   PV  E  VE WL  +    + +L   +R    ++        +++  +P Q+ +   Q+ WT D T+ L+  K  +D+  ++   ++ + +L+        +L K+ R K   L+T+ VH +D+ D+L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCSD +D++ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F+F   D+  +    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L   GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++R  P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+  I  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+ K+    +L KAL+     GEP      E  +NPKA++  +++G  D+STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E   +  LF         +   +    +   E   V   C L + L   ++     D+    R+  E  +IFS++WSI A ++ + R K++ ++R    ++   P     ++DT+++Y V ++N  W  +  K+ + + YP ++ P Y  I+VP VD VR  FL+N++   +  VLL G  GT KT +    L   +P      ++N SS T     Q  IES V+KR   TY P  G+KM  F+DD+NMP ++++G Q   E++R  ++   +Y+ +        +DM  +A+M  PGGGR  I  RL+ +F + N T P+ S I  IF   GT    K + F +EV+ +   L   T  L+     + LPTPAK HY+FNLRD+S+++QG++ +  D     +++  LW HEC RV SDR V   D   FV  L   L    DL+  +I    Q       F DF+++                P VYE +  F  LK  ++     YN +     M +V F DA+ H+ ++ R+I  PRGN LLVG+GGSG+Q+L++LA+YI  Y +FQ+ +T+ Y      ED+K LYR  G   K   FLF D +I DE FLE +NN+LSSG V NL+  DE +E+   L    +KE      T D +  Y + R + NLH+VLC SP+GE FRNR  ++P L++  T+DWF  WP+DAL+ VA  YL    +     ++ ++      +H  VA+         +R  +VTP +YL  ++GYK +  EK         ++ +GL K+ + +  V  +   L + +K++A   ++ EE L  +  QK  A+E +  V    +K  +  EEI + K +AE+       A PAL EA  AL ++   D+  ++  GRPP L+  +M  V+I                  +P+W E+ + +  + F+  L++F KD I++  ++ I  Y    D+  ++  RV      L  W RAM  +  I + V P +  L     +  +    L  A++   E +++L +++  YDE L +K+ L   +E    K+  A +L+ GLAGE++RW       +  +  LVGD L A AFLSY GPF   +R  +L   W K+ R  ++P S   N    L+ PT + +W++QGLP+D  S +NG+IVT+ +R+PL++DPQGQ   WIKN E+++ L+V  L    F + LE+++  G P+L++++ EELDP+L  +L K+F   G    +K+GDKEV+    F+ YITTKL NP YTPEI  +T+I++F V  +GLE QLLG+V++ E+ ELE Q+  L+ ++   K+K++ELED +L  L    GSL+DD  L+  L+T+K+T+ EVS +L  +  TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+LS+ +SQ+S   ++RI N+ +  TY V++Y  RGL+E  K+ F+  M  K+   AGK+ ++E+  F++GG  LD       P  +W+ D  W N+ EL  L  F  ++    +  K W QW+    PE   +P  + T  +  +++L+VR    DR       +I ++LG +F E  +LD   V E+S  +TP++ +LS G DPT  +  LA+   +     A+S+GQGQ   + R++   +  G WV L NCHL + ++ +L ++++  +  + +  +RLW++S  H +FPI  LQ  IK T EPP+G+++N++R +  +T+      S  V++ K++F SL F H  + ER+KF  LGWNI Y FN +DF      +  +LD        +   I W  ++Y+I+ + YGG VTDD+D RLL      YF E      FF     P   I    + D YR YI  LP  ++P  FG H NADI+     T+ + +T+LS+QP+    +  G G +RE  V +   ++  K+P   + ++  +K+ +     P+N+ L QEI R + ++H +R +LT+L+  I G+VVM+  L +   CI DA++P +WEK       L  W  +L  R  QF  W      PV FW++GF  P GFLTA+ Q   R H+  + D++     V+      L  PPK+GV+I GL+LEGA WDK+N  L+EA+P  L   +P I+   ++ + K  +     MY  P Y  P R+      +++   +L     S EHWI RG A+L  +
Sbjct:  911 QRKPVHNIIEQDEEICKIQAAIAAGMTANASHLQAYLKTWDKHREIWEINKDSFIRRYQHLNPPVSSFDSDIARYSEVANNVQKEETVLSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKG--------TEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDIC-LVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRM-VELWFIFSLIWSICASVDEDGRKKIDNFLR---EMEGTFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNA-PFY-KIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQMK------MDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIF---GTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQ----QPIFGDFLKE----------------PHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLE--TADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGA--EEI-KCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLF-SLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLD--------EYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVP-ELVDYESTQKLLQDDP-SPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNV-SVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAK----NMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSL 4405          

HSP 2 Score: 84.3445 bits (207), Expect = 4.006e-15
Identity = 69/276 (25.00%), Postives = 125/276 (45.29%), Query Frame = 3
Query:  498 QCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMN-----IVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKI 1310
            Q   F+R  + T I E +    V F ++ G +     +E  +  +M  H   +       E  +++    MN    F+  L++ R  +  +  L +           P++ +         + E + ++E  +  W +QI++VL   + +    D+ GP  E+D+WK R +  + +  QL+ P V     ILQ AKS  +  +  + ++I D   +A+ N+ FL  L E C  L    P  +   +  +I+  R+I   S YYNT E++T+LF K+
Sbjct:  141 QLAYFIREEE-TVIMEESFESSVQFGIVRGGD-----MESLLRLMMGIHASQVALSTAWPESIKNNYSTHMN---RFLTNLTDTRYKLVGKTVLYI-----------PVEALQHSPEVAARDKELVKRMEVVMIHWTRQIKEVLNAQETVEI-GDSSGPLEEIDFWKSRCSDLSGISQQLQKPGVLHIQAILQLAKSSYVPPFCRLAKQIQDGTQQAQSNLSFLSLLREPCEELALLKPREVEPKLAHIINVSRVIWVNSVYYNTRERLTTLFRKV 395          

HSP 3 Score: 64.3142 bits (155), Expect = 5.011e-9
Identity = 63/292 (21.58%), Postives = 128/292 (43.84%), Query Frame = 3
Query: 1641 FNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKH--YSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEA-KVIIKNYNKLAETLISFEIIYHQAWVRQIN-STHTGLNSSLIIRHPETKELY-VNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTS 2501
            F+  +  ++      LD R T +   ++ F  ++++L   + N ++  F  + S    +Q L  F+ L+       E   + L+    DV A++    Y  NKE             +  WAR + RRIQ  M++  +++ + L   E  K + +   +L + L       +  W + ++  +   LN  L+IR  E   +  +NFD ++L +  E     +L+ EIP        ++  L+     ++L+V    ++ +++  +   L   R+  L + ++PGL+   W+S
Sbjct:  435 FDKSLQVLRSVRKGILDVRNTSWHDSYNRFRAEVKDLEVMMQNLINTAFKTVNSVEEGVQLLDVFQHLSA-----REAIKRTLSRKTVDVYAMLSKEVYLVNKE-----------LSQAHWARAMQRRIQGQMQVCVLENAHFLPQIENDKKVREACMQLLQKLDELVRRMYSEWSQSLDRGSLKNLNQPLMIRCKEKAGMLDINFDKNLLKMFNEMYYWERLQFEIPHHVSEAYQRREDLRTMRENVLLVVRDYNRIISALSADEVGLFRERIRFLDKKLQPGLSKLLWSS 710          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1978.37 bits (5124), Expect = 0.000e+0
Identity = 1222/3545 (34.47%), Postives = 1939/3545 (54.70%), Query Frame = 3
Query: 3615 RFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYS-----GGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRN--ILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHEL----HFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-KQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKS-DRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFV-------VRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGK-------LEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIIS-MGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQE---PMFQP-DFFINP--IQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGA-FQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTE-ELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN---LTYIANAELVCSKSAEHWIMRGVAM 14096
            R+  Y  LW   K   +E+F    P    +D  +K Y  +  ++  +    D   + L  E L   +    +AW    G+  N   + ++  + +  + L + L +    L+D++  +  +  IR+  + +++    I+E Y  L  Y + V ++E +    +R  W  L S   QV   L   +  F     E +  +K++   F E ++  GP   G       D L   + RY + E   I        G E+LF L +T Y +L ++++E+  L+++Y +Y     +   +   LW +++I+ +      F    RKLPK ++  P    L   + +F   +PLL  + N A++ R+      L  H + +    + L++  ++ +P               VKE         V   W   +     +F   + RG +L   D   EI   ++D+ + L S+  +R+  PF   IQ     LS  SE+IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F +IDK + KIMS    +  + +CC+    LS L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI +++F      ET+  A  S EGE +EL++PV AE  VE W+  +L   +R+   + + A       +  V   L+ Y   V L G Q+ WT +  +      S +++ M+Q  ++    ++ L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D   V     +F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+IF GL+Q G+WGCFDEFNRID  VLSV + QI  + +    + K+F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P   E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E      P  V K++Q++ET   RH  M +GP+G GK+  I+ L +A T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   +   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P I    ++ +    + E L+  V       V Q   +L+ L+  +D      +S    E  +I ++  S+GA L    R K       L   +   +   L  P        T+FD+       +W+ W+S V +YI+  D+  ++  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT     +L++ NP++ M  ++NFSS T     QR++E+ V+KR   TYGPP G+ + VF+DD+NMP ++E+G Q    +++ LL+  G Y+  K  +   + D+ F+AAM   GGGRN++  R    F +FN   P   ++  I+S I  GH    R F + +R +   L   T  L+      + PTP+KFHY+FNLRDLSR++ G+  T  +        + +W++EC RV  DR +   D +     +K  + E    ++ S          F D+     E+            P+VYE I  +D  K   +     YNE+     M++V F DA+ HL ++ RIIR  RG+ALLVGVGGSGKQ+LTKLA++ AG  +F+I L+R Y+ SN  EDLK LY   G + K   FLFTD  + +EGFLE +NN+L+SG+V  LF  DE + +  ++     K       + +++ +YF++++  NLH+VL  SP+G+  R R   FPGL++   +DWF  WP  AL AVA  +L    ++  P    E +I  + +VH  V E    + Q+ RR  +VTPK+YL F++ Y ++ ++K        +R++ GL KL EA   +A+L + LAE++  LA  +   E +L+ ++     A E K   +    + +   + I  +KK AES L  A PAL  A  AL  +  +D+  +R   +PP  +  + +C+L+        M G  E N     W  +  +MS   FL +L+    D+I+   V+ +  +L+  + + +  + +    +G+L +  A+M + ++ +E+ P ++ + + +  + +S  +L   QS L+  QKELG +   Y  A+ +KQ L ++A+   R++ AA +LI GL  E  RWT    E K +  RL+GD L + AFLSY G FN +FRN ++   WQK++  R IP S    I  +LTD   +  W  + LP DELSVQNGI+ T+ASR+P+ IDPQ Q   WIK +E +  L+++S N   F + LE ++  G P L +D+ E +DP +DNVLEKN         + +GDKEVD    F+LY+ TKL NP Y+P +F +  +I++TVT+KGLEDQLL +++  E++ELE QR +L+++   NK+ +K+LED+LL  L ++ G+++D+ +L+  L+ TK  + EV +KL +A  T   I+  R+ YRP A RG+IL+F++ EM+LVN MYQ SL  FL +FD S+ +S  + +  KR+ NI+  +T  V+ Y   GL+E  K+ F+  M +K++   G+   EE   F+KG  SL+ +  + KP  W+ D  W ++V L+ L  ++F A+++ + +N K+W+ WFD ++PE+   P  Y  +L  F++LLL+RC+  DR       Y+  ++GEK+ +  ++  + +FE+S P +P+V +LS G +P   +  LA++        + ++MGQGQE  + +L+   +  G W++LQNCHL + ++ +L + ++  T  +  +RLW+T++    FPI  LQ ++K   EPP G++ N++ ++  +  + L S     ++ + Y LAF H  VQERRK+G +GWN+PY+FN++DF  C   +  +L   T   +     I W  ++Y+I E+ YGGR  D FD R+L V    Y  +     FQP  FF N     +I    + + Y   I +LP  + P  FGLH NA+I Y T+  + +   ++ +QP+    G G +R+  + +   ++ +K+PS    F +     K+G    P ++ L QE++R ++++  +  +L++L+ A+ G V M+  L +    +F+ +IP +W K++ ++  +LG W I    R+ Q+  W+  G P   W++G   P+ +LTA+ Q   R  +GW  D   L   VT + +E E+ E P +G Y+ GL+LEGA WD   G L+ +KPK L   LP++ +  ++    + Q        +P+Y    R N   +  +  A+L  ++   HW+++GV +
Sbjct:  896 RWKRYHPLWNLDKSIMMEKFAAKKPACVTYDEKLKFYSNIGQEVAQQPLVKDVHVVRLDLEPLAHTVQENVQAWVSSLGRLLNDSAREDLYALRSELQQLSENLKKSPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEEELQLAANIRNMWSDLFSESRQVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFNMHGPGAVG-------DNLDKGRLRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEVYK---AAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDRY------LFLHCYRL----YLLKDWSLIGSP-------------QGVKE---------VVDTWEVMKFSVQRYFKGTQERGYILGSVD---EIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLD-YQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQF-EGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPED------LSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIHNPDT--KFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH---TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDS---AMRDPILFGDYRTALSESE-----------PRVYEDIQDYDACKALFQEILEEYNEN--KTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGH--SKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMI--PAAHSETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILV--------MRGHKEIN-----WKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKS-KRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYL---TKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPS---AFDLDVIRKKLGPDVSPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCR-RNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQ----NTLRTPVYTTSMRRNAMGVGLVFEADLFTTEHHSHWVLQGVCL 4335          

HSP 2 Score: 159.073 bits (401), Expect = 1.184e-37
Identity = 152/670 (22.69%), Postives = 302/670 (45.07%), Query Frame = 3
Query:  783 VCTEIDLKRIRLPIDCMNIVNNTEQLMK-------VEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAAN---EAKDNVKFLYTLEEHCAPLYQNNPALMI-DNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFD---TFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGL-NSSLIIRHPETKE----LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP-----NDVPVTVDEFVNNTQELCIKAAKLL 2720
            +C  + L  I+L I  +++    E L+        +E CV  W  QI  VL E  + + +A   GP AE+D+W++R A  + L +QLKLP VK  + ++  A+  T++    +D  +T+  N   EA +NV FL TLE H   L      ++I + IP++++ ++++  IS +YNT E+M  L  +I  ++       +   N   ++    E    ++L   ++   +++C+ E + R+     + ++E     +F K D   + C+ L +++++                   ++   +NV  S ++       D RR       DD +R +  L                     I+ L  F+  +I   G    +  ++  +   VE +   +   +E+PPV++  P +AG + W R LF RI+ P+  F+ +   +L   + K + + Y ++   +  +E+   + W ++       L N +L++    + +    L VNF P++  +  ET  + +L   +P  A N+ ++++      ++L  +V     + +S+      L+  ++ +LRR++  G    NW S+ + E+I      + + E L+ + +      +D  L+++ T  L + P      D+P  V EF    ++  +K   LL
Sbjct:  123 ICVVLSLGGIKLHIPELDLKQEVEALLANQEAVEILEQCVMNWQAQITIVLEEQQKKKPQAP--GPLAEIDFWRERAAALSALSEQLKLPVVKKILEVMTRAEPATVQN---LDLTVTELNNYLVEAVNNVDFLSTLERHFKNLATGVSFIVILETIPQMMNGLQLVWIISSHYNTDERMVPLMERIAWELSERVARVV---NIRLLFKERREVAKAKVLDGKKVLDQWKSCYFEVRARIETSGTDPRWEFDRKKLFEKTDYMASICQDLYNVLQV-------------------TLDEFYNVFGSEMRAVTR---DSRR------IDDVVRWVDSL------------------VVPIEEL-NFDPFDIRKTG---SWKMVMKDFRSKVEVINSMFVEQRENPPVSKIYPPVAGAVYWERLLFHRIKDPIIRFQ-ELPEMLDNEQGKSVTEKYLEVGRRMRDYEVKKVEGWRKETERMLPELMNRTLLLTVDSSGDRGIRLVVNFAPELKEIISETIYLDRLGYAVPELARNVALQEHRFLRCVDELKNLVKRCHSLMDSLNDAEFLLLTPQVQELRRVLRAGWRRLNWNSLGIAEFIGRSEQAVTKFESLVSQIKK-NARDVDAKLQDIETANLFKFPAPDKAGDLP-GVKEFFELVEKQRVKDVILL 731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3763 bits (9757), Expect = 0.000e+0
Identity = 1934/3515 (55.02%), Postives = 2526/3515 (71.86%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKET---GDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDED--SRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIR----LPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKV-----IRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAE----SNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKM 10667
            + K  R  +R +LD RH+YL+ ++AD    +   VE++IL   + E +  FF ++ +  L F  QE    ++T     ++ +   G   S V   ++FIT G +    G C  F+R+++   I+   +A+++NF V+    G +LQG+E ++S +M+P  ++ +  WG ++  E+  +    ++S+  F+  LS  R++I ++V L    E DL  I     +P  C   V NTE + ++E  + +W+KQIEQVL ES+QIR+EADN+GP AEL YWKKR ++FN LL++LK   V+   G+LQAA+S++LK W E+D RIT+ A+EAKDNVK+LY+LE+   PL + +P  +   I  L+S++RM+H+IS+YYN+SE MTSLFVK+TNQMI +CKAY+     + +W  + + L++R+ +C  LN+ YQ CF ETK  L    + RQFE SE YIFGKFD+FC RL  +  + + +++ + L    IEG++ + +++  + +  K K Y+ LD R++EF  D+ +F  Q + L+ ++  F+D  F     T + ++ L +FER+    L + EKY  +L  Y RD++ V + Y + K++PP+ R++P ++GKI WARQLFR+I  PM+ F    +++L+T E K+ ++NYNK+A  L+ FE++YH+AW R ++     L SSL++R+P+ KE +VNFD  I  L  E   + KL  ++P A INL  K+  +K  H +L+  +    +  +SIP   + LM   +A +   I PGLT  +WTS+ +  YI+ +   + +L+    +  D+ + R++  L +MS   L  LP + P+ +  F+  T+ +   A K L ++S  VE SV +L+++L  +          +   +S    R S                   G ++  ++   +  +I +A   L +H+ ++    ++K+      R +L++LR+R+      A    V+    P F     L IPN+++ P+++++Q ++N+   +++ ++K IS W       KQ                   +ID              Q  S+  S  GT   P +  +    +  DE+ +   +N     +   K + E+K+V KV   LS+ ++  R E    +  FS +S LW++  +  ++EF+  DP +SEF+  +  Y  LE Q+     ++  GP+   TE LK+ L+ E + W+  +G A N K  A  +++  F+E + K L+R I DL+D+R AM AL E+R  EI+++  I P+EE++AML +Y+L  +    +RVD L Y W+ LM++  QVQ+ L+ +QP  +++L+  V  F KD   F  DYD  GP   G+ P+EASDRL + Q ++D+L R+F TYSGGEELFGL VTDY +L+ I++EL LLQKLY LYN VI SV+GYY+ILW D+DIEKI+NEL +FQN+CRKLPK LK+W AFEDL+K ID+FN   PLLE+M N AM  RHW+R++++T H FD+ESD FAL+NI+EAPLL FK++IEDICISA KE+DI+AKLKAV +EWS+    F  FK+RGELLL+G  T+E +++MEDSLM+L+SL+SNRYNVPFK  IQ  V KLSN++EIIE WM VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE   ++ CCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDPHTIQ+HLL +FDN+  V FHEK YE IL+  S EGE++ L +PV A+     NVE WL  LL   + ++H VIR A   I D  F + EF   +PAQVGLL  Q++WTRDS  AL NAK+DRKIM  TN++FL LLN LI  TT DL K ER K+ETLITIHVHQKDIFD LV+  +KS +DF+WLKQ+RFYFVE+ D+C++ ITDVDF Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK ++ QFVFTDGD+V+M+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELE AI  Q   A ++ HPPWVLK+IQL+ETQRVRHGMM LGPSGAGKT CIH+LMKA+TDCGEPHREMRMNPKAITAPQMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+++ WL    + +  ++     + F D+  +    +  KM+ LE   ++QA +LL+GL+P  DE+   ++   H +RL +FS+MWS+GALLE+EDR ++EA++R++ +  LDLP    D  D++F+Y+V ++G W HWN++V E+ YP+D+ PEY +ILVPNVDNVRTDFLM  +  QEKAVLLIGEQGTAKTVMI  Y++  + E H+ KSLNFSSAT P MFQRT+ES+VDKRMG+TYGPPAGRKMT+FIDDINMP+INEWGDQI NEIVRQL+E  GFYNLEKPG+FT IVD+QF+AAMIHPGGGRNDIPQRLKRQFCIFNCTLPSN+SIDKIF     GH+C ERGF +EV QL   L+P TRRLW  TK KMLPTPAKFHY+FNLRDLSRIWQGM+    +V  ++  LL L+ HEC RVI+DRF   +D  WF  T+ + + +D      + +   E + +F+DFMRDA E TGEEPDD D + PKVYEPI SF QL +RL+ F   YNES+RGA MD+VFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITL+R+YN+SNL+EDLK LYR  GQQGKG+TF+FTD EIKDE FLEYMNNVL+SG VSNLFARDE+DEI QELIP++KKE+PRRPPTN+NL +YFLSR + NLHVVLCFSP+GEKFR RALKFP LISGCTMDWFQ WP+DAL AVAGH+L+ + + C P VK+ ++ +M V  D VAE CV+YF+RFRRQT+VTPKSYLSF+ GYKSIY EK  + + L++RM +GL KL EA++SV++L   L  KEKELA+A+R A+EVL  VT +  AA  VK +VQ VKDKAQ+IV+EI  DK +AE KLEAA+PAL EAE AL TIKPADI TVRKL +PPHLIMRIMDCVL+ F+RR+DT+  +PER   +PSW E+ KLM+   FLN+L+ F KDTINEE V+L+ PY+EMEDY ++ AR VCGNVAGL SWT+AM++FF INKEVLPLK NL  Q+ R   +  +L+ AQ+ LDEKQ+EL  VQA+YD A+R+KQ L+DDAE CRRKM
Sbjct:    9 QTKVTRDERRVQLDGRHKYLISKLADVLGQDEAAVEDAILADERFEQIKDFFVANGSKRLMFFCQESTQPRDTLYSRGEMSVSHVG---SNVSHKRLFITTGADEAFAGTCYFFLRTTEKA-ISTANMAQEINFGVLECPEGDILQGVESFLSSLMIPALKS-QETWGVIKSGENDPAVEVFLDSVNYFMQSLSGVRQNIQQKVQL---MEADLGTITYLCCIP-HCPVTVGNTEMVERLEAALRVWMKQIEQVLVESEQIRKEADNVGPSAELVYWKKRTSRFNSLLEELKSERVQKVTGLLQAARSRSLKHWKELDSRITEEASEAKDNVKYLYSLEKFFGPLAKYSPVSIKSGIEGLMSNIRMVHTISRYYNSSEHMTSLFVKVTNQMIATCKAYLHQGGGK-IWDHDWDNLLQRMSECIRLNEEYQHCFHETKQHLRQSNNPRQFEFSENYIFGKFDSFCMRLRKLSDMLQTMQSLAGLQHVRIEGIDKIFLRYQALATNTKAKTYDVLDHRKSEFDIDYKEFCSQTEGLYQSLQTFVDSWFGDALKTEKMLELLGKFERIAGGRLQLMEKYQLVLHRYARDMDMVRRTYQKQKQNPPIPRNIPPVSGKIMWARQLFRKIDIPMK-FLNNKRDVLQTSEGKITVRNYNKMAAVLLEFELLYHRAWSRAVDLVRNSLLSSLLVRYPKKKEFFVNFDLAIFELLMEAKHLHKLGFQVPEAVINLCQKEQQIKHHHTRLLEALQEYTQAVSSIPPILQPLMTPCVALVEDAILPGLTIISWTSLNIDTYIEEIQAAVVQLKQTTKQVVDIMECRVEATLYDMSFTPLLTLPEEEPLDMLAFMAATETMVASATKSLATQSDFVEKSVLDLLDLL--KSACRAPTTTSQGRSVSATRRRSSAVSVQ------------FPGTANTTQEPWGLATNIIQAEVFLSIHYIYKTWSCLLKLSVRAGTRRSLDALRRRLQTAGPYAEQQRVQQGHMPLFCTEIILAIPNVLLKPSLDDLQSSLNKAVNVMLGMAKDISVWKYAHLQQKQQQVR---------------LID--------------QGSSQQNSSLGTYCCP-QLEMQVARELGDENIVIKQIN----PRTLDKQITEHKDVGKVMFHLSSVLSFLRVESTEVLKNFSCFSSLWSQEPEEMVKEFMTTDPTMSEFNAQMVYYAQLEQQVQDLPAHFAVGPVLAMTEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPICDLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTMKADLLTGVAEFHKDLSSFQLDYDTQGPGEAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLLPEADER---RLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPS-HLDLPGSAND--DSIFEYVVGDSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHG---TAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKM 3454          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2825.42 bits (7323), Expect = 0.000e+0
Identity = 1414/2026 (69.79%), Postives = 1660/2026 (81.93%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQ--TLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELR 10862
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF +IGTGHY   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++ + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K   ++     N  L+   G   Q   +  +  + A +  F +T + SY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK      LA RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L   WQ+EL+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDWAVPGVVRHDAQHIQFDLTFSTSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2021          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2820.03 bits (7309), Expect = 0.000e+0
Identity = 1414/2028 (69.72%), Postives = 1657/2028 (81.71%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLA----SYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELR 10862
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF +IGTGHY   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++ + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K   ++     N  L+   G   Q +   +    S  A         +RSY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK      LA RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L   WQ+EL+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDILSASLRTDSDPAVLTPVVTPASRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2023          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001365.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2802.7 bits (7264), Expect = 0.000e+0
Identity = 1419/2035 (69.73%), Postives = 1661/2035 (81.62%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFG-LRNIL-SVLRTLGQQK--RANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKI-SRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIF-QITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEK---FDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELR 10862
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G L NIL S++ +L      R           +R LR+  LS  +D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF +IGTGHY   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++ + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K  ++++ T   +  + GV     Q +    ++   + +F QITL+RSY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK            RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L   WQ+EL+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILENILLSLIHSLSDSVIIRHLTAKPWAKRTLRALRNTGLSTPIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKKEAKLLVTAYCDWAVPGVVRHDAQHIQFDLTFSTLFPVFTQITLSRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKRLCVCVIYTWGDRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2032          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001375.1 (pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2766.1 bits (7169), Expect = 0.000e+0
Identity = 1404/2042 (68.76%), Postives = 1644/2042 (80.51%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNL-----SKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITN--------------------AKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNIL 10835
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T G      P  ++      V R + +     + L+D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF  +    +   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++                     + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K   ++       L+   G S +  L  +    A + I+   L RSY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK      LA RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCG------PPISDARDRYNVFRPLAVNAETKANLIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGSLANSRFIAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPEESTAVDLCPVIRPAPPDRPQLLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGV-TNLTLMTFDGHSLQDMLCDIDVRSANHTIY---LLRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLL 2029          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 384.415 bits (986), Expect = 9.879e-107
Identity = 306/1087 (28.15%), Postives = 532/1087 (48.94%), Query Frame = 3
Query: 4236 EDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRM-SDLTSHHFD---VESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGG-DIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEI--WLMGLLNMAQRSLHGVIRAANNSIND-TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFY----FVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTE----QTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIIS----HPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC-GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRT---LKGK-KGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPL 7421
            E +    P+ P L P EA   L         L+++  + +   ++  + V    +L  + +E+     ++    ++   V   ++  W  VD+  + ++L  F  R  +LP+ +K +  ++ L   ++   S+  +L  + + A+KPRHW  +  D+         ++   F+L++++   L   +  +  I   A KE  IE  L  +K  W   E  +   ++   L L  +      +  ED   ++S   SN Y + F++D  D+ SKL+  SEI   W+ VQ  W+ L  +     DI   LP E  +F ++   +  I +RA +    ++  +        L   ++ L++ + SL+ +LE++R  FPRF+F+ +  LL+I+G       +   +  +F +I+++ F E   + I    S+EGE L L + ++ + +++   WL  L    + S+    R     + D T+  V+  ++ Y  Q  LL  Q++WT    + L   +  +   +   +   LL  L             + K E L+  ++H  ++  QL     K  +   W K  +FY     ++D++   +S +     Y+ E++G  ERL+ TPL    + TL  +L    GG   GPAGTGKTETVK  G+ LG+ VVVFNC D  D++ L R+  G++Q G+WGCFDEFNR+D  VLS  +  I  + +  +  K      + +   ++P   +F+T+NPGY GR ELPENLK +FR  +M  P    I  + L   GF D+  LA K     +L   + +   HY FGLR +  VLR        +P  +E    + TV+  L+ + L  L D DE +F   ++ +F     D  G P    AI + + +A   S       ++ K +Q +  Q+ +  ++ +G +G GKT     ++ A+    G  +    ++ K +T   ++G +  +T +W DG+F+++ RR    + G  K   IW+V D  +D  ++E +NSVLDDNK LTL NG+R+P+ P+ +I+FE  N+D+ +PAT++R G+++ S+   D C +
Sbjct: 1166 ESWSVRKPISPTLTPPEALKILEFFNESITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWK--EAQYEVIEHSSGLKLVREWDVLEQACKEDLEELVSMKASNYYKI-FEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIE-VIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLE---DFITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVV--VSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNV------KKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEE-TPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRN------CSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIF-----DSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFST---DVCSI 2222          

HSP 2 Score: 296.975 bits (759), Expect = 2.585e-80
Identity = 301/1377 (21.86%), Postives = 631/1377 (45.82%), Query Frame = 3
Query: 7890 ILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIE---SFVDKRMGSTYGPPAG-RKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGM---INTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDL-SEDI--VSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLS----SFEIVCAPIVKKELIIS--MGVVHDGVAENCVDYFQRF--RRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQR---MDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMD--CVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVEL---ISPYLEME-----DYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQN-GIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFD-LSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKM 11918
            I++P +D ++ + +   + + ++ ++L G  G+ KT+++N  L  +N   +    +NFS  T        +    ++V    G T  P +  + + +F D+IN+P ++++G Q     +RQL+E +GF+   +   +  I  +  + A   P   GR  + +R  R   I     PS  S+ +I+ I    +Y        E R   +     +  L+   K +   T  + HY+F+ R+L+R+ +G+   INT        ++L+ LW +E  R+ +DR V V++ + F + L   + + L ++D+  +S + +  +    +DF         +E + TD         + +F  +++R K F    +E +    + MV     + H+L+I R ++  +G+ +L+G   +GK  LT+  +++ G KI Q  + R  N+S+    LK        +      +  +  I +  FLE MN +L++  + +LF  +E D++   L     +       T   L ++F+    +NLHVV           +  +  P L + C ++W   W    +  VA + +      F     P V KEL+ +  +  + D V    + + + F  + +  V P+S   F+ G +++ K     Y +L +    ++ GL+KL E+   V EL + L++K  EL    +EA   L  + +++N +   +   + +K   +   E+I + K++    ++  EP + EA+  +  IK   +  +R +  PP  +  +M+  C ++ +Q                 +W +  + +  + F++N++++      + T+ +   I  Y+E E     ++T +   R       L  W  A ++F ++ + V PL+  + + +    K+  +L AA+ +  + +  +   +  Y   +R  + +  +    +  +  +  L++ L  EK RW N + +F      L+G+ + ++ + +Y G  N+  R  +    ++ L    + +  +   ID L       +W   GL  ++  ++N  I++      P L+DP       I N    K + ++ L   + ++ LE+++  G  ++I+D GE  DP +  ++ + F   G+   V++GD EVDV   F+L+I +  P+      + +R  ++ F    + +E ++  + +  E  E++ +R  L++     K K+K LE  LL  L +++G+++++++L+  L   K  +  + +KL  + +   + ++  EEY  +      ++ ++ +    +  Y  S+ QFL  F  + + +S+++   + R+  I+  +  EV+      L   DK  F ++MA+ M
Sbjct: 2390 IVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNAL--RNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPE-NKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEI----YYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPR--QTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDF---------KEVNKTD---------LVNF--IEERFKTF---CDEELE---VPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRN-KTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQF---------------SNWRDIQQFIRKDDFIHNIVHY------DTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKR-LENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTAL---DK-KFKMIMAMTM 3702          

HSP 3 Score: 71.2478 bits (173), Expect = 4.353e-12
Identity = 54/230 (23.48%), Postives = 105/230 (45.65%), Query Frame = 3
Query: 12369 DPTPTIEMLAKKHKVECRAISMGQGQEI-HSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNV---NALYRLWMTSE-QHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMF-YSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYF 13040
            D T  +  LAK  K   + I +G  + + +++  ++   + GGW+LLQN  + + ++        E T     +  ++++MT     D+ P   LQ   +F  E   GI   ++  +      +    +   W V   + L++ H  +  R +  P G++  Y FN  DF   +++++N L       ++ T+ I W  VR  I+ I YGG++ ++ DL ++  +    F
Sbjct: 3795 DGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWG---SQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVL------ATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVF 4015          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 5944.77 bits (15421), Expect = 0.000e+0
Identity = 2935/4657 (63.02%), Postives = 3622/4657 (77.78%), Query Frame = 3
Query:  216 LDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRV-MKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVING-SNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDL--GIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVIST----QEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXX------XXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAA--------PTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNV-SNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            +D RH +L+  VA    L   ++ E++LDGNQIE M+ FF  D    + F++QE +   E  + +R+G  G +++ +  KPKVF+T GK+  L G CV F+R +   QIN   I ++ +F V++   +G+L  +E  +  V +P        WG+L   + S  R   MN LE+FV +L++A+ S+ + V LK C  +DL  I  P D +   +++E L ++E  V  W+KQIEQVLAES+Q+R+EAD++GP+AELD+WKKRMAKFN LLDQ+K  + KA +G+L AAKSK LKTW E+D RITD ANEAKDNVKFLYTLE+ C PLY ++P  M+D IP LI+++RMI+S S+YYNTSE+MT+LFVK+TNQMIT+CK YI+    + VW     EL+++L  C  LN+ YQ CFQ+TK RL   P ERQFE SEMYIFGK +TF RRL+ II++   ++ +  L ++ IEGLE M  K  +I++T+KKK Y+ LD R+ EF  DF++F RQI EL   + NFMD  F+ I ST RA++ +R+FE L +  L   I+EKY +IL ++GRD+E + K Y R+K DPPVARD+P IAGKIAWARQ++RRIQ PM MF+ ++ ++L+T +A+ IIKNYNKL++ L+ FE++YHQAWV+Q+    +GL +SL++RHP+ K+L+VNFDP I+ L RET+ M++L L+IP +A  L  KQ++LK+  + L L++N  ++V   IPQ +  LM   +AK+   I+PGLT  NWTS+ L  Y+DSVY  L ELELL+DRA DL  +RID VLEEMS++ LCELP D P T+++F+  T+ LC + A LL++KS  VE++ NELI ML   E + E  E  ++         +++R      P   S  P  + +  G +         K         +E A ELL +FNHRN++AIV+V R TL+S R+RIAA        P       +  S   P F+ N  LQIPN+ M P ++E+Q  +N+ A  ++SVSKG+SQW +           AL+  EK +D +     +E+  +R  SNV S+ +S SE      + R P            D+     ++    Q  N +KNV+ENKEVAK+ S+LST +NS +KEV TA+  F+ YS +W   +D T+  FL++DPK+SEF+  I  Y  +E  I  E + Y  G IAL TE LK  L +ETKAW I + + CN KY+ EME+IFTF ED+ KRLSR IKDLDDIR+AM ALKEIR  EI+IDM I PIEESY ML RY++P+ ++E+ERVDTLRY+W+KL S  ++ QD+LI IQ  F+  LI+ VQ F  D   F  DY+++GPMVP +PPREASDRLII QNR+D L R++ITYSGGEELFGL VT+Y +L  IK+ELNLLQKLY LYNDVI++VNGYYDILW DV+IEKI+ EL +FQNRCRKLP+ LKDW AF DL+KTIDDFN   PLLELM N AMK RHW R+++LT H FD+ESD F+LRNI+EAPLLK KE+IED+CI+AVKEKDIEAK+K V A+WS  +L F  FKNRGELLLRGD+TSEI+S+MEDSLM+L SL+SNRYN PFKK+IQ  V KLSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRF NIDK W+KIM+RAHEN NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ I+A  S EGE +E+ KPV A+ NVEIWL  LL M+++SLH VIR A  +IND+ FN+LEFLN +PAQVGLLGIQ++WTRD+TEAL NAK D+K+MQQTN  F  LLN+LI+QTT +L +V RTKFETLITIHVHQ+DIFD L +  +++PSDF+WLKQ RFYF +D D C V+ITDV FIYQNEFLGCTERLVITPLTDRCYITLAQAL MSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI ++L+ KKERKKQF+F+DGD+VDMNPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLASCGFIDNI L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E TTVMRVLRDMNLSKL+D+DEPLF+SLINDLFPGI LDK GYPELE AI  + +E  +I+HPPW LKLIQLFETQRVRHGMM LGPSGAGKT CIHVLMKA+TDCG PH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGE IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CKI+FE HNIDNASPATVSRNGMVYMSSS LDW P+++ W+ KR   E  I+   F  S+ ++  +  + L+ KM+ L+   + Q   LL+GLIP+KD  D  Q S  H E LY+FS+MWSIGALLE++DR K+E ++R N    LDLP++ ++  + +F++MV++ GEW HWN++VEEY+YPKD  P++ SILVPNVDNV  D+L+ TV+ Q KA LLIGEQGTAKTVMI  Y+S  +PE H+ KS NFSSA+ P +FQRTIESFVDKRMGSTYGPPAG+KMTVF+DDINMP+INEWGDQ+ NEIVRQL+E KGFYNLEKPGDFTNI D+QF++AMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIFS+IG G++CKERGF ++V+     L+P TR+LW LTK KMLPTPAKFHY+FNLRDLSRIWQG++NT  +VI + + L+ LWKHEC RV+SDRF   +D  WF KT+KR + ++L ED      + +  A+F+DF+RDA EATG+EP+D DF+ PK+YEPI SFD L++RL M+  LYN+SIRGAGMD+VFF DAM HL+++SRIIRTPRGNALLVGVGGSGKQ+LT+L+S+IAGYK FQITLTRSYN SNL+EDLK+LYRTAGQ G+GITF+FTD EIKDEGFLEY+NNVLSSG VSNLFARDE+DEIC ELIP+MKKE+PRRPPT +NL EYFL+R K NLHVVLCFSP+GEKFRNR+LKFPGLISGCTMDWF RWPKDALIAVA H+LSSF+IVC   +K +++ SMGV+HDGVA  C DYFQRFRR THVTPKSYLSF+ GYKSIY EK      LAQRM +GL KL+EA +SVA+L + LA KEKELA+A+ +A++VLK V+++  AA +VK +VQ VKDKAQ+IV+EI  DK +AE KLE A+PAL EAE AL TIKPA I+TVRKL +PPHLIMRIMDCVL+   +++D +  DPERN  KPSW ES+KLMS + FLNNL+NF KD+IN+ETVEL++ YLE +DY ++ A+RVCG+VAGL SWTRAM +FF INKEVLPLK NL  Q+ R   +  DLN AQ+ LDEKQ EL + QA+Y+ A+++KQ LLDDAE CRRKM AA+ LI GL GEK RWT QS EF  QI RLVGDVL  T FLSY GPFNQEFR +L ++WQKE+++RKIPF+++LN+  M+ D   +GEW+LQGLPNDELSVQNGIIVTKA+R+PLL+DPQGQGK WIKNRE   E+Q+TSLNHKYFR HLED+LSLGRPLLIED+GEELDPALDNVLEKNFIK GST KVKVGDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVT+KGLEDQLLGLVI TEK ELE++R +L+EDV  NK+KMKELEDNLL+RLTST+GSLVDDE LI+VL  TK T+ EVSQKL++A+DTEIKIN AREE+RPVATRGSILYFLIVEMS VN MYQTSL+QFLGLF  SM RS  SP+T KRI NII+ +T+EVW+Y+ RGL+E+ K  FTLL+A K+D++  +IK  EF T IKGGASLD+    PK   WITDMTWLNLVELS L QFS +L+Q+SRNEKQW+ WFDK+APEE  IPDGY  +LDTFR+LLL+R WCPDRT+SQA+KYI +S+G ++ E  IL+ +K +EES  RTP++  LSMGSDPT  IE LAKKHK +CRAISMGQGQE+H+R+L+ +F+ TGGW LLQNCHL ++++ EL   + ES +++  +RLWMT+E+H QFPI  LQ++IKFTNEPP+G+RA L+R++  ++QD LD   +  W+ M YS+AFLH TVQERRK+GPLGWNIPYEFNQADF A   F+QNHLD +  KK     G+ W  VRYM+ E+QYGGRVTDDFD RLL    K +F E MF P F       I    +V ++  +I  L   D+P  FGLH NADI+Y +   K  L+TILSIQPKDS  G GETRESIV+K   +ML+K+P ++I  +V  ++ KMG   PMNIFLRQEIDR+ +VI  VR+TLTDLKLAIDG ++M++ LRD+LDC++DA+IP  W+K+SWES+T+GFWF ELI+RN QF  W  DGRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N VTRF+ +++  PP EGVY++GLFL+GA WD+R  +L+E   K+L+  +PVI+I+A+          D ++Y  PIYKKPRRT+LTYIA  +L  +++ +HWI+RGVA+LCDIK
Sbjct:    2 IDFRHDHLISTVASALGLAQDDLTEAMLDGNQIETMENFFKPDGLQKIMFYYQETDNIPEAVEHVRLGPGGAQRTTIKTKPKVFVTDGKDNQLSGACVFFIRINPSKQINTANIYQETSFGVLDTRGDGMLNAVERVLGDVFIPALGK-NSSWGELSDKQGSSVRHEFMNQLESFVAILASAQASLEDAVTLKECDTVDLSNINTPTDFIAAASSSETLEQIEAVVSAWIKQIEQVLAESEQMRKEADDVGPKAELDHWKKRMAKFNSLLDQIKGSDCKAVVGVLHAAKSKLLKTWRELDIRITDYANEAKDNVKFLYTLEKFCDPLYNSDPVGMMDGIPGLINAIRMINSYSRYYNTSERMTALFVKVTNQMITACKNYITEHGYKNVWEYTHSELIEKLGNCIRLNEEYQRCFQKTKQRLEQNPDERQFEFSEMYIFGKINTFSRRLNKIIEMMNTMQKFMTLGESRIEGLEQMWNKVQLIMTTMKKKPYDLLDYRKMEFDADFEEFKRQISELQAQLQNFMDICFEKIPSTQRALRLIRKFESLGLDSLRDTIQEKYERILIYFGRDIETIQKIYQRHKTDPPVARDLPPIAGKIAWARQMYRRIQEPMIMFQ-KYPSILQTSDARKIIKNYNKLSKVLLEFELLYHQAWVKQVEVIKSGLQASLLVRHPDNKKLFVNFDPQIMTLIRETECMVRLGLDIPFSAHALLQKQSSLKKNSDTLQLLLNERERVLGKIPQTFRPLMAPHLAKVEAAIDPGLTMLNWTSLNLDTYVDSVYESLGELELLIDRANDLVAFRIDAVLEEMSSVPLCELPTDTPKTIEQFLKTTEGLCKRGADLLETKSARVEEAANELITMLLELENEEEAKEDEKDKDEEKTGEEEKDRSRSPTRPHTGSSRPGSRASRLGSAAISPAAAAAKRKREMRDYLAEEAQELLSYFNHRNVDAIVRVTRATLDSTRRRIAASAAHHFVKPRSNVEGENSSSFVPPLFKANVTLQIPNVTMQPALDEIQQGLNKAAQCVVSVSKGVSQWDR--------TCRALRKAEKRDDSD-----NEDSRSRSASNVGSDDESRSEAAPTRRSARMP-----------TDDASTVVSMPIFPQKMNYFKNVSENKEVAKLLSMLSTVVNSQKKEVITALELFNKYSSVWQGDRDHTISAFLQNDPKLSEFEAQILHYKEMEQTIVQEPESYSVGSIALMTEKLKSSLCAETKAWCISFSRYCNQKYRMEMEEIFTFVEDMTKRLSRPIKDLDDIRLAMNALKEIRSQEIKIDMNIGPIEESYQMLARYDMPIAREESERVDTLRYSWEKLQSLATESQDHLIGIQSNFKGGLIDEVQTFILDVGSFAGDYNSTGPMVPNVPPREASDRLIIFQNRFDTLWRKYITYSGGEELFGLPVTEYPELMQIKRELNLLQKLYGLYNDVIDTVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFKNRGELLLRGDNTSEIVSLMEDSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKDYDRIMAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAFQELLNVLIEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAWINKRPIPEGEILNGFFEKSYEELLTFLRESLVSKMDILDHNYIIQTLTLLDGLIPKKD--DGGQFSSQHLEHLYVFSLMWSIGALLELDDRAKMETFMREN--FDLDLPQVSEN--ENIFEFMVNDAGEWAHWNTRVEEYVYPKDHVPDFLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGYFCKERGFINDVQDFALKLVPCTRKLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDY---QPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVSIKAQAAEKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLMSNWQKEMKSRKIPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELSKLSQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKYDCRAISMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEFMLELIDTVVESEHIHEDFRLWMTTEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDVSNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHLDDMDIKK-----GVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNFYKGYVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGGGETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWESSTIGFWFTELIERNAQFRTWCFDGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAI----NSTGGRDNRLYQCPIYKKPRRTDLTYIACVDLKTNQNPDHWILRGVALLCDIK 4614          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO32004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB3])

HSP 1 Score: 4335.02 bits (11242), Expect = 0.000e+0
Identity = 2133/3278 (65.07%), Postives = 2611/3278 (79.65%), Query Frame = 3
Query: 2973 ELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAK-PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQIN--AESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQ 12797
            EL+L+FN R  +A+++  RN L+ +++R A    V+  ++V+S  K PFF+    L IP +++ P++E++Q  +N+ A  ++ VS+ + QW ++R                DE D  G                                K  +R   SN + A             ++KN YK ++E+K+V K+  +L++ I+ST+ EV   + +FS Y  +W   K++ ++ F+  DP +S+F   I +Y TLE +I     S     G I L++E LKI L  E + W++ +G + N KY+  M++I  F  D  KRL R I+DL+D+R AM AL+++R+NEIRIDMT+ P+EE+YAML ++E+ V ++E ERVDTLRY+++KL+++   +Q +L+ IQP+F+++L+ +V+I++ +   F  +Y+  GPMV G+ P+EAS+RL + Q+R+D+L R+F+TYSGGE+LFGL VT+Y  L  IKKEL LLQKLY LYN VI+ VNGYYDILW +VDIEKI+NEL +FQNRCRKLPK LK+W AF +L+K IDDFN   PLLELM N AMK RHW+R+++LT H FDVE++ F LRNI+EAPLLK KE+IEDICISAVKEKDIEAKL  V A+W + E  F +FKNRGELLL+G  T+EI+S++EDSLM+L SLLSNRYN PFKKDIQ  V KLSN+S+IIE WM VQNLWVYLEAVFVGGDIAKQLPKEAKRF NIDKSW+KIM+RAHE +NV+ CCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDN+KTV FHEK Y+ IL+  S EGE + LE  V A+ NVEIWL  LLN A  SLHGVIR A ++IND  F ++ F+N +PAQVGLLGIQ++WTRD+ EAL +A+ D+KIM  TN++FL LLN LI  TT +L K+ERTKFETL+TIHVHQ+DIFD LVK  ++S +DF+WLKQ+RFYF ED+D CIVSITDVDF YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ KK+RK QF+F+DGD+VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGFI+N++LA+KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+P D+E TTVMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELEAAI +  ++A +I HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI+VLMKA+ +CG+PHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGE+IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CK++FE HNIDNASPATVSRNGMVYMSSS +DW P+LK WL  R   E  +  +LF   F +++ Y  Q L  KM+ LE  V+ Q  D+L+GLIP K+E     +S  H  RL++F++MW +GALLE+EDR K+E ++  +   KLDLPK+ + S +T+F+++V   GEW HWN++VEE++YP DS P+Y SILVPNVDNVRT+FL++T+A Q KAVLLIGEQGTAKTVMI  Y+S+ NPE HM KS NFSSAT P +FQRTIES+VDKR+G+TYGPPAGRKMT FIDDINMP+INEWGDQI NEIVRQL+E+KGFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIP+RLKRQF IFNCTLPSN+SIDKIF +IG G +C ER FN EV  +++ L+  TR LW  TK KMLPTPAKFHY+FNLRDLSRIW+GM+N  GD I + K  L LWKHE  RVI+DRF    D  WF K + + L + + +D   +      + +F+DF+RDA E TGEEP+D D D PK+YE + S + L ++L M+  +YN+++RG  +D+VFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYK+FQITLTRSYN +NL++DLK+LYR AG  G+GITF+FTD EIKDE FLE++NNVLSSG VSNLFARDE+DEI Q LI +MKKE PR PPT DNL  YF+SR ++NLHVVLCFSP+GEKFRNR+LKFPGLISGCTMDWF RWPKDALIAVA ++LS FEIVC+  +K++++ +MGVVHD VAE C++YF RFRRQTHVTPKSYLSFL GYK+IY E   H   LA RM +GL KL+EA  SV +L + L  KEK+LA+A+ +A++VL  VTV   AA +VK  VQ VKDKAQ IV+EI  DK +AE KL AA+PAL EAE AL TIK ADI+TVRKL +PPHLIMRIMDCVL+ F+R +  +  D +R  P PSWGE+ KLMS++ FL  L+NF KDTINEETVEL+ PYLEMEDY ++ A++VCGNVAGL SWT+AM  F+ +NKEVLPLK NL  Q+ R + +M DLN AQ  LDEKQ EL KVQA+YD A+ +KQTLLDDAE+C+ KM AA+ LI GL GEK RWT QS EF+AQI RLVGDVL AT FLSY GPFNQ FR +L+  WQ+EL   KIPF+ +LN+  ML DP  +GEW+LQGLP D+LS+QNGIIV KA+RYPLLIDPQ QGK W+ NRE   +LQVTSLNHKYFR HLEDSLSLGRP+LIED+GEELDPALDNVLEKNFIK GST+KVKVGDKE DVM GF +YITTKL NP+YTPEI ART+IIDFTVTMKGLE+QLLG VI TEK+ELEA+R++LMEDV  NK+KMKELEDNLL+RLTSTKGSLV+DE L+ VLK TK T+ EVS+KL IA++TE KIN AREE+RPVATRGSILYFLIVEMS+VNIMYQTSLRQFLG+FD+SM+RS+KSP+  KRIQNIIE +TYEV+KY+ RGLYE+ K  FTLL+ALK++++ GK+K +EF T IKGGA+LD+     KP  WITDMTWLNLVELS L QFS +LDQV RN+  WR WFDK+APEE  IPDGY T+LDTFR+LLLVR WCPDRTL QA+KYI D++GE++AEG IL+ +  +EES  +TP++  LSMGSDPT +IE LAK+  +ECRA+SMGQGQE+H+RRL+     TGGWVLLQNCHL +++++EL + +  + N +  +R W+T E H QFPI+ LQ +IKFTNEPP+G++  L+R++A +TQD LD   +  WK + Y++AFLH  VQ
Sbjct:  259 ELILYFNQRTFDALLRATRNALDGIKRRRA--FYVSNALAVESYTKGPFFKAEITLAIPQVIIQPSLEDIQQALNKAAQRVLEVSRSVGQWGQKRFRTLGFY---------DEPDPRGTF---------------------------QHTKKTERAATSNEELAPS-----------KLKNYYKAISEHKDVTKLLMILTSSISSTKAEVMGCLDQFSQYHFVWEGDKESVVKVFVASDPLLSDFKTEILKYQTLEQEIENIPASFRVGHGAIELYSEPLKIALTVEIRGWKLLFGHSINNKYRVCMDEISQFLGDYSKRLGRPIQDLEDVRGAMAALEDVRQNEIRIDMTLGPVEEAYAMLNKFEVAVAREEVERVDTLRYSFEKLLAQARDIQSHLVKIQPKFKADLLGSVEIYQHNVVDFTSNYEEIGPMVGGITPQEASERLSVFQSRFDDLWRKFVTYSGGEQLFGLEVTEYPDLVRIKKELGLLQKLYGLYNAVIDGVNGYYDILWTEVDIEKINNELLDFQNRCRKLPKALKEWDAFNELKKKIDDFNECCPLLELMANKAMKERHWERLANLTGHKFDVENENFLLRNIMEAPLLKHKEDIEDICISAVKEKDIEAKLSQVVADWKSQEFSFASFKNRGELLLKGGETTEIVSLLEDSLMVLGSLLSNRYNAPFKKDIQSWVQKLSNTSDIIENWMVVQNLWVYLEAVFVGGDIAKQLPKEAKRFGNIDKSWVKIMTRAHETSNVVTCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNVKTVDFHEKDYDRILSIVSSEGETVPLETAVMAKGNVEIWLGDLLNQAMSSLHGVIRDAFHAINDPAFALMSFMNTFPAQVGLLGIQMIWTRDAEEALKHARHDKKIMASTNQKFLNLLNSLIDVTTQELTKMERTKFETLVTIHVHQRDIFDDLVKMHIRSVTDFEWLKQSRFYFKEDIDDCIVSITDVDFSYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTAKKDRKTQFIFSDGDVVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFIENVILAQKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPQDSESTTVMRVLRDMNLSKLVDEDEPLFLSLINDLFPGITLDKAGYPELEAAIQKNTEDAGLIFHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTACINVLMKAMGECGQPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGENIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKVVFEPHNIDNASPATVSRNGMVYMSSSVMDWKPILKAWLNSREPQEHDVFEQLFDCVFDELHTYMKQSLHPKMDVLECNVIAQCLDILQGLIPSKEEH--GILSASHLSRLFVFALMWGVGALLELEDRAKMEEFLVDHG--KLDLPKLAEGSHETIFEFVVDSKGEWEHWNNRVEEWVYPTDSKPDYASILVPNVDNVRTNFLVDTIAKQSKAVLLIGEQGTAKTVMIKGYMSTYNPELHMTKSSNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGRKMTAFIDDINMPIINEWGDQITNEIVRQLMEMKGFYNLEKPGEFTHIVDIQFLAAMIHPGGGRNDIPERLKRQFSIFNCTLPSNTSIDKIFGVIGCGWFCPER-FNSEVSDIIKQLVVCTRILWQQTKIKMLPTPAKFHYIFNLRDLSRIWEGMLNVTGDEIDSRKLALALWKHEVTRVIADRFTNEVDREWFEKQITKSLVDTVGDDAAGE---LMAEPFFVDFLRDAPEVTGEEPEDADLDAPKIYELVPSLEFLNEKLGMYMMMYNDTVRGGHLDLVFFKDAMIHLVKVSRIIRTPCGNALLVGVGGSGKQSLTRLASFIAGYKMFQITLTRSYNATNLMDDLKYLYRVAGSDGQGITFIFTDNEIKDEAFLEFLNNVLSSGEVSNLFARDELDEITQNLISVMKKELPRVPPTQDNLYNYFISRARKNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFTRWPKDALIAVADYFLSKFEIVCSAEIKQKVVQTMGVVHDMVAEACIEYFDRFRRQTHVTPKSYLSFLDGYKTIYAENKGHIGELANRMKTGLDKLVEATMSVNQLSKELVVKEKDLAVASVKADKVLAEVTVSAQAAEKVKASVQKVKDKAQIIVDEINADKVVAEGKLAAAKPALEEAEAALQTIKAADISTVRKLAKPPHLIMRIMDCVLLLFRRSISNVVPDFDRGCPTPSWGEAQKLMSSSGFLQALMNFQKDTINEETVELLQPYLEMEDYNLETAKKVCGNVAGLCSWTQAMSFFYGVNKEVLPLKANLIVQEARLKVAMGDLNKAQGQLDEKQAELDKVQAMYDAAVGEKQTLLDDAESCKNKMVAASALINGLGGEKERWTQQSKEFQAQIGRLVGDVLLATGFLSYSGPFNQTFRTLLSARWQQELEANKIPFTENLNLTSMLADPATIGEWNLQGLPTDDLSIQNGIIVNKATRYPLLIDPQTQGKAWLLNREKANDLQVTSLNHKYFRNHLEDSLSLGRPMLIEDVGEELDPALDNVLEKNFIKSGSTYKVKVGDKECDVMSGFTMYITTKLGNPAYTPEISARTAIIDFTVTMKGLEEQLLGRVINTEKEELEAERVKLMEDVTSNKRKMKELEDNLLYRLTSTKGSLVEDESLVAVLKITKETAEEVSEKLAIAAETETKINLAREEFRPVATRGSILYFLIVEMSMVNIMYQTSLRQFLGVFDMSMARSEKSPIPAKRIQNIIEFLTYEVFKYSCRGLYENHKFLFTLLLALKIEIQDGKVKNQEFQTLIKGGAALDLKACPAKPFKWITDMTWLNLVELSKLPQFSGILDQVRRNDSGWRGWFDKDAPEEHPIPDGYQTSLDTFRKLLLVRSWCPDRTLPQARKYIADAMGERYAEGVILNLEATWEESDTKTPLICFLSMGSDPTGSIESLAKRKGIECRAVSMGQGQEVHARRLIQQSCATGGWVLLQNCHLGLNFMDELLETVTNTENAHETFRTWITCEAHPQFPISLLQSSIKFTNEPPQGVKPGLKRTYAGITQDQLDITNMPQWKPILYAVAFLHTVVQ 3479          

HSP 2 Score: 172.17 bits (435), Expect = 4.041e-42
Identity = 84/197 (42.64%), Postives = 129/197 (65.48%), Query Frame = 3
Query: 2184 GLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            GL +SL++RHP++ ELYVNFDP +  L RET+ MMK+ L++P  A  L M ++ LK+  +KL LM+  +  V  +IP  ++ LM   + ++   I PG+T  NW S+ ++ Y  +VY  L EL+LL+    D+R  RID VL+E+S I LCE+P+D P T DEF+  TQ++C +   +L  KS  VE++V+EL+++ 
Sbjct:    6 GLQASLLVRHPDSGELYVNFDPQLYQLIRETECMMKMNLQVPNNAKLLYMNRHQLKKTSSKLKLMLEEVVSVKANIPNIFQPLMAPHIERVDAAISPGITMLNWNSLNIENYCKNVYTRLRELDLLIKTVNDIRDSRIDSVLKEISEITLCEVPDDQPWTTDEFITKTQKICNRVGGILDKKSLQVEEAVHELVDIF 202          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO42024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L5])

HSP 1 Score: 3954.06 bits (10253), Expect = 0.000e+0
Identity = 1952/2866 (68.11%), Postives = 2349/2866 (81.96%), Query Frame = 3
Query: 3501 QMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGE-EPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQV 12095
            Q K+ +K V+E+K+V KV  +L++ I++ + + +  +     +  LW +  +  + EF++  P +S+FD  IK Y  LE QI     +Y  G +   TE LK  +++ETKAW+  +GKA   K  A+ME+IFTF ++L KRL+R I DLDD+R +M AL EIRE+EI+IDMTI PIEES+AM+ RY L     + ERVD L Y W+K+ ++   V  +L+ IQPEF+++L++ V  FK     F EDY   GPMVPG+PPREASDRL I Q R+D L R++ TYSGGEELFGL VT+Y  ++ I++EL LLQKLY+LYN VI++VNGYYDILW ++DIEKI+ EL +FQNR RKLPKGLK+W AF +L+KTIDDF+   PLLE+M N AMK RHW R+S +     DVES+ F LR ++ APLL  KEEIEDICI+AVKEKDIE+KLK V  EWSA    F  FKNRGELLL+G  TS+I+S+MEDSLM+L SLLSNRYN PFK +IQ  V+KL+ S+EIIE W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRFS IDKSW+KIM RAHEN NV+QCCVGD+TL QLLPHLLEQLEICQKSL+GYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL VFDN+KTV F EK+Y+ ILA  S E E + LEKPV A+ NVE+WL  LL  A  SLH VIR A+  I D  F ++EFL+ YPAQVGLLG+Q++WTRD+ +AL +A+SD+KIM Q N+ FL +LN LI+ TT +L KVER KFET ITIHVHQ+DIFD LV+  +K+PSDF+WLKQ+RFY+ E+ D+C+VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGM+MGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERKKQF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLA+CGFI NIVL+ KF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KRANP D+E   VMRVLRDMNLSKLVD+DEPLF+SLI+DLFPG+QLDK GYP++E AI + ++EA +I+HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI++LMKA+T CG PH+E RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKG+HIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP+CK++FE HNIDNASPATVSRNGMVYMSSSALDW P+L+ WL  R+S E  I+  LF   F D+  +    ++ +ME LE   + QA +LL GLIP +D    +  S  H E+L+IFS+MWSIGALLE+ DR K++  + +  ++K   P +    +DT+F+Y+V++ G+W HW+ +VE Y YP DS PEY  ILVPNVDNVRTDFL+N +A QEKAVLLIGEQGTAKTVM   Y    +PE H+FK++NFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMT FIDDINMP+INEWGDQI NEIVRQL+E+KGFY+L+KPG+FT+IVD+QF++AMI PGGGRNDIP RLKRQF +FNCTLPSN+SIDK+FS IG G++ K RGF  EV  ++  L+  TR+LW  TK KMLPTPAKFHY+FNLRDLSRIWQGM+    +++   K LL LWKHEC RVI+DRF    D  WF K+L   + ED   ++   S + + + +F+DF+RDA E TG+  P+D +F+ PKVYEP+ +F+ L +RL  F  +YNE++RG  MD+VFF DAMTHL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLTRSYN+SNL++DLK LY+TAG +GKGITF+FTD EIKDE FLEYMNNVL+SG VSNLFARDE+DE+  +LI +MK EYPRRPPTN+NL +YF++R K NLHVVLCFSP+GEKFRNR+LKFPGLISGCTMDWF RWPKDALIAVA ++LSSF++ C P VK+ ++ +MG+ HD VAE C  YF+RFRRQTHVTPKSYLSF++GYK IY ++      LA RM++GL KL+EA ESVA+L E L  KEKELA+A+R+A+ VL+ VTV   AA +VK++VQ VKDKAQ+IV+EI  DK+IAE KLEAA+PAL EAE AL TIKPA I+TVRKL +PPHLIMRIMDCVL+ F +++D +  DP+R   KPSWGES+K+MS   FL  L+NFPKDTINEETVEL++PYLEMEDYT++ A++VCG+VAGL SWTRAM  F+ INKEVLPLK NL  Q+ R  K+  +LN AQ+ LDEKQKEL  VQA YD+A+R KQTL+DDAE CRRKM  A  LI+GL GEK+RWT QS +F  QI RLVGDVL AT FLSY GPFNQEFRN+L ++W+K++R  KIPFS  +N+ +MLTD   +GEW+LQGLPNDELS+QNGIIVTKASRYPLLIDPQGQGK WI+ +E   ELQ+TSLNHKYFR H+ED+LSLGRPL+IED+GEELDPALDN+LEKNFIK G T+KVKVGDKEVDVM GF LYITTKL NPSYTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELEA+R +LME+V  NK++MK+LEDNLL+RLTST+GSLV+DE LI+VL +TK TS EVS+KLI+A++TE+KIN+AREEYRPVA RGSILYFLIVEMS VN+MYQTSL+QFLG+FD+SM+RSQKSP+  KRIQNII+ +T+EV++Y  RG YE  K  FTLL+ LK+D++  KIK EEF   IKGGA+LD+N V+PKPK WI D+TWLNLVELS L QF+++L QV
Sbjct: 1062 QAKSLFKIVSEHKDVVKVVIVLNSIISTFKADAKDLLSEMDQFKELWNEDPNTKVHEFMESKPLLSDFDAQIKYYQHLETQIEDLPSFYRIGSVIYLTERLKEAVVTETKAWKQSFGKALAEKASADMEEIFTFIDNLNKRLARPITDLDDVRGSMAALGEIRESEIKIDMTIGPIEESFAMMNRYGLHFSSSDAERVDGLTYAWKKVNTQAGVVAAHLLKIQPEFKADLLDGVTKFKVLVQNFVEDYTEKGPMVPGIPPREASDRLAIFQARFDELWRKYETYSGGEELFGLEVTEYPDVQRIRRELGLLQKLYNLYNSVIDNVNGYYDILWQEIDIEKINQELLDFQNRIRKLPKGLKEWQAFLELKKTIDDFSECCPLLEMMANKAMKERHWGRISQMVGVTLDVESETFQLRQLMSAPLLPNKEEIEDICIAAVKEKDIESKLKGVIGEWSAQSFSFAGFKNRGELLLKGSDTSDIVSLMEDSLMVLGSLLSNRYNAPFKAEIQKWVAKLTGSTEIIENWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFSQIDKSWVKIMQRAHENANVVQCCVGDDTLGQLLPHLLEQLEICQKSLSGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLGVFDNVKTVTFDEKEYDKILAINSRENEQIMLEKPVVAQGNVELWLFALLKEAMNSLHAVIRMASVGIKDPSFKLIEFLDAYPAQVGLLGLQMIWTRDAEDALSSARSDKKIMAQRNQYFLDMLNELIEVTTRELTKVERIKFETFITIHVHQRDIFDDLVRKNIKTPSDFEWLKQSRFYWREETDQCLVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMAMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKKQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKLAACGFIRNIVLSAKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRANPEDSEDRIVMRVLRDMNLSKLVDEDEPLFLSLIDDLFPGLQLDKAGYPDIEQAIAQCVEEAKLINHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTKCINILMKAMTICGAPHKEFRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGDHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPTCKVVFEPHNIDNASPATVSRNGMVYMSSSALDWKPILQSWLKTRSSTESEILFNLFEQLFDDVQNFLTVSVVPRMELLECNYIVQASNLLNGLIPGEDAPKQADAS--HLEKLFIFSIMWSIGALLELSDRKKVKFMMETFPDLKW--PPV--SGQDTIFEYVVNDQGDWQHWSERVEAYDYPTDSVPEYSGILVPNVDNVRTDFLINCIAKQEKAVLLIGEQGTAKTVMTKGYCERYDPELHVFKAMNFSSATTPNMFQRTIESYVDKRMGTTYGPPAGKKMTSFIDDINMPIINEWGDQITNEIVRQLMEMKGFYSLDKPGEFTSIVDIQFISAMIQPGGGRNDIPSRLKRQFTVFNCTLPSNASIDKVFSTIGCGYFHKARGFPVEVVNMISPLVASTRKLWQKTKVKMLPTPAKFHYIFNLRDLSRIWQGMLVVTSEILKTPKVLLNLWKHECHRVIADRFTNQPDRDWFEKSLMAVVEEDFGAEV---SAMIDPEPYFVDFLRDAPEPTGKSHPEDAEFEAPKVYEPVETFESLNERLDSFVEMYNETVRGGRMDLVFFKDAMTHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSYNVSNLMDDLKVLYKTAGHEGKGITFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEMTNDLISVMKAEYPRRPPTNENLYDYFITRVKNNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVASYFLSSFDVKCKPEVKEAMVNTMGIFHDTVAEFCTQYFERFRRQTHVTPKSYLSFISGYKQIYSQQHSDIDLLATRMNTGLAKLVEATESVAKLSEELVIKEKELAVASRKADVVLQEVTVSATAAEKVKSQVQKVKDKAQAIVDEIAEDKQIAEGKLEAAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLFMKKIDPVQQDPDRPCVKPSWGESLKVMSQGGFLTTLLNFPKDTINEETVELLAPYLEMEDYTMENAKKVCGDVAGLASWTRAMAIFYGINKEVLPLKANLVIQEARLNKATTELNVAQAQLDEKQKELDAVQAKYDQAMRDKQTLVDDAEACRRKMANATALIDGLGGEKIRWTEQSKKFDQQIQRLVGDVLLATGFLSYSGPFNQEFRNLLQSTWKKDMRKAKIPFSEDINLTNMLTDAATIGEWNLQGLPNDELSIQNGIIVTKASRYPLLIDPQGQGKAWIRTKEQPNELQITSLNHKYFRNHMEDALSLGRPLIIEDVGEELDPALDNILEKNFIKSGKTYKVKVGDKEVDVMDGFRLYITTKLGNPSYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEAERTKLMEEVTANKRRMKDLEDNLLYRLTSTQGSLVEDESLIEVLSSTKATSEEVSEKLIVAAETELKINTAREEYRPVANRGSILYFLIVEMSYVNVMYQTSLKQFLGVFDISMARSQKSPIPAKRIQNIIDYLTFEVFRYTTRGFYEEHKFLFTLLLTLKIDLQEKKIKHEEFQVLIKGGAALDLNAVEPKPKKWILDLTWLNLVELSKLPQFTSILGQV 3918          

HSP 2 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 400/1041 (38.42%), Postives = 639/1041 (61.38%), Query Frame = 3
Query:  162 LTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDL----KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS------VKSSAKPF---FRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQW 3242
            + E+Q + K E+  ++S +D RH Y+  +++D   ++   VE+ IL  ++   +D+FF++D    L F++QE  L        R+ L+   Q+     K+FI+ G    L G C+VFMR S    I    IA++V+F+  + S G +L+G E+ +  +M+P  +  +  WG++       +  + SLE FV +L+ AR +++ RV L    + DL      ++ P D +   NN + + K+E  +  W + IEQVLAES+Q+R+EAD+IGP AEL++WKKRMAKFN LLDQ+K P  KAA+G+L AAKS++LK W E+D RITDAANEAKDNVK+LYTL++   PL + +P  MI+ +P L++++RMIHSISQYYNTSE+MTSLFVK+TNQMIT+CKAYI N     +W    E L  RL +C +LN  YQ CF +TK +L   P ERQFE SE YIFGKFD FC+RL  I  +   ++  S +    IEG+E++ V++  IVS +KKK Y+ LD R+ EF  D+++F   I++L N +  F+D  FD   ST R+++ L +FE +    L + +KY ++L  YGRD+E   K Y + K DPP+ R++P +AGKI WARQLFRRI  PM +F+ +  +LLK  EAK I+KNYNK+A  L+ FE++YH+ W R + +  +GL +SL++RHPETKEL+VNFDP I+ L +E   M +L LEIP +A  L++K+  +K   N+L+ ++     V + IP+ +  LM   + ++   ++PGLT  NWTSM + +YID++   +  LE L    +D+++ RI+ VLEE+ +  LC+LP +  +TV+EFV  T++ C+ AA++L      + +++  +         + +     E    S +    ++K++ +     P+++ A+     P+ K  +    ++ +   L++ +N R ++A+V+  R +L+++++R+        +         K S   F   F+ +  L+IP+++M P+++++Q  +N+   +++  ++ I +W
Sbjct:    1 MKERQKQAKAEKEGRKSTMDTRHAYIFTKISDTLGMDPNLVEDFILGDSRFPQIDEFFATDGIKKLMFYYQECNLR-------RVDLS--TQASNSHKKLFISTGNTEKLTGTCLVFMRMSNSKNITTANIAQEVSFMQFDASKGNILEGFEKLLGGIMIPALQK-QENWGEMSTQISQVQEFLESLERFVSILNGARGNLSGRVQL---GDHDLGPLLDSLKTPTDYVMAANNPDVVDKLEGLIAHWARDIEQVLAESEQMRKEADDIGPTAELEHWKKRMAKFNVLLDQIKSPHCKAAVGVLHAAKSRSLKQWKELDSRITDAANEAKDNVKYLYTLDKFFGPLIKCSPTEMIEYVPSLMNAIRMIHSISQYYNTSERMTSLFVKVTNQMITTCKAYI-NRGVVKIWEHPREVLSGRLNECIKLNDEYQRCFHKTKQKLRENPKERQFEFSENYIFGKFDAFCKRLEKIDDMLTTMENLSGICKVKIEGIETIIVRYTTIVSNVKKKAYDLLDHRKGEFDSDYEEFKESIEQLKNQLQMFVDSWFDKSLSTMRSLELLNKFENIAGVQLYLHDKYQRVLLQYGRDLETCRKIYQKQKTDPPILRNLPPVAGKITWARQLFRRIHEPMLIFKTK-SDLLKGEEAKRIVKNYNKMASVLVEFELLYHRGWFRAVEAAKSGLYASLLVRHPETKELFVNFDPQIVELIQEAKCMARLNLEIPNSAQVLRLKEEQIKSSSNRLVDVLKDYNHVVSGIPEVFVPLMKPFLNRVDETVKPGLTMLNWTSMNIMQYIDNIQVSIRGLERLTKEIKDIQECRIEAVLEEIGSTPLCDLPEEDAITVEEFVETTEKTCLSAAEVLSRYVTQICNAIKHVSRRSSRIPNNQQSSAYGELVETSVEVLLETLKRNLTAAEIQPLEK-ANYPCMFPESKQAKNNKCMACSYWNLIVTYNQRTIDALVRCTRLSLDTIKRRMHTANKYIGENGQGRAALFKVSHNHFLCVFQADIVLEIPSVLMKPSLDDIQQALNKAVQIMLKTTQSIPEW 1025          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 2034.61 bits (5270), Expect = 0.000e+0
Identity = 1239/3590 (34.51%), Postives = 1963/3590 (54.68%), Query Frame = 3
Query: 3516 YKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTF----KNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAA-NNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK-SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKR-NSNERPIMLELFTNSFPDIYRYSIQYLI-----YKMETLEAF----VVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDL-------PKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSE--DIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNE-SIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEE---IERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEF-RNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNT------------------VDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINK-MGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFY-TEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN---LTYIANAELVCSKSAEHWIMRGVAM 14096
            + +++ +  + ++ + +S  + +T   +   + R+  Y  LW   K   + +F   +P    +D  ++ Y  L  ++  +    D   + L  + L   + +  +AW    GK  N   K  +  +    E L   L R    L+D++  +  + +IR+  + +++    I+E Y  L  YE+ V  +ETE V+ +   W  L     +V   L++++ +F     + V  F  D  KF E + N GP   G       + L   Q  Y+  E+     +  E LFGL++T Y +L+ ++KEL  L++++ +Y     + + + + LW ++D+  +S+ +  +  + ++LP+ +K  P    L + + +F + +PL   + N A++ RHW+++ D+T   FD+  + F L+N+    L  F + I DI  SA KE  IE  +  V   W+A +     +    + RG +L   D   EI+ I++D+ M L S+ ++R+  PF + +      LS+  E++E WM VQ  W+YLE++F+GGDI  QLP+EA++F +IDK++ KIM+   +N  VL+ C     L QL   +    + CQKSL  YL+ KR  FPRFFF+SD  LL ILG + DP  +Q H++ +FDNI +++F E   +  LA    S EGE+++  + V AE  VE W+  +L   +R+   + + A  N  N  +   +E++  Y   V L G Q+ WT +  +     K  D+  M+    +    ++ L+ +  ++L K +R KF T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D  ++     +F Y  E++G   RLVITPLTDR Y+T+ QAL M +GGAPAGPAGTGKTET KD+ + LG   VV NC + MDF+ +G+IF GL+Q G+WGCFDEFNRID+ VLSV + QI  + +      K+  F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V  +VPD Q I  + L S GF+   VLA+K   LYKL   QL+KQ HYDFGLR + +VL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI DLFPG+   +  YP    A+   + +   I  P    K++Q++ET   RH  M +GP+G GKT  I+ L  A T  G   +   MN KA T  +++G LD  T DWTDG+ S ++R   K   K E  ++V DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMVY+    L + P  + W   R N+ ER  +  LF    P      ++ ++      K++T+       +V Q   +L+ L+P  +   S+ +     E ++I S++WS GA L  + R   +  I+    I  +        P     ++ T+++Y   S+   WV W   V EY++  D   +Y  ILVP VD VRT +L+  + +  + VLL+GE GT+KT     YL   + +  +  ++NFSS T     Q  +E+ V+KR   TYGPP G+++ VF+DD+NMP ++E+G Q    +++ LLE  G Y+  K   + N+ D+ F+AAM  PGGGRN++  R    F +FN T PS  S+ +I+S I TGH    + F   ++ LV+++   T  L+      + PTP+KFHY+FNLRDLSR++QG+  T  D   +    + +W++EC RV  DR     D       +   + ++ SE  DI  +         F D+     E             P++YE +  +D  K    +FE +  E ++  A M++V F DA+ HL +I R+IR  +G+ALLVGVGGSGKQ+LTKLA++ AG  +F+ITLTR Y+ ++  EDLK LY + G + K + FLFTD  +  EGFLE +NN+L+SG+V  L+  DE + I  ++     K     PP  +++ +YF+++   NLH+VL  SP+G+  R R   FPGL          + P      V  H +                     VH  V      + Q+ RR  + TPK+YL F++ Y  + + K  +      R++ GL KL+ A E +AEL E LA ++  +   +   E++L  +      ANE   K ++   K + I E+   I  +K  AE  L AA PAL EA+ AL  +  +D+  +R   +PP  +  + +C++               R   + SW  +  +MS   FL +L     D I    V+     L+  + T++  + V    AGL  +  A+M +  + +E+ P ++ + + +  +  S  +L   +  L   ++EL ++   YD+A+R+K +L ++AE   R++ AA +LI GL  EK+RWT    + K Q  RL+GD L   AFLSY G F  +F R++L   W+ ++  R+IP S    +  +LT+   + +W+ +GLP D+LS++NGI+ T+ASRYPL IDPQ Q   WIK +E +  L+V + N   F + LE ++  G P+L +D+ E +DP +DNVL+KN   +     V +GDKEVD    F LY+ TKL NP YTP  F+R  ++++TVTMKGLEDQLL +++  E++ELE QR +L+++   NK+ +K+LED LL  L +++G+++D+ +L++ L+ TK  + EVS+KL + + T I I+  R+ YRP A  G++L+F++ EMS+VN MYQ SL  +L +FDLS+ +S    +  KR++NI++ +T  V+ YA  GL+E  K+ F+  M +K+    GK+K EE   F+KG  +L+ +  Q KP +W+ D  W +++ L  +    F ++ D + RNEK WR+W D +APE    P  Y  +L  F+RLLL+RC+  DR       ++   +GEK+    +L  + + E+S P +P++ +LS GSDP   +  LA++      + + ++MGQGQE  + +L+   +  G W++LQNCHL + ++  L +V++  +  +  +RLW+T++   +FPI  LQ ++K   EPP G++ NL+ ++  ++   L       +  + + L F H  VQERRK+G +GWNI Y+FN++DF  C   +  +L   T    +    I W  ++Y+I E+ YGGRV DDFD R    + K Y  E  +  DF  +  Q    +N                    D Y +YI  LP  + P  FGLH NA+I Y T   K +   ++ +QP+ +    G +RE  + K  +++  K+P    P    +++ K +    P  + L QE+DR + +I  +  +L +L+ A+ G V M+  L +    +F+  IP +W K++  +  +LG W      R +Q+ KW+NDG P   W++G   P  +LTA+ Q   R H GW  D   L   VT+++  +E+ E    G ++ GL+LEGASWD     L   KPK+L + LPV+ +  ++    K Q      + +P+Y   +R N   +  +  A+L  ++   HW+++GV +
Sbjct:  815 FTDISASPAIIELVTTVSKSVQNTLGTLNKYLNRWKRYRLLWKLDKSNMVMKFAAKNPTCIAYDEKLQFYSNLVLEVGTQPMSRDVEFVRLNLDPLATTIQANARAWVKELGKMLNESAKDNLMTLKGEIETLCTDLKRAPDTLEDLKFVLRVIADIRDMSLDVELRTADIKERYRTLKMYEIEVSDNETELVNGIDQLWDDLFVESRRVDYSLVSVKMKFTEITQDQVSNFTSDISKFKESFINEGPSSIGTDLDAGVELLKKFQEEYNTFEKERQELTNAERLFGLSITMYPELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKYMKGTQERGFVLGTVD---EILQILDDNAMNLQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEK-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCN--QITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQF-EGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAE--SSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDL--KYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHL---QPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIAMRDPCL-----FGDYRNTLTED------------PRLYEDVVDYDATK---AIFEEILEEYNMDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANK--AGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGL--------NDKIPDQYRETVVDHVV--------------------FVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANE---KKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVAL-------------RGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSRQ-KPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYL---TKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRR----VVKTYMDE--YMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSGGISREEFITKIASDIQGKLP----PLFDVDRVRKNLSEITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGEPAVIWLSGLHIPDSYLTALVQATCRKH-GWPLDRSTLYTTVTKYHNADEVTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQ----NTFRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHWVLQGVCL 4304          

HSP 2 Score: 166.392 bits (420), Expect = 2.544e-40
Identity = 127/571 (22.24%), Postives = 263/571 (46.06%), Query Frame = 3
Query:  927 QIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNP-ALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFD---TFCRRLSSIIKIFEIIKTYSVLTD--ASIEG----LESMGVKFNVIVSTIKKKNYNFLDQRR-TEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMK----ILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPET------KELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQ 2576
            Q+++     GP AE+D+W++R A  + + +QLKLP VK  + +L    S+ L  +      +     EAKDNV+FL TLE H   L       ++++ IP +++++RM+  IS++YN  E+M  L  +I  ++       +   N  T+    P  + ++  +  +  +T++  + + + ++ +   + ++E     +F + D   + C  L  + ++ E  + Y++      ++ G    +E +  + + +V  I+   ++    R    +    D F R++  + N   +F+D  F  + S   A   L  F  +   +  I  + MK    IL  +G++                   + P +AG I+W R LF RI+  +  F+ + +++L     K   K Y  +A  +  +E   ++AW  Q+ +         ++  P T      +   V+F P++  +  ET  + +L  ++P  A N+ +++    ++ + L LM+     VT S+     QL+   + +L+R+++PG    NW S+ + +Y+      + + E L+++ Q
Sbjct:   88 QLKKTPQGSGPLAEIDFWRERNATLSAIAEQLKLPTVKKIVAVLTKVNSENLANFEYHRAELNKYYTEAKDNVRFLSTLERHFKNLAHGASFNIVLETIPSMMNALRMVWIISRHYNRDERMVPLMERIAWELSERVAKTV---NIRTILKEPPYVVKQKTSEARDTLRTWKESYFDVRAKIESSGRDARWEFDRKRLFERTDYMASICEDLQEVAQVME--EFYNIFGPELKAVTGDPKRIEDVLKRVHELVKPIENVAFDPFSLRHLASWRNVMDWFHREVNAIENEAKHFIDNSFKSLRSAEGAFDMLLNFRHIRSRE-AINSQMMKKFNDILVQFGKE-------------------NQPPVAGAISWERSLFYRIKRTILRFQ-EMEDMLNNEHGKQASKKYLSVARLMKEYEDKKYEAWREQVEANLLIYLKKNLLTKPSTSSATTHRSYVVDFAPELAEIITETKYLEQLGFQVPELARNVALQEEKYLKYVDGLKLMLERYHTVTGSLDVAETQLLDDNIKELKRVLKPGSKRLNWNSLGISDYVTRCGQAIGKFESLVNQIQ 632          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1874.37 bits (4854), Expect = 0.000e+0
Identity = 1121/3229 (34.72%), Postives = 1786/3229 (55.31%), Query Frame = 3
Query: 3525 VAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELT---EFQ-----NRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLE-LFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDE---KDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVS-ENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSE--DLS-EDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDK-----KIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKP-KAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECR--AISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIH----WKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFF 13070
            +  ++E  K+Q+ +   +++    +++ +  +  Y  +W   KDA +  + + +P VS FD  I  Y  + +    E    +   + L    LK  LLS    W+  +          ++ ++  F +   K+LS   + LD++  ++  L++++ +   I+    P+ + +A+L +YE+ + ++    +D L   W             L   + +F++ LI + + FKK  +  ++D+ + GP    +  +EA +++  +  +  NL+ +  +   G  +F +       L++++K+L  L+++++        V   ++ LW    + K    +T   E Q      R  K+ + +KD  W   + ++  I+ F   +PL++ + N AM+ RHW ++       FD   D F L  I+E  L +F E+I +I  +A KE  IE  +  + + W    L  G +K+RG   L+   T E+   +ED+ + LS++ ++RY   F+ ++      LS   E++E  +TVQ  W+YLE +F+G DI KQLP+E+  F +++ +W  IM R +++ N L+       L  L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIKT+K         + E +   YS EGE +E    V  E  VE WL  +    + +L  +++     +  +     +++  +P Q+ +   Q+ WT D  +AL ++K   D+K ++   ++ + +LN   +     L K++R K   L+TI VH +D+ ++L+K      + F+WL Q R Y+ +D+D C+V  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +DF+ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS       +FVF +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M VPD  +I  + L + GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + SVLR  G++KRANP  +++  ++  ++DMN++KL  QD PLF  +++DLFPGI+     Y +L  AI  ++ +      P  +LK+IQL+ET+  RH  + +G +G+GK+    VL  A+T     GEP     RE  +NPKA++  +++G  D++TN+WTDG+ S++ R+T   +K E  W++ D PVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY     L W P +  WL +R   +    L+ LF    P +  +   +    + T E   V   C L + L   ++     +    +R+  E  ++F ++WS+ A ++ + R K++ ++R    ++   P     ++DT+++Y V  +   W  W  K+        S P Y  I++P VD VR DFL+  +   ++ VLL G  GT KT +  K L   +P+ +    +N S+ T     Q  IES V+KR    Y P  G++M  F+DD NMP  + +G Q   E++R  ++  GF+          + DM  +A+M  PGGGR  I +RL+ +F + N T P  S I +IF   GT    K + F ++V+ L   +   T  ++     KMLPTP + HY+FNLRD+S+I+QG++    D+      +  LW HEC RV SDR +   D   FV  L   L    DL+  ++    Q       F +FM+D          DT      +YE +  F  +K  ++     YN       +++V F DA+ H+ +I R+I  PRGN LLVG+GGSG+Q+LT+LASYI  YK+FQI +T+ Y      +DLK LY  AG   K   FLF D +  +EGFLE +NN+LSSG V NL+  DE +E+   L  I  KE  +  P  +++  +F+ R + NLH+VLC SP+G+ FRNR   +P  ++  T+DWF  WP DAL+ VA  YL + E+      K  +      VH  V +         +R  +VTP +YL  ++GY+S+  EK     + A ++ +GL K+ + +  V  +   L +   ++A   ++ EE L  +  QK  A+E +  VQ   +K       IE DK     + A+  L+ A PAL+EA  AL ++   D+  ++  GRPP L+ ++M+ V+I  Q               +P+W E+ + + +  F+  L+N+ KD + +  ++ I  Y    D+  ++  RV      L  W RAM  +  I + V P K  L +   + E+    L  A++ L E    + +++  YDE   +K+ L   AE    K+  A +L+ GLAGE+ RW    +  +  I  LVGD L A AF+SY GPF   +R+ ++  +W  ++R   +  + + +    L  PT + EW++QGLP+D  S +NG++VT+ +R+PL+IDPQGQ   WIKN E +  L++  L    + + LE+++  G P+L++++ EELDP+L  +L K+ +K G  + +K+GDKEV+    F  YITTKL NP YTPEI  +T+I++F V  +GLE QLLG+V++ E+ ELE Q+  L+ ++   KKK++ELED +L  L + +GSL+DDE L+  L ++K TS EV+++L ++  TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+ S+ +SQ+SP    RIQN+ E  TY V+KY  RGL+E  K+ F+  M  K+   AGK+ ++E++ F++GG  LD       P   W+TD +W N+ EL  L  F  ++    +  + W QW+    PE   +P  +    +  +R+L+VR   PDR    A  +I ++LG KF E  +LD   V ++S  RTP++ +LS G DPT  +  LA+   +  R  A+S+GQGQ   + R++   +  G WV L NCHL + ++ +L ++++  +  + +  +RLW++S  H +FPI+ LQ+ IK T EPP+G++AN++R +  +T+     F   H    +K + + L F H  + ERRKF  LGWNI Y FN +DF      +  +LD        +     W  ++Y+++ + YGG VTDDFD RLL       F +   Q  ++
Sbjct:  748 IERDEETKKIQTSIKAGMSANASHLQSYLSTWDGYREIWEIQKDAFIRRYQRLNPPVSSFDADIARYTEIANNFQKEETVLNIDFVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDALSGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWT--------VTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLK--QTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAV-GMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVF-EGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGVRMSNGESYARM-LELWFLFCLIWSVCASVDEDSRKKMDNFLRE---LEGQFP-----AKDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFY-KIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDY-GFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIF---GTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQ----SPIFGNFMKD----------DT------MYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTP--ESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEE-TKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIA-----IEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQ--------------SEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGMSNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITE---QQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLD--------EYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYY 3896          

HSP 2 Score: 95.9005 bits (237), Expect = 4.593e-19
Identity = 55/209 (26.32%), Postives = 109/209 (52.15%), Query Frame = 3
Query:  717 LENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAY 1343
            L  F+  L++ R  +  +  L V +E         I+      N E + ++E  +  W +QI++VL+  D     A+N GP  E+++W+ R A  + + +QL  P VK     L+ +KS  +  ++++ + I D +++A+ N+KFL TL+  C  L Q  P  +   +P+++ ++RM+   S++Y + E++T +  K+    +   + Y
Sbjct:   27 LHKFMANLTDTRYKMQGKTVLYVPSE------STTINIEQASKNKEFVQRLEAAMIHWTRQIKEVLSSQDTFE-TAENSGPLEEIEFWRSRCADLSGISEQLDKPGVKRIQATLELSKSSYVTPFLKLSKLIQDGSSQAQSNLKFLSTLKGPCEELAQAQPKDVPAMLPRILHTIRMVWMNSEHYRSRERLTGILRKVCEGQMHFARMY 228          

HSP 3 Score: 77.7962 bits (190), Expect = 1.448e-13
Identity = 72/296 (24.32%), Postives = 128/296 (43.24%), Query Frame = 3
Query: 1650 IVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDL---GIEEKYMKILTHYGRDVEAVIKHYSRNKED-PPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKE--LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEY 2519
            I+  +KK     LD + T +  DF+ F   +++L   + N +   F+ +T+    ++ L  F+ L+  +     I++K +++   +  ++  V K ++    D PP+    P  AG  +WAR L RRI   M +   +   L +      I   Y +LA+ L  F       W   ++     L    ++R    +   L +NFD  +L L  E     KL LE P     +  K+  L+     ++L+V    ++   +  E   L   R+  L + I PGLT  +W S  + +Y
Sbjct:  263 ILKAVKK---TILDVKATTWHDDFNRFRAGVKDLEVMVQNLIASAFETVTTVEEGVEILDIFQHLSTREAIRRTIDKKTVEVYQLFNEELNLVKKEFNTKTVDLPPL---YPKYAGSASWARMLKRRIDKSMNVLS-KAFFLPQIGSGDEIRTQYQQLAQALDEFVRKTFNEWTATVDKDCGRLLEIPLMRRSAERAGTLDLNFDKVLLKLFNEIHYWEKLMLETPHYVSEVYQKKEDLRILRENVLLVVRDYNRIIAVLSPEERGLFRERIRSLDKKIHPGLTKLSWASKGISDY 551          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4719.84 bits (12241), Expect = 0.000e+0
Identity = 2523/4658 (54.16%), Postives = 3205/4658 (68.81%), Query Frame = 3
Query:  183 IKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEP-EELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTG---VXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIE-ESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLD-QVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLS-QAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPF--KVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKI-SWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            +KEER AKR++LD RH Y+L  +A    LE  +VE++IL+G QIE M++FF +D  + L F+ Q+             G TG  + +    KVF+T GK   L G CV F+R++    +    I +D++F +++ +  G+ + +E+ +S V +P  +    GWG+L+  E    +   ++  E+F  VL  A E I E+     C   D + ++ P D     NN  ++ K+E C+  W++QIE +L+ES+Q+R+  D++GPRAEL+YWKKRM++F+YLL+QLK P V+  + +L  AKSK ++   E+DRRIT A+NEAK+NVK++Y+LE    PLY+ +P  ++  +P LI+++R IH++S+YYN SEK+T+L            +AYI        W  +  +  M+++LK   +  TY +  Q++K                                                  IEGLE++  +F  I+ ++K K+Y+FLD   T F  DF+ F ++  ELH  +  FM+   ++I  T RA+  L +FERL IPDLG + KY  IL  YG+D+E V   + + K DPP  RD+P +AG+I WAR L RRI  PM  F+                                       Q+     GL ++L++R  ET EL+VNFDP++LI   ET+ M ++ L+IPP A  L+ K+  LK+ ++++                           ++   I+PGLT   WTS+ + +Y+      L +LELL++R  DL +YRID +L+EMS + LC LP D PVT +E V+ T+ELC K A+ L  KS  VE + NELINML         +   E  +IS                KT + Q+  TG       +KK  ++K  + E A +LL HFNHRNL+A++K+ RNTLE LRK                 ++  FR +  L IP+IV+ P +E+VQ  +N+    ++SVSKG+ QWSK+R +  ++    + S E+D                      N++S +E ++ +       +   GS S        SA++   +  +N YKNV+ENKEV K+ S+LS+ I ST+K                          F + +P +S+F+  I  Y  LE +IN+E  Y + G +ALFT      L  ET  W   Y   CN KY+ E+E+I    ++  K+L+R IKDLDDIRIAM A+ +IR+++I I++ I PIE ESYAML +Y+ PVQK+E E+V+TLR  W KLM R ++VQ  L T+QP+F+  L  N+ + +++C  FY+DYD                             + + TY  G +LFG+ VT + +L  I+ EL LLQKLY LYN+VI +VNGYYDILW +++IEKI+NEL +FQ  CRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++                               EDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD TSE+I+ +EDSLM+L SL+SN YN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLT YLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTD                           ET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFK L+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KK EHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+    WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQL+E KGFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IG GH+C +RGF +EV++ +  L+ +TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGM+ T  +VI +   LL LWKHEC RVI+DRF   +D+ WF +TL + + + L E+     +V +   + +F+DF+RD  EAT E  +++DFDMPKVYEPI SF+ LKDRL MF   YN+SIRG GMDMVFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLT  YN +NL+EDLK LYR AG QGKGI+F++TD EIK+E FLEYMNNVLSSG VSNLFAR+EMDEI  +L+P+MK+E+PRRPPTN+NL +YF+SR + NLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+  + H+LS+F+I C+P VK E++  MG   D VAE CVDYF                                      M++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  A+  VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR L RPP LIM+ MDCVL+  +RR++ +  + E N    SW ES+ LM++  FL+ L  FPKDTINEETVEL+ PY  + +Y I+ AR    NVAGLLSWT+AM SFF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  V+A Y+EA+ +K TLL+DA+ CRRKM  A+ LI GLAGEK RWT QS EF AQ  RLV DVL ATAFLSY GPFNQEFR++L   WQ EL+ R IPF  +L+I ++L D + + EW+LQ                                             +TSLNHKYFR HLE+SLSLGRPLLIED+GEELDP LDNVLEKNFIK GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPEI ARTSIIDFTVT++GLEDQLLG VI TEK+                                    SLVDDE LI VL  TK T+ EV+QKL IA DT+I+IN+AREEYRP ATRGSILYFLI EMS+VN+MYQTSL QFLGLFDLS++ S KS  T +RI++IIE MT++V+ YA RGLYE  K  FTLL+ LK+DM+   +  +EF T IK GASLD+     KP  WI DM+WLNLVELS L QFS +LD Q+S +EK W+ WFDKEAPEEEV+P+ Y + LD FRRLLL+RCWCPDRT++ QA+KYI+D++GEK+ EG ILD +  +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL +++++EL   + E+  +N  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + QD LD      WK M Y +AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  K+      + W  V+YMI EIQYGGRVTDD+D RLL   +K +F + MF+ DF       I   ++VD+Y  YI  LP  D P  FGLH NADI++ +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++IPF  +V E++ KMG  +PMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W K  SW S+TLGFWF EL++RN QF  WL  GRP CFW+TGFFNPQGFLTAM+QE+ R++ GWA D ++L N VT++  +++  PP +GVY+YGL+LEGASWD+ N RL E+KPK+L++ +PVI ++A      +   +D ++Y  PIYKKP RT++  IA+  L  ++  EHW++RGVA+LCD+K
Sbjct:    3 LKEEREAKRAQLDGRHDYILNTLALCLGLEKDDVEDAILEGVQIEHMEQFFVADGLSHLMFYHQDN------------GPTGGGKKK----KVFLTDGKTVELTGMCVFFIRTNTAKPVTSENIHRDISFNMLDTTEVGLFKSMEQLLSEVFIPSLKKTNHGWGELDSPEAQAIKEEYISLFESFASVLVGAEECIKEK-----CDTFDTQALKTPADYTAAANNNTEVKKLEACMKGWIQQIELILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIE---EIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDPVAIVKAVPSLINAIRTIHNVSRYYNDSEKITTLL------HYQQWEAYI-------FWKFDAFQSRMEKILKMFNIISTY-SVLQDSK--------------------------------------------------IEGLETIATRFKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSELHRQLEKFMNDTIENIQDTQRALDVLHQFERLGIPDLGTDTKYQDILLKYGQDIEWVSDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQ---------------------------------------QVTDARLGLEATLLVRLGETGELFVNFDPELLIQIMETNCMARMNLKIPPFAAVLQQKEYTLKKNNSQM---------------------------QVDEAIQPGLTYLTWTSLNIDKYLRDTKKAL-DLELLMNRVNDLVEYRIDTILQEMSMVTLCVLPEDNPVTCEELVHTTRELCKKQAQNLHYKSMLVEKAANELINML-------MDEHQSEGHLIS----------------KTTLPQSGSTGPSPSLVKRKKKMDLKDVMEEEAQKLLSHFNHRNLDALLKMTRNTLEMLRKHF---------------SQAVFRVDVVLSIPDIVINPALEKVQEALNQIVECVVSVSKGVGQWSKDRLSLGKMDERCMISLEQD----------------------NSESAAEDVATT------HRSLAGSIS--------SASVIQAFPFRNYYKNVSENKEVLKLVSILSSSITSTKK--------------------------FNQTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFT------LTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEQESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYD-----------------------------KVYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQT-CRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRIT-------------------------------EDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSN-YNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEK-YDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT-CGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKK-EHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE-HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEE---HKKVVDCGVERYFVDFLRDPPEATEEP-EESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYF--------------------------------------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQ---------------------------------------------ITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKR------------------------------------SLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLA-SSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIK-GASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYG-INQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQL-----VSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA------ENNVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 4159          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4662.44 bits (12092), Expect = 0.000e+0
Identity = 2294/3481 (65.90%), Postives = 2794/3481 (80.26%), Query Frame = 3
Query: 3675 LKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            L  +P +S+F+  I  Y  LE +IN+E  Y + G +ALFT  LK  L  ET  W   Y   CN KY+ E+E+I    ++  K+L+R IKDLDDIRIAM A+ +IR+++I I++ I PIEESYAML +Y+ PVQK+E E+V+TLR  W KLM R ++VQ  L T+QP+F+  L  N+ + +++C  FY+DYD  GPM  GL P++ SDRLI+ QN++DNL  ++ TY  G +LFG+ VT + +L  I+ EL LLQKLY LYN+VI +VNGYYDILW +++IEKI+NEL +FQ RCRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++++T H+ DVES+ F LRNI+EA  LK+KEEIEDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD TSE+I+ +EDSLM+L SL+SNRYN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTDRCYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQL+E KGFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IG GH+C +RGF +EV++ +  L+ +TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGM+ T  +VI +   LL LWKHEC RVI+DRF   +D+ WF +TL + + + L E+     +V +   + +F+DF+RD  EATGEEP+++DFDMPKVYEPI SF+ LKDRL MF   YN+SIRG GMDMVFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLTR YN +NL+EDLK LYR AG QGKGI+F++TD EIK+E FLEYMNNVLSSG VSNLFAR+EMDEI  +L+P+MK+E+PRRPPTN+NL +YF+SR + NLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+ V+ H+LS+F+I C+P VK E++  MG   D VAE CVDYF R+RR THVTPKSYLSF+ GYK+IY EK       A+ M++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  A+  VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR L RPP LIM+ MDCVL+  +RR++ +  + E N    SW ES+ LM++  FL+ L  FPKDTINEETVEL+ PY  + +Y I+ AR    NVAGLLSWT+AM SFF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  V+A Y+EA+ +K TLL+DA+ CRRKM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   WQ EL+ R IPF  +L+I ++L D + + EW+LQGLPNDELS+ NGIIVTKA+R+PLLIDPQ QGK WIKN+EA+ ELQ+TSLNHKYFR HLE+SLSLGRPLLIED+GEELDP LDNVLEKNFIK GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPEI ARTSIIDFTVT++GLEDQLLG VI TEK+E+E +R  L+EDV  NK+KMKELEDNLL+RLTST+GSLVDDE LI VL  TK T+ EV+QKL IA DT+I+IN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSL QFLGLFDLS++RS KS  T +RI++IIE MT++V+ YA RGLYE  K  FTLL+ LK+DM+   +  +EF T IKGGASLD+     KP  WI DM+WLNLVELS L QFS +LDQ+S +EK W+ WFDKEAPEEEV+P+ Y + LD FRRLLL+RCWCPDRT++QA+KYI+D++GEK+ EG ILD +  +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL +++++EL   + E+  +N  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + QD LD      WK M Y +AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  K+      + W  V+YMI EIQYGGRVTDD+D RLL   +K +F + MF+ DF       I   ++VD+Y  YI  LP  D P  FGLH NADI++ +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++IPF+V +++ KMG  +PMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W K SW S+TLGFWF EL++RN QF  WL  GRP CFW+TGFFNPQGFLTAM+QE+ R++ GWA D ++L N VT++  +++  PP +GVY+YGL+LEGASWD+ N RL E+KPK+L++ +PVI ++A     +    +D ++Y  PIYKKP RT++  IA+  L  ++  EHW++RGVA+LCD+K
Sbjct:  657 LTTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFTASLKTSLTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEE---HKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEK------RAEVMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQL-----VSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMK-SWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-----ENNVVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 4113          

HSP 2 Score: 483.026 bits (1242), Expect = 1.042e-135
Identity = 252/600 (42.00%), Postives = 381/600 (63.50%), Query Frame = 3
Query:  594 GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNY 2387
            G+ + +E+ +S V +P  +    GWG+L+  E    +   ++  E+F  VL  A E I E+V  + C +   + +R PI        T  L  V H          Q+L+ES+Q+R+  D++GPRAEL+YWKKRM++F+YLL+QLK P V+  + +L  AKSK +++WIE+DRRIT A+NEAK+NVK++Y+LE    PLY+ +P   +  IP LI+++R IH++S+YYN SEK+T+LF+ +TNQM++SCKAYI+N+  +++W    +E+++++     LN+  +         L   P ERQF+ SE YIF KFD F  R+  I+K+F II TYSVL D+ IEGLE++  +F  I+ ++K K+Y+FLD   T F  DF+ F ++  E    +  FM+   ++I  T RA+  L +FERL IPDLG + KY  IL  YG+D+E V   + + K DPP  RD+P +AG+I WAR L RRI  PM  F+ Q   +L T EAK IIKN+N++ E L+ +E ++H  W+ ++     GL ++L++R  ET EL+VNFDP++LI   ET+ M ++ L+IPP A  L+ K+  LK+ +N  M + N+
Sbjct:   14 GLFKSMEQLLSEVFIPSLKKTNHGWGELDSPEAQAIKEEYISLFESFASVLVGAEECIKEKV--RNCLD---QGLRYPIFLFYPFKKTHDL--VYH----------QILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIESWIEIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDP---VRKIPSLINAIRTIHNVSRYYNDSEKITTLFLLVTNQMVSSCKAYITNNGCDSIWDQPRQEIIRKIKAAIHLNQVLKP------RELEQAPLERQFDFSEAYIFWKFDAFQSRMEKILKMFNIISTYSVLQDSKIEGLETIATRFKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSE---QLEKFMNDTIENIQDTQRALDVLHQFERLGIPDLGTDTKYQDILLKYGQDIEWVSDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQ-QQPGVLSTQEAKNIIKNFNRMTEILLEYEKLHHHNWMTKVTDARLGLEATLLVRLGETGELFVNFDPELLIQIMETNCMARMNLKIPPFAAVLQQKEYTLKK-NNSQMQVHNF 582          

HSP 3 Score: 54.299 bits (129), Expect = 4.872e-6
Identity = 25/59 (42.37%), Postives = 38/59 (64.41%), Query Frame = 3
Query: 3117 FRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQS 3293
            FR +  L IP+IV+ P +E+VQ  +N+    ++SVSKG+ QWSK+R +  +L    L S
Sbjct:  606 FRVDVVLSIPDIVINPALEKVQEALNQIVECVVSVSKGVGQWSKDRLSLVRLTTNPLLS 664          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3648.6 bits (9460), Expect = 0.000e+0
Identity = 1794/2691 (66.67%), Postives = 2172/2691 (80.71%), Query Frame = 3
Query: 6063 TPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQG---DVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFAL---XXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            T L   CYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K     +Q    H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQL+E KGFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IG GH+C +RGF +EV++ +  L+ +TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGM+ T     ++I   + LL LWKHEC RVI+DRF   +D+ WF +TL + + + L E+     +V +   + +F+DF+RD  EATGEEP+++DFDMPKVYEPI SF+ LKDRL MF   YN+SIRG GMDMVFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLTRS  +  L+  LK LYR AG QGKGI+F++TD EIK+E FLEYMNNVLSSG VSNLFAR+EMDEI  +L+P+MK+E+PRRPPTN+NL +YF+SR + NLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+ V+ H+LS+F+I C+P VK E++  MG   D VAE CVDYF R+RR THVTPKSYLSF+ GYK+IY EK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  A+  VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR L RPP LIM+ MDCVL+  +RR++ +  + E N    SW ES+ LM++  FL+ L  FPKDTINEETVEL+ PY  + +Y I+ AR    NVAGLLSWT+AM SFF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  V+A Y+EA+ +K TLL+DA+ CRRKM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   WQ EL+ R IPF  +L+I ++L D + + EW+LQGLPNDELS+ NGIIVTKA+R+PLLIDPQ QGK WIKN+EA+ ELQ+TSLNHKYFR HLE+SLSLGRPLLIED+GEELDP LDNVLEKNFIK GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPEI ARTSIIDFTVT++GLEDQLLG VI TEK+E+E +R  L+EDV  NK+KMKELEDNLL+RLTST+GSLVDDE LI VL  TK T+ EV+QKL IA DT+I+IN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSL QFLGLFDLS++RS KS  T +RI++IIE MT++V+ YA RGLYE  K  FTLL+ LK+DM+   +  +EF T IKGGASLD+     KP  WI DM+WLNLVELS L QFS +LDQV  +EK W+ WFDKEAPEEEV+P+ Y + LD FRRLLL+RCWCPDRT++QA+KYI+D++GEK+ EG ILD +  +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL +++++EL   + E+  +N  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + QD LD      WK M Y +AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  K+      + W  V+YMI EIQYGGRVTDD+D RLL   +K +F + MF+ DF       I   ++VD+Y  YI  LP  D P  FGLH NADI++ +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++IPF+V +++ KMG  +PMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W K SW S+TLGFWF EL++RN QF  WL  GRP CFW+TGFFNPQGFLTAM+QE+ R++ GWA D ++L N VT++  +++  PP +GVY+YGL+LEGASWD+ N RL E+KPK+L++ +PVI ++A      + KKK  +D ++Y  PIYKKP RT++  IA+  L  ++  EHW++RGVA+LCD+K
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQ----HLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNII--FQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEE---HKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQL-----VSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 2687          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1673.68 bits (4333), Expect = 0.000e+0
Identity = 1114/3522 (31.63%), Postives = 1822/3522 (51.73%), Query Frame = 3
Query: 3636 LWAKVKDAT-LEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTE---DLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFH-EKQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHY-ERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIK-LDLPKIEKDSED-----TMFDYMVSENGE-WVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDV-ITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFR-NILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKEL-QVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKT--SGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQP----DFFINPIQKIVVFNTVDEYRNY----ISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKW-LNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLT---YIANAELVCSKSAEHWIMRGVAM 14096
            L  K+K AT +E F K +P  + +D  ++ +  L  ++  E        I        +  L      RI     C+   K   E++F   +    L++++ ++    +D++  +G + +IR+  + +++ +  I+E Y M+  Y      DE E V  +   W  L +   QV   L  ++  F    +E ++ FK+D   F E ++  GP   G    E  + +   +     +  +    +   +L  L + +Y ++  I+K L+ L ++Y++Y     +   +   LW + DI+ + + +  F     +L K ++  P    L   + +F   + LL  + N A++  HW ++ + T   FD+    F L  +    L K+  +I++I  SA+KE  IE   K  K             K   E +        I+  +++ +M L  +  +R+  PF   IQ     L+  SE IE W+ VQ+ W+ LE +F G DI  QLP+EAK+   I K + +IM       N+ +CC     LS L     +   I QK+L  +L+ KR  FPRFF +SD  LL +LG   DP  IQ H++ ++DNI++++   +   +T++ A  S EGE +E  KPV  E+ VE W+M +L   +R+   + + A        ++ ++++  Y   + L   ++ WT +   A+ N  K D+  +++  EQ    ++ L+        + +R K   ++   VH +DI D  V   +K   DF+W  Q RFY+V++ D   V   +    Y  E++G   RL ITPLT R Y+TL QAL M +GGA AGPAG GKTETVKD+ + LG + VV +C++ MD   LG+I  GL++ G WGCFDEFNRI   VLSV + QI  + +      K F F +G  + ++   GI++TMNP Y  R ELPE++K+ FR V ++ PD Q I  + L S GF+    LA+K   LYK    QL+KQ HYDFGL +  SVL+  G+ KR +   +E   +MR LRD+NL KLV +D P+F+ LI+D+FPG+   + G+P     +   + ++     P  V K++Q++E    +   M +G +  GK+  I+ L +A T  G   +   +NPKA +  +++G  D  T DWTDGIFS L+R   +    +  +++ DG VD+ W+EN+NSVLDDNK LTLANGDRI +   C ++FEV ++ +ASPATVSR  +V++    L + P  + W+  R       +  LF    P     ++        T +  +V Q C +L+ L+  K+   S+++   ++ E LY      S+GA L    R K +  ++S + +  +D  K      +     T++D+   E  E WV W+S V EYI+  +   ++  IL P VD  RT +++  +   ++ VLL+GE GT+KT +I   L + + +  +  ++NFSS T     QR +E+ ++KR   TYGPP G+K+ VF DDINMP ++++G Q    ++R LL+  G Y+ ++   F  I D+ ++AAM   GGGRN++  R    F +FN   P+  S+  I++ I  GH    R F   ++++ Q +   T +L+      + PTP+KFHY F+ R+LSRI+ G+  T+ D      +  + +W++EC R   DR     D +     +K+ + E    D    S+    D       R A+E   +          +VYE I  +D  K   ++FE                  DA+ HL ++ RI+R+ RG+ALL+G  GS  Q LTKLA++ A  ++F+I L R YN  N   DLK LY   G + +   FLFTD  I +EGFLE +NN+L S +V  LFA DE + I +++     +E      + +++ +YFL ++  NLH+VLC S  G+  + R   FP L+S   +DW+  W   AL AVA   L +  I  A      +I  + +VH  + +       + +R  + T KS+L F++ Y ++ +EK +H     + ++  L +L EA+E            E  L +A++      K V  +K A                + +EEI++++ I+                                 +PP  +  + +C+L+        + G  E N     W  + K+MS   FL++L+    D+I+   +  I  +L+    +++  + +    +G+L +  + MS+++I KEV P KD + + +  + +S  +L   ++ L+  QKE   ++  Y++A  +K+  LD+A+   R++TAA +L+ GL  E+  WT    E K Q + L+GD L A AFLSY G FN +FR N++   W ++++ + IP S    I + LT+   +  W  +GLP DE SVQNGI+ TK SR+PL IDPQ Q   WIKN+E    L QV+SLN   F + LE S+  G P L++D+ E++DP + NVLE+N +       + +GDKEV+    F+L++ T L NP Y+P +F +  +I+++ T++GLEDQLL +     ++  + Q L L+E++  NK  +K L D+LL  L ++ G+++D+ +LI+ L+ TK  ++E  +KL +A    ++  + RE YRPVA RG++L+F + +M+LVN MYQ SL  +L LF+LS+  S   P  Q+R++NII  +TY V  Y    L+   K+ F++ M +K++   G +  +E    IK   S D   VQ KP  WI D  W ++ +L+ L   QFS++   + +N   W+ W+D  APE+   P  Y+ +L  F++LLL+RC   DR       Y+  ++G       I +   ++E S   +P+V ++S GSDPT  +   A+K   +   I++GQGQE    +L+   +  G W++LQNCHL + ++ +L + +++ TN N  +R+W+T+   D FPI  LQ + K   EPPE I+ N++ +++ ++Q  L S     +  + Y LAF H  VQER K+G  GW++P  FN +DF+A    +  +L      K H+   S I W+ ++Y+I E+ YGGR  D FD R+L V    YF + +F P     FF N   K V +      R +    I  +P    P   GL +  +I Y T+  + +   +  +QP ++  G G   +  +     ++  ++P       V E++       P ++ L QE+ R +K++  ++ ++ +L  A+ G V M+    D      +  +P MW++++ E+  +L  W   L  R  Q+  W + +G P   W++G   P+ +L A+ Q   R   GW  D       VTR+ TE+  +   +  Y+ GLFLEGA WD  NG L  +KPK+L   LP++ +  +Q+ + + +        +P+Y    R N +    +  A+L  +    HW++ GV +
Sbjct:  837 LLLKMKVATEIERFAKKNPSCAMYDNKLQYFENLNQEVKQEV-LCKTEHIIHVNMMPLVSSLRNIAESRI--STLCSFLNKPAKEELFILRDKFMQLQEKMHQRPDTFEDLKSILGTISDIRDMSLDVEIRVADIKERYRMMAMY------DELELVANIGQIWSNLFAESRQVDQSLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVG-NDLEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWKRTKFNMQPQ------LKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERI-QKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEA-------VYHYVDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQF-EGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQT-LGLCTKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR-------LNRLFEKYVPSCIDVTLNSETIVPRT-DVNMVSQLCLMLDVLLESKN--SSAEVLECYFLEALYC-----SLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYIH--NPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH---TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETD----SEAVLADPILFGDYRAAREECEQ----------RVYEDIGDYDVSKAIFQLFE------------------DAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLIS-MVPTLFADDEKESIIKQINSEALQE--GAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHF--GAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHVLQ-CKCLEGSLNRLREAREQ---------IDELNLKLADQ------KVVLAKKTAT-------------CTAFLEEIDKNQTIS-------------------------------FAKPPKQVQVVCECILV--------LRGKKELN-----WLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIK-NLSGDGTKVQ-KPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGNCVHPPLI-NFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYL-----TKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRN---KDVGYKIPPPGRKHVYTEIEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQP-ETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGT--DLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRK-KGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLR----NTLRTPVYTTSLRRNASGAGLVFEADLFTTMHTSHWVLSGVCL 4171          

HSP 2 Score: 85.1149 bits (209), Expect = 2.585e-15
Identity = 87/425 (20.47%), Postives = 197/425 (46.35%), Query Frame = 3
Query:  684 DEDSRRAMMNSLENFVLVLSNARESINERVALKV-CTEIDLKRIRLPIDCMNI-------VNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQN-NPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEII-KTYSVLTD--ASIEGLESMGVKFNVIVSTIKKKNYN-FLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPD---LGIEEKYMKILTHYGRDV 1910
            DE   R + +S+  F   L    +  + + A+ + C   D   I+L I  +++       + + + +  +E CV +W  QI  VL E  Q  ++ +  GP  EL  W++R      L +QLK P V+  + +L  A +   +T+      +T+   E+  N ++L T+E H   L +  + +L ++ IP L+  ++ +   S++YN++E+M  L  +I  Q+   C+      + +T++  + +E+  ++    ++ + ++  + E +  +       ++E     +F   D        I  +F+++ + Y++ +     ++G+  +  + + +V   ++ ++N F    +  +    +DF   ++++     + +D  F +  S+  A   L RF++    D   L +  K+  +LT Y ++V
Sbjct:   92 DEYPERFLQSSVFYFSRNLRAVVQPRDMKEAVNIMCKLFDFDEIQLHIPDLDLEPEVDALITSPDMVENLEQCVMIWQTQITIVLQE--QQSKQPEGPGPLPELTLWERRATVLGALTEQLKQPAVEKILKVLGMANAGIAQTFEGTIIELTNYHLESNSNSRYLKTMERHFLNLQRGAHFSLHLETIPTLMERLQTMWLSSRHYNSNERMVPLMERIAWQL---CENVAQEIHVQTLFE-KQKEVKSQVFLAKQVLEKWKLSYFENRAEIEKLGRSSRWEFDREKLFKMSDYMASVCQDIHNVFQVLEELYNIFSPELKGMKGINEVISRVDGLVLPFQRVSFNPFRISNKKTWKTIMEDFSVTVKDIEEEAAHIIDMFFTNTLSSAHAFDILMRFKQNRSRDAISLHLLGKFEDVLTQYCKEV 510          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1613.59 bits (4177), Expect = 0.000e+0
Identity = 1100/3267 (33.67%), Postives = 1731/3267 (52.98%), Query Frame = 3
Query: 4614 IDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESD-GFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPV---KAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPE-LEAAINRQIDEALIISH--PPWVL--KLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGE-PHREMR------MNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLK-----RNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLI--PRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR---SNNNIKLDLPK-IEK-----DSEDTMFDYM--VSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMI-NKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVF----------ETDA---WFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLK-FLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIM---KKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXX---XXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIK-PADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPK--PSWGESMKLMSNNQFLNNLINFPKDTINEETVELI-SPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKV-------QAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVS--QKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECR--AISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQES--TNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIH-------WKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQ---NHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQP-DFFINPIQKIVV--FNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIP--FKVAEKINKMGAF--QPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH----DGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRT--------NLTYIANAELVCSKSAEHWIMRGVAMLCDI 14108
            I  F   +P++ ++ NP ++ RHW++MS +    FD+  + G +LR +L+  L  F EE E I ++A KE  +E  ++ +   W     H    K+ G  +       +I  +++D ++   +++ + +  PF+ +++    +L +  E I++W+ +Q  W+YLE +F   DI +Q+P+E + F  +D++W +IM    +++ VLQ       L +L        +I  K L  YLEKKRL FP                                                  YS EGE +EL + +   +A   VE WL+ L +    S+  +I  +  +   T  N  +++  +P QV L   Q+ WT +  +AL   K  +++  Q NE   L+   L         K  RT    L+TI VH +D+   L+ +KV   +DF+WL Q R+Y++ D  R  V I + D  Y  E+LG + RLVITPLTDRCY TL  A  +++GGAP GPAGTGKTET KD+ + L    VVFNCSD +D+  +G+ FKGL+ SG+W CFDEFNRI+L VLSV AQQ+  +      + + F F +G ++ +NP   + +TMNPGYAGR ELP+NLK+ FR VAMMVP+  +I  + L S GF++   L+ K    Y+LC EQL+ Q HYD+G+R + +VL   G  K   P + E   ++R ++D+N  K +  D PLF  + +DLFPG+ L    Y   LEAA     +E   I +  P  V   KLIQ +E   VRH M+ +G S AGKT  +HVL   L+   E  H E        +NPK+IT  Q+FG+ D+ +++WTDG+ +  +R     +  +  W+V DGP+D +WIE++N+VLDDNK L L +G+ I MS    +IFE +++  ASPATVSR GM+YM  S L W PL+  W+       ++ + R ++L+LF    P   +   ++    + T  +  V   C L + ++  P K   D   I R      +  S++WS+G   + + R K   +IR   S  N +  +P+ IE+     + +  ++DY     E G W+HWN  +E  I   +   +   I+VP +D VR  +LM+   SQ   +L +G  GT K+V + +K L++ + + ++   +NFS+ T     Q  I S +DKR    +GPP G++  +F+DD+NMP   ++G Q   E++RQ L+  G Y+L+     + +VD+QF+AAM  PGGGRN +  R  R   I +    S+ ++  IFS I      K+  F+ E   +   ++     ++      +LPTPAK HY FNLRD SR+ QG +  +   +   +TL+ L+ HE  RV  DR V  ED +W  + +   + +  +   V   QVF          E D     F D+M    E  G+E         ++Y  + S +   + +K     YN+ +    M++V F   + HL +ISR+++ P GNALLVGVGGSG+Q++T+LA+ +A   +FQ  ++++Y ++   +DLK  L R AG +G+   FL TD +IKDE FLE +++VL++G V NLFA DE  EI + + PI    KK     P T   L  +F++R K+NLHVV+ FSPIG+ FR R  +FP LI+ CT+DWFQ WP++AL  VA  +L S E+  +   ++E+I      H   A    D+     R  ++TP SYL  +  ++ +  +K +   N  QR  +GL +L  A+  VA++K+    L  K ++  I N +  EV++  +++  A + V   V V ++ A     E +  K   E+ L  A PAL  A  AL+T+K P+DI+ V+ +  PP  +  +M  V +    + D +  DP     K    WG S KL+ +  FL +L  + KD I    ++ I + ++   D+             GL  W  AM  + ++ K V P K  L + Q       E L A ++VLD+K+ EL +V       Q  ++E   +K  L    E+C RK+  A +LI GL+GEK+ W+  + + +   D L GDVL +   ++Y GPF   FR      W    +++ IP S   ++   L +P  +  W++ GLPND  S+ NG+IV + SR PL+IDPQGQ   W+KN E    L V  L    + + LE+ +  G PLL+E++GEELDP+L+ +L K   KQG    +K+G++ ++    F  Y+TT+L NP Y PE+  + S+++F +T +GLEDQLLG+V+  E  ELE +R  L+     NK+++KE+ED++L  L S+KG++++DE  I++L + K+ S E++  Q++ IA  TE+KI  +RE YR VA   SIL+F I +++ ++ MYQ SL  F+ L+  S+ +  KS V ++R++ + +  TY ++    R L+E DK+ F+ L+   +  R  +I+  +    + GG  L   V  P P +W+ D +W  +   S L  F   L+   +N + ++  +D   P    +P  +   L   +++++ RC  PD  +    K++  +LG+KF +    D  K F +S    P+V +LS G+DP   ++  + K     R  +IS+GQGQ   + +++   +  G WV LQNCHL + +++ L ++ ++   T  +  +RLW+TS    +FP+  LQ  +K TNE P G+R NL +S+  LT    D             W+ + + L F H  VQER+KFGPLGWNIPY FN++D +     +Q   N  D + F           + + Y+  E  YGGRVTDD+D RLLM     ++ E + +   + ++P  K      ++ ++Y  +I NLP +  P  FGLH N DIS   + TK + +++L  Q   +  G     ++ +Y    ++ + I +  +P  F     + K      + MN  L QE++R + +   + ++L +L  A+ G+VVM+  L      +   K+P  W K S+ S   LG +  + + R      W  +G+P  FW++GFF  Q FLT + Q   R +    D   FD  +L         ++   PP++GVY+ GLFL+GA WDK  G L E  P+IL+DS+P+I +    +  KK   +   +Y+ P+YK   R         +  ++    L   K  +HWI RGVAML  +
Sbjct:  567 IQKFKDYIPVVSILCNPGLRGRHWEKMSQIAG--FDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTA--LDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKI-MKGLNAYLEKKRLFFP-------------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSR-AYEKTARN--QWVKEWPGQVVLCTSQIFWTLEVHKALGLKKYYQQLQNQLNEIVELVRGELP--------KQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVR--VHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDF-EGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAA-----EECCKIHNVQPTKVFTDKLIQTYEMMIVRHFML-VGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDDESI-RTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIEN-INLGEINTKGQEIIVPTIDTVRYTYLMDLCISQ-GPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLD-HGHYDLKDTSKIS-LVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSI-VAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFN---VPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLE--GDE---------RLYTEVPSIETFAEVVKSCLEEYNQ-MHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLT---LFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEM--SENERQEVITICKTFHTS-ANQLSDFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRV---VHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIP-DPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQ-------ESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIV-RNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVE-SIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKEP-ELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSI-QDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARK-EIEHSDLMFLLTGGIGLQNTVANPDP-SWLQDKSWDEICRASELPGFQG-LEAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSY--LTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPF-----------EAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLY----DIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLP-------IDKSETPPEDGVYVNGLFLDGARWDKE-GVLTEQHPRILFDSMPIIWV----KPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQL 3680          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 8823.75 bits (22895), Expect = 0.000e+0
Identity = 4420/4665 (94.75%), Postives = 4521/4665 (96.91%), Query Frame = 3
Query:  129 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXD--TKMYISPIYKKPRRTNLTYIANAELVC--SKSAEHWIMRGVAMLCDIK 14111
            NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVE CVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNP+LMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFE QHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQ+YIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAM+RFSAYSHLWAKVKD TLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHL +DY+ EL   + E+  ++  +RLW+T+E H +FPI+FLQ++IKFTNEPP+GI+A ++R++    QD+LD   ++ W+ M Y++A+LH  VQERRKFGPLGWNIPYE+N AD NA   F+QNHLD +  KK     G+ WK + YM+ EIQYGGRVTDD+D RLL    + +F + MF P F       I   + ++EY + I+ LP  D+P  FGLH+NADI+Y +KT + IL+ IL+IQPKD+  G GETRES+VY+ C +ML K+PS+++ F+V E++  MG  QPMNIFLRQE+DR+ KVI  VR TL DLKLAIDG ++MN+ LRDALD ++DA+IP  W K+SWES+TLGFWF ELI+RN+QF  WL  GRP CFW+TGFFN QGFLTAMRQEVTR+H GWA D+V+L N VT+   +E+ +PP EGVY+YGL+LEGA WD+RN +LIE+K K+L++ LPVI I A+    + +   D    MY  P+YKKPRRT+LT+IA+  L C  +K A+HW +R VA+LCDIK
Sbjct:   15 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTTLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4674          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 8760.96 bits (22732), Expect = 0.000e+0
Identity = 4396/4665 (94.23%), Postives = 4503/4665 (96.53%), Query Frame = 3
Query:  129 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXD--TKMYISPIYKKPRRTNLTYIANAELVC--SKSAEHWIMRGVAMLCDIK 14111
            NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVE CVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNP+LMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFE QHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQ+YIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAM+RFSAYSHLWAKVKD TLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRF   EDISWF K L R ++EDL E  V   Q    + +F+DF+RDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHL +DY+ EL   + E+  ++  +RLW+T+E H +FPI+FLQ++IKFTNEPP+GI+A ++R++    QD+LD   ++ W+ M Y++A+LH  VQERRKFGPLGWNIPYE+N AD NA   F+QNHLD +  KK     G+ WK + YM+ EIQYGGRVTDD+D RLL    + +F + MF P F       I   + ++EY + I+ LP  D+P  FGLH+NADI+Y +KT + IL+ IL+IQPKD+  G GETRES+VY+ C +ML K+PS+++ F+V E++  MG  QPMNIFLRQE+DR+ KVI  VR TL DLKLAIDG ++MN+ LRDALD ++DA+IP  W K+SWES+TLGFWF ELI+RN+QF  WL  GRP CFW+TGFFN QGFLTAMRQEVTR+H GWA D+V+L N VT+   +E+ +PP EGVY+YGL+LEGA WD+RN +LIE+K K+L++ LPVI I A+    + +   D    MY  P+YKKPRRT+LT+IA+  L C  +K A+HW +R VA+LCDIK
Sbjct:   15 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTTLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFTAHEDISWFNKVLLRIVNEDLGEVHVGSLQ---DERYFVDFLRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4671          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000039073.1 (SMESG000039073.1)

HSP 1 Score: 4728.7 bits (12264), Expect = 0.000e+0
Identity = 2339/3719 (62.89%), Postives = 2906/3719 (78.14%), Query Frame = 3
Query: 2970 HELLLHFNHRNLEAIVKVIRNTLESLRKRI-AAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE--RPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXX--XXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            + +L +F  RN E ++K  R TL+++++R+ ++    + D   +      F+ +  L IPNI+  PN++E+Q  +N+    I+ +S+ I QW+      KQ+      + E ++D+++                                  PG  ++                      K+  K ++++K+VAK  S LS  +N+ + +V+T +  FS YS LW +     ++EF++  P +SE +  IK +  +E +I++    Y  G +  ++E LK GL+SE  +W+  Y +  N K   EM+ I    + L KRLSR +KDLDD+R  M AL E+RE+EI+I+MTI PIEE+Y ML +YE+      +ERVD+L Y + KL ++   VQD+L+ IQP+F+  LIE V+ FK++   F  DYD+ GPM  G+ PREASDRL I+Q ++D L R++ TYSGGEELFGL VTDY  ++ I+KELNLLQKLY LYN+V+++VN YYDI W +++I+ I+ +L +FQN+CRKLPK LK+W A++DLRKTIDDFN   PLLE M++ AM PRHW+R+  +T H F+V+SD F LRN++EAPLL  KEEIEDICISAVKEKDIEAKLK V  +WSA    F +FK+RGELLL+GD T EI+S+MEDSLM L +LLSNRYN PFK  IQ+ V KL+ ++EIIE W+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  NV+QCC+GD+TLSQLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLSVFDN KTV F EK Y+ ILA  S E EA++L++P+ A+ NVEIWL  LL M+++SLH VIR+A+ +IND++F + EF   +P+QVGLLGIQ++WTRDS EAL  +K+D+KIMQ TN++FL +LN LI  TT +L K+ERTKFETLITIHVHQ+DIFD LV  K+ +P DF+WLKQ+RFYF ED D+CIVSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERK QF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDR IIIRVKLASCGF+ N VL++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E   VMRVLRDMNLSKLVD+DE LF+SLI DLFP +++    YP++ AAI++QI++A +I+H PW LKLIQLFETQRVRHGMMTLGPSGAGKT CI+VLM+A+TDCGEPH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT K KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+ KIIFEVHNIDNASPATVSRNGMVYMSSS LDW P+L+ WLL   + +     +L  F   F + YRY  Q L  KM TLE   +RQA DLL GL+   D K   +I   H E+L +FS+MWS+GALLE+EDR KL+ +I     + + + K     +DT+F+Y+V++ GEW HW ++V EY+YP D  PEY SILVPNVDN RTDFL+NT++ Q KAVLLIGEQGTAKTV++  Y    NPE  +FKSLNFSSAT P MFQRT+ES+VDKRMG+T+GPP GRKMT+FIDDINMPVINEWGDQI NEIVRQ++E+ G Y+LEKPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF I+G G++C ERGF  +V+  V NL+  TR+LW  TK KMLPTPAKFHYVFNLRDLSRIWQGM+    DVI +   L+ LWKHEC RVI+DRF +  D  WF KTLK    E+   ++V+  Q   T+ +F+DF++DA EATGEE ++T+ + PK+YEPI S++QL DRL  +   YNE++RG  +D+VFF DAMTHL+KISR+IRT +G+ALLVGVGGSGKQ+LT+LAS+I+GY+ FQITLTRSYN+SNL+EDLK LYRT+GQ GKGITFLFTD EIKDE FLE++NN+LSSG ++NLFARDEMDEI QEL+ +MKKEYPRRPP+N+NLQEY++SR  + LHVVLCFSP+GEKFRNR+L+FPGLISGCT+DWFQRWPKDALIAV+ ++LS+FEIV  P VKK ++ +MG+  D VAENC++YFQRFRR THVTPKSYLSF++GYK +Y +K +    LA RM++GL+KL+EA ESV EL + LA KEKEL +A ++A EVL  V V+ +AA +VK +VQVVKD+A+++V  I RDK IAE KLEAA+PAL+EAE+AL TIKP  IATV+KLGRPPHLIMRIMDCVLI F++RLD++  DPER  PKP+W E++KLMS + FL +L+NFPKDTIN+E V+L+ PY  MED+ +  A+ V G+VAGL SWT+AM SFF INKEVLPLK NL  QQ + E +M++LN AQ +LD KQKEL  VQA Y++A+ +KQ L DDAE CRRKMT A  LI GLAGE+ RWT  S  F  QI +LVGDVL  TAFLSYCGPFNQ+FRNIL  SW+ EL T  IPF+  +  I MLTD   + EW++QGLPNDELSVQNG+IVT+A RYPLLIDPQGQGK WI+N+E   ELQVT+LNHKYFR HLED+LSLGRPLLIED+GEE+DPALDNVLEKNFIK GSTFKVKVGDKEVDVMKGF+LY+TTKLPNPSYTPE+FA+TSIIDFTVT+KGLEDQLLG+VI TEKQELEA+R +LME+V  NK+K KELEDNLL+RLTST+GSLV+DE LI+VL+ TK T+ +V QKLII  DTEIKINSAREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLGLFD SM+ SQKSP+T KRI NIIE +TYEV++Y  RG YESDK TFT+L+ +K+ M++G+IK EEF  FIKGGA+LD+N V+PKPK WI D+TWLNLVELS L  F  + +QV++N+K W+ WFD +APEE  IPDGY+ NL+TF++LLL+R WCPDRT+  AKKYI++++G +FAEG I + +++ EE    TPM+  LSMGSDPT  IE LAKK  ++C +ISMGQGQE+H+R+L++  +  G W+LLQNCHL +++++E  ++I  + N++  +R W+T+E H +FPIN LQ+ IKFT +PP GIRA L+R++A LTQD LD      WK M + +AFLH TVQERRKFGP+GWNIPYEFNQ+DF +   F+QNHLD +  K+     G+ WK V YMI E+QYGGRVTDD+D RLL    K +F   MF P F       I    ++DEYR +I  LP  D+P  FGLH NADI Y T    ++L TI++IQPKDS  G GETRES+VY+   +ML ++P ++ PF+V EK+ KMG+ +P+NIFL+QE+DR+ KVI  VR TL DLKLAIDG ++M++ L+DALD IFDA+IP  W K+SWES TLGFWF +L+DRN QF  WL +GRPVCFW+TGFFNPQGFLTAMRQE+TR+H GWA D+V+L N VT+F  E++   P EGVY++GL+L+GA W+ R+ +L E  PK+LY  LPV++++A+        K + + + Y  P+YKKPRRT+L YI    L  +++ +HWI+RGVA+LCDIK
Sbjct:  968 YAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKL----------------------------------PGPGSV----------------------KSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKELNLLQKLYQLYNNVLDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQSFSFSSFKSRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTLSQLLPHLLEQLELCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK---EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICK----DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQ---TEPYFVDFLQDAPEATGEENEETELEAPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTRSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNELSKELAVKEKELEVARKKAGEVLAQVEVKASAAQKVKEQVQVVKDRAEALVNNISRDKAIAEEKLEAAKPALQEAEEALETIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKR-----GVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 4614          

HSP 2 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 347/886 (39.16%), Postives = 559/886 (63.09%), Query Frame = 3
Query:  144 LLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLE-KDEDSRR--AMMNSLENFVLVLSNARESINERVALKVCTEIDL-KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETK----ELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ++  E+  E+Q  +K+ +  +R  +D RH ++ + +AD  DL+ T+VE+++L   +    ++FFS + +  L F++Q+  +E    D  R   T I      K K+FI  G   PLKG C +F+RS+    +  N IA D+ F +++ S G +L  LE ++S++M P  +NL+  WG +  KD  + +       L+ F+  L  A+++++ ++ L+   + DL  +I +P   +  VN++E + K+E+ +  W+KQIEQVL+ES+QIRREAD++GP AEL YWK RM++FN LL+Q+K  +V   I IL  AKS++L+ W E+D RITDAANEAKDNVK+LYTL++   PL + NP  MI++IP LI+++RMIHSISQYYN+SE+MTSLFVK+TNQMIT+CK ++  +    +W L  EEL KR+  C  LN+ Y+ CF +TK +L     E+QFE SE YIFGKF+ FC+RL  I  +  I+++YS+L    IEG++S+ V++  I   IKKK Y+ LD R++EF  D+ DF+ Q + L   I  F+D  F+      + +  L++FE+++   L  ++K+ K+L ++ + ++ V K Y + K DPP+ R++P IAGKI+W+R LF++I+ PM +F+     +LK PEA  ++KNYNK+A+ L+ FE+IY+  W + I +   GL SSL+IR+P+ +    +  VNFD  IL L +E   +  L L+IP  A  L   +N +K+ +  +  ++    ++ +S+P     +M   + ++     PGL    WTSMK+ +Y++ V   L    LL+ +  D+   RI+ VL++M+   LC+LP D P+T++EF++ T++   +A++ L  +S+ VE +VN++I++L
Sbjct:   52 IITGESRKEQQKLLKQRKDERRLLVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVE----DYSRTDSTSIGPVSAHK-KLFIATGSSEPLKGLCFLFIRSTDKA-LTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMY-EGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL 929          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4561.9 bits (11831), Expect = 0.000e+0
Identity = 2283/3748 (60.91%), Postives = 2847/3748 (75.96%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAA--PTMVAYDISV-------KSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVM-------IDENVINRRQSNVSNAQSISEGLS---DSGTGRKPGKRTIGSNSQFADEDGLS--ANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRK----------EVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYI-SNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A+++LL   + + ++A+VK +R  L++L   +A    T    D S        K    P  +C   +    + + P++E++Q+ + +    I +  K +++WSK  +    L       NE  ++  I V         DE    ++ +  +    +S  ++   +S   ++   R+ G +++  +   LS    L+   Q +NCY +V  ++EV ++QS L + +N+ RK          E+++       YS+LW       + EF K+ P + EF    KE  +++ Q+  E  +Y  GP+ + T   K+  L+  K ++  Y   C  ++   +E I T  +++E+ LS+ I +LDDI   M  L  IR+ +I++D  I   E +   + ++++P  K   ++V+ +R  + ++     Q  D+++ IQ  ++  L+ N+   K D + F  DY+  GPM PGLPP EA D+ I+ +NR+DNL R+  +Y+ GE LFGL  + Y     I KEL LLQ+LY LYN+V  +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD+    FA ++                                   +W+  +L   +FKNRGELLL+GD  SE+IS++EDSLM+LSSL+SNRYN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQ +E+KGFY+LE+PG+FTNIVD+QF++AMIHPGGGRNDIP+RLKR F IFNCTLPSN+SIDK                      LV  +  I  R  +  K  +     KFHYVFNLRDLSRIWQG+INT  DVI N + LL LWKHEC RVISDRFV ++D  WF+K ++R +SE++S D+   ++  E  ++F+DF+RDA E TGEEP+D DF  PK+YEPI+  D LK RL MF   YNESIRGAGMD+VFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LA++IAGY         SYN+SNLLEDLK LYR+AGQ+GKG TF+FTD +IKDEGFLEYMNN+LSSGVVS LF +DE+DE+   L+P+MKKE+P+RPPTN+NL EYF SR ++NLHVVLCFSP+G+KFR RAL FPGLISGC  DWFQ+WPKDAL+AVA HYL +FE+VC    K  +I S+  +HD VA  C +YF ++RR THVTPKSYLSFL  Y+ +Y EK D    LA+RMDSGLQKLIEAQ+S+AEL   LAEKEKEL +AN+EAE+VL+TVT Q  AA  VK+KVQ VKD+   IV  I  DK IAE+KLEAA+PAL EAE+ALNTIKPADI+TVRKL +PPHLIMRIMDCVL+ FQR +D +  DPER   KPSWGES+KLM+N+ FLNNL+NF +D+INEE V+L++PYL MEDY ++ A++VCGNVAGLL WTRAM  F+ +N+EVLPLKDNL KQ+++   +  DL  A+++L EK++ L  V+A Y+ A+++KQ L DDAE CRR+M  A +LI+GL+GEK+RWT QS  FK Q  +L                   +FR  L T+W  E+  + IP +  L++I +LTD   + EW+LQGLPNDELS+QNGIIVT A+RYPLLIDPQGQGKIWIKNREA KELQ+TSLNHKYFRQHLED+LSLGRP+LIEDI EELDPALD VLEKNFIK G+  KVKVGDKEVDVMKGF LYITTKLPNP YTPEI+A+TS+IDFTVT+KGLEDQLLG VI+TEK+ELE  R++L+E++  NK++M+ELED+LL RL +T+GSLVDD+DL+ VL  TKVTS EVS +L  A++TE +IN+AREEYRPVATRGS+LYFL  EMS VN MYQ  L+QFL LFD SM +S KSP+T +RI  IIE MT+++WK+AVRG+Y+ D++T TL++ALK+D+++  I+ EEF   IKGG+ LD+  V PKP  WITD+TWLNL  LS L+QFSA+++QV + EK W+QW+DKE PE E IP GY +NLDTFRRLL+VR WCPDRTL QAKKYI  SLGE FAE  +L+ +K+  +S  R+ ++ LLSMGSD TP IE LAKK  + C+A+SMGQGQEIHSR+L++ F+  GGWVLLQNCHLC+DY+ ELF  I E+ NV+  YRLW+T+E+H +F IN LQI+IKFTNEPPEGI+ANL R++ D+TQD+LD+ V  HWK+M + LAFLHCTVQERRKFGPLGWNIPYE+NQ+DFNA   FIQNHLDGI FKK+ K SGIDWKCVRYMISEIQYGGRVTDD+D +  +                                +RN I + LP  D P +FGLH NADI+YSTKTTK+IL+TILSIQPKD+  G GETRES+V +QC +ML K+PSN+IP++V EK+ KMGA  PMNIFLRQE+DR++KVI  VR TL DL+LAI G ++MN+ LRDALD ++DAKIP +W KISW+S TLGFWF ELIDRNNQF  WLNDGRPV FW+TGFFN QGFLTAMRQEVTRSHDGWA DSV+L ++VT+   +ELREPPKEGVY+YGLF+EGA+WDKRN RL E KPK LYD+LPVINIFA+QE TK K +  +K+Y +PIYKKPRRT+LTY+A+ ELVCSK+ +HW+MRGVA+LCDIK
Sbjct:  937 ASNDLLRIMDQKTVDAVVKSVRTALDNLWNYMACKDATFAIKDASFGQVVKAEKVKPNPLIKCFVRIMGNKLAIRPSLEDIQNIIKKAIVAIQNSMKAVTKWSKRGRRKAFLNDLKESENEVSQNPNIVVKDFQDDANTDEKTNGKKTAKETLPVMVSTSVTSDVESQNSQQEKSRSKGLSTKPEESQRLSLIVQLDIEEQAENCYYDVKHDREVYRLQSFLQSWMNNMRKILFLPNGELKEIKSLTQTLQCYSNLWLSNPIEEIAEFKKNKPSMYEFQSKFKELDSVQEQLENEVPFYIIGPLYIDTTEFKLAALANLKQFKQVYVTGCTERFVGRIEAIQTQLDEIERNLSKNITNLDDIAFIMDTLAYIRQIDIKMDYDIMTAEYASQTMSKFDIPYPKSTGDQVEAVRCNYNRMKENEFQAIDHILAIQGSYKEGLLNNINQLKIDIEDFINDYNERGPMKPGLPPVEALDKQILFKNRFDNLLRKLESYAKGEILFGLPTSSYPSFLQIGKELELLQRLYGLYNEVNKTVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDMMLKTFACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDRVSEVISLLEDSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK---------------------SLVLLVWDIIVRKEVSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDL---AESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYS--------SYNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKKKCL--------------------------------HRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDT-SKLYTTPIYKKPRRTDLTYVASVELVCSKTPDHWVMRGVALLCDIK 4557          

HSP 2 Score: 482.256 bits (1240), Expect = 1.318e-135
Identity = 273/880 (31.02%), Postives = 477/880 (54.20%), Query Frame = 3
Query:  144 LLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETK--ELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP-NDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            L+  E L E Q K+KEE   +++ LDERH YL++ + +F+ ++   +E+ I D NQ+E +  F + ++T+ LF +  +  L K    +     +G K  +     +        P     ++F+++     I E  +  D+  I + G   +L    E +++V LP     +   G+LE     ++  +N +++F   L  A   + E+V L +  E     +       N  N+ E L K E     W+KQI++ + E + +R E+  IGP  EL +WKK+M +FN L++QLK   V   + IL+ A SK L  WI++D+++T A  E+K+N KFL  +E++C PLY  N   MI+ +PKL+ S+ MI+  S YY T   MT LFVKITNQMI +CK++I++ N  T+W  EPE  +KR+  C  LN  YQ C+Q+ +  +  +   R F+ SE+ IFG F+ F  RL  +I I + +K YS+L D  +EG +++  +++ I  +I  K Y+FL+QR   F +D+++F  QI++LH+ ++  +   F         ++   + E+++IP+L    +Y+++   +  +   +   +  ++++PP+ RDMP  AG+IAWAR L+  ++  M +F +    +    E + I+  YN   E L+ +EI  +  W R I S   G+ SS+ I   +    E  +N DPD+L L RE   + +L   +      +  K + LK    K+       +++   +P EYE+L++    K+ R I  G+T ++W  + ++EYI+ +   + E ELLL+RA D+R +RI+ +L  ++  +L   P N  P  +++F+  T E C+K ++ +   S ++ ++ N+ +++L
Sbjct:   10 LVNEEELKEMQ-KLKEEFEMRKANLDERHHYLIKFMEEFFKIKHDIIEDYICDSNQLEAVQSFLAPNETDKLFVYRIKNSLYKRITKK-----SGNKFMKKTDDDILCFHIGSLPFTKGGIIFVKTDVTQPITERNMTTDIFLIKLGGEKSLLGSYVESIAKVFLPFIEGQETELGELE--HSGKKNYVNFIQDFNNSLETASICVEEKVILNM--EGSTVIVTGVEGLANAANDPETLSKAEELASKWMKQIQKEITEIELLRVESGIIGPHEELKFWKKQMTRFNCLVNQLKQKPVINVLLILKIAHSKALDKWIQLDQKVTRAFIESKENTKFLNVIEKYCVPLYHRNIEKMIEIVPKLLQSLSMIYVYSTYYRTFTNMTQLFVKITNQMIFTCKSFITDKNKHTLWDDEPETFVKRMEICINLNHVYQKCYQKVRKEMKYENENRYFDFSEVQIFGNFNLFESRLIKLIAILKSMKNYSILKDVVLEGKDAIMNRYDRITQSITTKKYDFLNQRNLAFDKDYEEFQNQIEDLHSALIGVITSYFHRSKGVAAGLRMQSKIEKISIPELDHFARYVELFKSFRSENLTIKNIFIEHQDNPPLDRDMPYFAGRIAWARNLYLHLEENMNLFVLTCPEVFTIAEGRRIVHTYNTTTEMLVHYEITVYHTWKRLITSKLNGMKSSIFILTNDEPYGECILNIDPDVLGLLREISCLDRLGCALTSVPREIYAKNDFLKRRSEKIRYFCQEHKRIMAKVPAEYEKLLLPITTKIYREIGKGMTLYDWCCLGVEEYIEGLLKLIYEFELLLNRAFDIRDFRINNILTSIAETELFAQPENGEPWEINKFLEITVEKCLKGSQSMHYFSLSIYEASNDYVDIL 879          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4559.59 bits (11825), Expect = 0.000e+0
Identity = 2283/3748 (60.91%), Postives = 2846/3748 (75.93%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAA--PTMVAYDISV-------KSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVM-------IDENVINRRQSNVSNAQSISEGLS---DSGTGRKPGKRTIGSNSQFADEDGLS--ANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRK----------EVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYI-SNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14111
            A+++LL   + + ++A+VK +R  L++L   +A    T    D S        K    P  +C   +    + + P++E++Q+ + +    I +  K +++WSK  +    L       NE  ++  I V         DE    ++ +  +    +S  ++   +S   ++   R+ G +++  +   LS    L+   Q +NCY +V  ++EV ++QS L + +N+ RK          E+++       YS+LW       + EF K+ P + EF    KE  +++ Q+  E  +Y  GP+ + T   K+  L+  K ++  Y   C  ++   +E I T  +++E+ LS+ I +LDDI   M  L  IR+ +I++D  I   E +   + ++++P  K   ++V+ +R  + ++     Q  D+++ IQ  ++  L+ N+   K D + F  DY+  GPM PGLPP EA D+ I+ +NR+DNL R+  +Y+ GE LFGL  + Y     I KEL LLQ+LY LYN+V  +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD     FA ++                                   +W+  +L   +FKNRGELLL+GD  SE+IS++EDSLM+LSSL+SNRYN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQ +E+KGFY+LE+PG+FTNIVD+QF++AMIHPGGGRNDIP+RLKR F IFNCTLPSN+SIDK                      LV  +  I  R  +  K  +     KFHYVFNLRDLSRIWQG+INT  DVI N + LL LWKHEC RVISDRFV ++D  WF+K ++R +SE++S D+   ++  E  ++F+DF+RDA E TGEEP+D DF  PK+YEPI+  D LK RL MF   YNESIRGAGMD+VFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LA++IAGY         SYN+SNLLEDLK LYR+AGQ+GKG TF+FTD +IKDEGFLEYMNN+LSSGVVS LF +DE+DE+   L+P+MKKE+P+RPPTN+NL EYF SR ++NLHVVLCFSP+G+KFR RAL FPGLISGC  DWFQ+WPKDAL+AVA HYL +FE+VC    K  +I S+  +HD VA  C +YF ++RR THVTPKSYLSFL  Y+ +Y EK D    LA+RMDSGLQKLIEAQ+S+AEL   LAEKEKEL +AN+EAE+VL+TVT Q  AA  VK+KVQ VKD+   IV  I  DK IAE+KLEAA+PAL EAE+ALNTIKPADI+TVRKL +PPHLIMRIMDCVL+ FQR +D +  DPER   KPSWGES+KLM+N+ FLNNL+NF +D+INEE V+L++PYL MEDY ++ A++VCGNVAGLL WTRAM  F+ +N+EVLPLKDNL KQ+++   +  DL  A+++L EK++ L  V+A Y+ A+++KQ L DDAE CRR+M  A +LI+GL+GEK+RWT QS  FK Q  +L                   +FR  L T+W  E+  + IP +  L++I +LTD   + EW+LQGLPNDELS+QNGIIVT A+RYPLLIDPQGQGKIWIKNREA KELQ+TSLNHKYFRQHLED+LSLGRP+LIEDI EELDPALD VLEKNFIK G+  KVKVGDKEVDVMKGF LYITTKLPNP YTPEI+A+TS+IDFTVT+KGLEDQLLG VI+TEK+ELE  R++L+E++  NK++M+ELED+LL RL +T+GSLVDD+DL+ VL  TKVTS EVS +L  A++TE +IN+AREEYRPVATRGS+LYFL  EMS VN MYQ  L+QFL LFD SM +S KSP+T +RI  IIE MT+++WK+AVRG+Y+ D++T TL++ALK+D+++  I+ EEF   IKGG+ LD+  V PKP  WITD+TWLNL  LS L+QFSA+++QV + EK W+QW+DKE PE E IP GY +NLDTFRRLL+VR WCPDRTL QAKKYI  SLGE FAE  +L+ +K+  +S  R+ ++ LLSMGSD TP IE LAKK  + C+A+SMGQGQEIHSR+L++ F+  GGWVLLQNCHLC+DY+ ELF  I E+ NV+  YRLW+T+E+H +F IN LQI+IKFTNEPPEGI+ANL R++ D+TQD+LD+ V  HWK+M + LAFLHCTVQERRKFGPLGWNIPYE+NQ+DFNA   FIQNHLDGI FKK+ K SGIDWKCVRYMISEIQYGGRVTDD+D +  +                                +RN I + LP  D P +FGLH NADI+YSTKTTK+IL+TILSIQPKD+  G GETRES+V +QC +ML K+PSN+IP++V EK+ KMGA  PMNIFLRQE+DR++KVI  VR TL DL+LAI G ++MN+ LRDALD ++DAKIP +W KISW+S TLGFWF ELIDRNNQF  WLNDGRPV FW+TGFFN QGFLTAMRQEVTRSHDGWA DSV+L ++VT+   +ELREPPKEGVY+YGLF+EGA+WDKRN RL E KPK LYD+LPVINIFA+QE TK K +  +K+Y +PIYKKPRRT+LTY+A+ ELVCSK+ +HW+MRGVA+LCDIK
Sbjct:  937 ASNDLLRIMDQKTVDAVVKSVRTALDNLWNYMACKDATFAIKDASFGQVVKAEKVKPNPLIKCFVRIMGNKLAIRPSLEDIQNIIKKAIVAIQNSMKAVTKWSKRGRRKAFLNDLKESENEVSQNPNIVVKDFQDDANTDEKTNGKKTAKETLPVMVSTSVTSDVESQNSQQEKSRSKGLSTKPEESQRLSLIVQLDIEEQAENCYYDVKHDREVYRLQSFLQSWMNNMRKILFLPNGELKEIKSLTQTLQCYSNLWLSNPIEEIAEFKKNKPSMYEFQSKFKELDSVQEQLENEVPFYIIGPLYIDTTEFKLAALANLKQFKQVYVTGCTERFVGRIEAIQTQLDEIERNLSKNITNLDDIAFIMDTLAYIRQIDIKMDYDIMTAEYASQTMSKFDIPYPKSTGDQVEAVRCNYNRMKENEFQAIDHILAIQGSYKEGLLNNINQLKIDIEDFINDYNERGPMKPGLPPVEALDKQILFKNRFDNLLRKLESYAKGEILFGLPTSSYPSFLQIGKELELLQRLYGLYNEVNKTVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDT----FACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDRVSEVISLLEDSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK---------------------SLVLLVWDIIVRKEVSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDL---AESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYS--------SYNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKKKCL--------------------------------HRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDT-SKLYTTPIYKKPRRTDLTYVASVELVCSKTPDHWVMRGVALLCDIK 4553          

HSP 2 Score: 482.641 bits (1241), Expect = 1.086e-135
Identity = 273/880 (31.02%), Postives = 477/880 (54.20%), Query Frame = 3
Query:  144 LLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETK--ELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP-NDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            L+  E L E Q K+KEE   +++ LDERH YL++ + +F+ ++   +E+ I D NQ+E +  F + ++T+ LF +  +  L K    +     +G K  +     +        P     ++F+++     I E  +  D+  I + G   +L    E +++V LP     +   G+LE     ++  +N +++F   L  A   + E+V L +  E     +       N  N+ E L K E     W+KQI++ + E + +R E+  IGP  EL +WKK+M +FN L++QLK   V   + IL+ A SK L  WI++D+++T A  E+K+N KFL  +E++C PLY  N   MI+ +PKL+ S+ MI+  S YY T   MT LFVKITNQMI +CK++I++ N  T+W  EPE  +KR+  C  LN  YQ C+Q+ +  +  +   R F+ SE+ IFG F+ F  RL  +I I + +K YS+L D  +EG +++  +++ I  +I  K Y+FL+QR   F +D+++F  QI++LH+ ++  +   F         ++   + E+++IP+L    +Y+++   +  +   +   +  ++++PP+ RDMP  AG+IAWAR L+  ++  M +F +    +    E + I+  YN   E L+ +EI  +  W R I S   G+ SS+ I   +    E  +N DPD+L L RE   + +L   +      +  K + LK    K+       +++   +P EYE+L++    K+ R I  G+T ++W  + ++EYI+ +   + E ELLL+RA D+R +RI+ +L  ++  +L   P N  P  +++F+  T E C+K ++ +   S ++ ++ N+ +++L
Sbjct:   10 LVNEEELKEMQ-KLKEEFEMRKANLDERHHYLIKFMEEFFKIKHDIIEDYICDSNQLEAVQSFLAPNETDKLFVYRIKNSLYKRITKK-----SGNKFMKKTDDDILCFHIGSLPFTKGGIIFVKTDVTQPITERNMTTDIFLIKLGGEKSLLGSYVESIAKVFLPFIEGQETELGELE--HSGKKNYVNFIQDFNNSLETASICVEEKVILNM--EGSTVIVTGVEGLANAANDPETLSKAEELASKWMKQIQKEITEIELLRVESGIIGPHEELKFWKKQMTRFNCLVNQLKQKPVINVLLILKIAHSKALDKWIQLDQKVTRAFIESKENTKFLNVIEKYCVPLYHRNIEKMIEIVPKLLQSLSMIYVYSTYYRTFTNMTQLFVKITNQMIFTCKSFITDKNKHTLWDDEPETFVKRMEICINLNHVYQKCYQKVRKEMKYENENRYFDFSEVQIFGNFNLFESRLIKLIAILKSMKNYSILKDVVLEGKDAIMNRYDRITQSITTKKYDFLNQRNLAFDKDYEEFQNQIEDLHSALIGVITSYFHRSKGVAAGLRMQSKIEKISIPELDHFARYVELFKSFRSENLTIKNIFIEHQDNPPLDRDMPYFAGRIAWARNLYLHLEENMNLFVLTCPEVFTIAEGRRIVHTYNTTTEMLVHYEITVYHTWKRLITSKLNGMKSSIFILTNDEPYGECILNIDPDVLGLLREISCLDRLGCALTSVPREIYAKNDFLKRRSEKIRYFCQEHKRIMAKVPAEYEKLLLPITTKIYREIGKGMTLYDWCCLGVEEYIEGLLKLIYEFELLLNRAFDIRDFRINNILTSIAETELFAQPENGEPWEINKFLEITVEKCLKGSQSMHYFSLSIYEASNDYVDIL 879          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH50.000e+062.56dynein axonemal heavy chain 5 [Source:HGNC Symbol;... [more]
DNAH80.000e+057.47dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+058.09dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+057.74dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH25.104e-1833.83dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-10.000e+026.78Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.83Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.83Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-30.000e+026.25Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-31.719e-1923.87Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94929.435e-11258.70gene:FBgn0037726 transcript:FBtr0309028[more]
CG94921.071e-11158.67gene:FBgn0037726 transcript:FBtr0309029[more]
CG94925.977e-11258.33gene:FBgn0037726 transcript:FBtr0344344[more]
CG94927.301e-11258.35gene:FBgn0037726 transcript:FBtr0309027[more]
kl-33.921e-7555.08gene:FBgn0267432 transcript:FBtr0346771[more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah50.000e+066.62dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah5l2.873e-15461.35dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah5l0.000e+064.95dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
si:dkeyp-86b9.18.275e-4034.30si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH108.275e-4034.30si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021690.10.000e+068.09dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000035049.12.179e-15667.83dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021565.11.378e-15969.78dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021598.15.077e-16469.79dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
nifk5.424e-8665.24nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah50.000e+062.51dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah80.000e+057.28dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+057.28dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+057.28dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah23.041e-1734.26dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TE73|DYH5_HUMAN0.000e+062.56Dynein heavy chain 5, axonemal OS=Homo sapiens OX=... [more]
sp|Q8VHE6|DYH5_MOUSE0.000e+062.51Dynein heavy chain 5, axonemal OS=Mus musculus OX=... [more]
sp|Q96JB1|DYH8_HUMAN0.000e+058.09