Sodium/hydrogen exchanger

Overview
NameSodium/hydrogen exchanger
Smed IDSMED30000707
Length (bp)2796
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/hydrogen exchanger (SMED30000707) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/hydrogen exchanger (SMED30000707) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/hydrogen exchanger (SMED30000707) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/hydrogen exchanger (SMED30000707) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000707

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000707h1SMcG0018569 SmedASXL_015465SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30000707h1SMcG0018569 dd_Smed_v4_11493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000707h1SMcG0018569 dd_Smed_v4_11493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000707h1SMcG0018569 dd_Smed_v4_11493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000707h1SMcG0018569 dd_Smed_v4_11493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000707h1SMcG0018569 dd_Smed_v6_11493_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testisSMED30000707h1SMcG0013885 Contig3141uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30000707h1SMcG0013885 Contig3141newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30000707h1SMcG0018569 Contig3141uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30000707h1SMcG0018569 Contig3141newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A2 (solute carrier family 9 member A2 [Source:HGNC Symbol;Acc:HGNC:11072])

HSP 1 Score: 221.861 bits (564), Expect = 4.387e-60
Identity = 160/508 (31.50%), Postives = 267/508 (52.56%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAK--IFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDL--FQSDNDVRFRMYKK 1881
             I PES  LI  G++  +  ++ GV      + K  +FF  +L PIV+ AG+      F+ NIGTI W+A+ GT+ N+  +   LF     +   +   D+ L+   L+  LI AVDPVAVL+VFE +H+++ +Y +VFGESLLND V VV Y+   +F  MKTI  +  F  +     FF+   G  VL+   +  I +F ++  ++ + ++ + +   +YL+Y+  +    SGI+++  C +   +YV  N+S  S   +   +  L+ +SE ++FI MG+   S  G +   +  F  + +  C + R + ++ L  + N FR   L + K  FI ++GGLRGAI FAL  L     +  + ++ TA  +++FF+VF+LG TI+PLV    V   +   + +   +  ++ D  K GI+ + G     F W  +++KF++K+ +K       I  +   SS+V L++   I  A ++A     GMI  +  F S ND R    +K
Sbjct:  106 TIVPESCLLIMVGLL--LGGIIFGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENIGTIFWYAVVGTLWNSIGIGVSLF--GICQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIA---NFFVVGIG-GVLIGIFLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGV---STVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRFRTIPLTF-KDQFIIAYGGLRGAICFALVFLLPAAVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNF-WRDKFKKFDDKYLRKLL-----IRENQPKSSIVSLYKKLEIKHAIEMA---ETGMISTVPTFASLNDCREEKIRK 592          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A1 (solute carrier family 9 member A1 [Source:HGNC Symbol;Acc:HGNC:11071])

HSP 1 Score: 202.216 bits (513), Expect = 1.704e-53
Identity = 156/495 (31.52%), Postives = 256/495 (51.72%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGT-LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLF----YGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVF-----FLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIK 1833
            +I PES  LI  G++  V  L+ GV      L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  L  L++     G +   N      + L+D  L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +         +E VG+V +F     F       VL+     +I +F S+   H + ++ + +   +Y+ Y+  +    SGI++L    V+ + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G   S + +  F    +  C ++R + +  L +  N FR  KL   K  FI ++GGLRGAI F+L  L    ++    ++ TA   ++FF+VFV G TI+PLV+L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KK  ++    ERS     ++  +    + +A ++    G G I 
Sbjct:  127 SIVPESCLLIVVGLL--VGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINN------IGLLDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFAN------YEHVGIVDIFLGFLSFFVVALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAG---SHHWNWTFVISTLLFCLIARVLGVLGLTWFINKFRIVKLT-PKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKKYVKKCLIAG---ERS-KEPQLIAFYHKMEMKQAIELVESGGMGKIP 598          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A3 (solute carrier family 9 member A3 [Source:HGNC Symbol;Acc:HGNC:11073])

HSP 1 Score: 198.364 bits (503), Expect = 4.324e-52
Identity = 145/440 (32.95%), Postives = 235/440 (53.41%), Query Frame = 1
Query:  469 TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVS--RYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTI-GDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDR-------TKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHS 1752
            TL+  +FF  +L PIV+ AG+      F+ N+GTIL +A+ GT+ NAA    L  YG          L + L+D  L+  L+ AVDPVAVL+VFE +H++++++ +VFGESLLND V VV Y+ F     +   N+   + V  +  FF+ + G   L+    A ++S +++   H + ++   +  ++YL+Y+  + +  S IL++ FC +  ++YV AN+S  S   V   +  LA  +E I+F+ +G++A +    + NT     F L+ L ++S  R I +    ++ N +R  +L+    + + S+GGLRGA+ FAL + + GD  + + ++ + T I+VFF+V   G TIKPLV   KV    H        LNEK+  R         E I   IG + LR +W          HF + F+S+  + RS   S
Sbjct:  109 TLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAAT-TGLSLYGVFLS-GLMGDLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLG-GTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVNPFIWTWNT----AFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVL-SYGGLRGAVAFALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREP----RLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKW---------SHFDRKFLSRVLMRRSAQKS 527          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A3 (solute carrier family 9 member A3 [Source:HGNC Symbol;Acc:HGNC:11073])

HSP 1 Score: 198.749 bits (504), Expect = 4.700e-52
Identity = 145/440 (32.95%), Postives = 235/440 (53.41%), Query Frame = 1
Query:  469 TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVS--RYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTI-GDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDR-------TKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHS 1752
            TL+  +FF  +L PIV+ AG+      F+ N+GTIL +A+ GT+ NAA    L  YG          L + L+D  L+  L+ AVDPVAVL+VFE +H++++++ +VFGESLLND V VV Y+ F     +   N+   + V  +  FF+ + G   L+    A ++S +++   H + ++   +  ++YL+Y+  + +  S IL++ FC +  ++YV AN+S  S   V   +  LA  +E I+F+ +G++A +    + NT     F L+ L ++S  R I +    ++ N +R  +L+    + + S+GGLRGA+ FAL + + GD  + + ++ + T I+VFF+V   G TIKPLV   KV    H        LNEK+  R         E I   IG + LR +W          HF + F+S+  + RS   S
Sbjct:  109 TLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAAT-TGLSLYGVFLS-GLMGDLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLG-GTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVNPFIWTWNT----AFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVL-SYGGLRGAVAFALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREP----RLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKW---------SHFDRKFLSRVLMRRSAQKS 527          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A4 (solute carrier family 9 member A4 [Source:HGNC Symbol;Acc:HGNC:11077])

HSP 1 Score: 197.208 bits (500), Expect = 6.594e-52
Identity = 141/488 (28.89%), Postives = 263/488 (53.89%), Query Frame = 1
Query:  358 LTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDG--TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQI 1803
            L HR  PG + PES  LI  G +  V  ++ G        + + I+F  +L PIV+  G+      F+ NIG+ILW+A+ G ++NA  +   L+   + +   +   D++L+   L+  LI AVDPVAVL+VFE   +++ +Y ++FGE+LLNDG+ VV Y+   AF  M    ++   + +     F +   G  VL       I +FI++   +   ++ +++   +YL+Y+  +T+  SGIL++  C V  K+YV  N+S TS   +   +  L+ +SE ++FI MG+   S  G +   +  F  + +  C + R I ++ L +I+N FR      +    I  + G+RGA  F+L+  +  + +  + ++ TAT ++++F+VF+ G T+ PLV    V  +++  ++I   L+ ++ D  K GI+ + G  S  ++   +++KF++++ +K       I +++  SS+V L++   + +A ++
Sbjct:   89 LYHRL-PG-LMPESCLLILVGAL--VGGIIFGTDHKSPPVMDSSIYFLYLLPPIVLEGGYFMPTRPFFENIGSILWWAVLGALINALGIGLSLYLICQVK--AFGLGDVNLLQNLLFGSLISAVDPVAVLAVFEEARVNEQLYMMIFGEALLNDGITVVLYNMLIAFTKMHKFEDIETVDILAGCARFIVVGLG-GVLFGIVFGFISAFITRFTQNISAIEPLIVFMFSYLSYLAAETLYLSGILAITACAVTMKKYVEENVSQTSYTTIKYFMKMLSSVSETLIFIFMGV---STVGKNHEWNWAFICFTLAFCQIWRAISVFALFYISNQFRTFPFSIKDQCII-FYSGVRGAGSFSLAFLLPLSLFPRKKMFVTATLVVIYFTVFIQGITVGPLVRYLDVK-KTNKKESINEELHIRLMDHLKAGIEDVCGHWS-HYQVRDKFKKFDHRYLRKIL-----IRKNLPKSSIVSLYKKLEMKQAIEM 558          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-1 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:G5EDH8])

HSP 1 Score: 217.624 bits (553), Expect = 2.883e-61
Identity = 154/485 (31.75%), Postives = 260/485 (53.61%), Query Frame = 1
Query:  388 FPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRF-FESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTI-GDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKD 1836
            FPESA LI  G+     +  L  T+D  L   +FF  +L PIV+ AG+      F  NI TI  FA+ GT++N  +    +F    +  NFY   ++ +VD  L+S +I AVDPVAVLSVFE +H++KL+Y  VFGESLLND V VV Y +F+ M  I      ++   +  + F    G  +L+    A++ +   K   +   +Q ++ +++ Y+ Y+  + +  SGIL +  C +  K YV  ++   ++  V   L  L+   E I+F+ +G + FS        D  F    +  C+ +R++V++TL ++AN +R +K+  R    I + GGLRGAI F L LTI G+    + I  + T I++ F+VF+ G  IKPLV+   V +++   K++F S  E   + T  G++AIIG+   ++ W+ +  K+N + F +  ++++ + R      ++K   D +  E ++      + M+++
Sbjct:   42 FPESAVLIVLGLFAGFTIYELW-TVDLFLHPDLFFLYLLPPIVLEAGYFMPNKAFISNITTISLFAVAGTVMNIFLTSCFIF----AFQNFY-DFNITIVDTLLFSTVISAVDPVAVLSVFEEIHVNKLLYITVFGESLLNDAVTVVLYHSFHSMVRIGQAHLIYQDYTMSMMNFFLVSGGGILVGVVFAVVAALGVKWSSNVSVLQPIICITVPYMAYLCSEIVHVSGILGIVVCGLCMKSYVTGSMEERADITVKYTLKTLSSCCEAIIFVFLGFSIFSK---DHKWDFGFAIVTVITCFAARFLVVFTLTWVANKWRMQKISLRDQT-IMAFGGLRGAICFGLVLTIDGEVVPAKPIMISTTLIVIVFTVFIQGTMIKPLVSFLNVKIDNAYDKSLFQSCIEHSFEDTMCGVEAIIGAHG-QYYWKNKVDKWNAQ-FLEPALTRQDMNRG---RRLLKKLTDMTTDEQREALLQEESAMLEE 511          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 201.06 bits (510), Expect = 9.554e-55
Identity = 147/476 (30.88%), Postives = 245/476 (51.47%), Query Frame = 1
Query:  391 PESAFLITAGIIPAVAMLLLGVTLDG-TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNA-AILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIA 1806
            P+S+ LI  G+  A+  +L   +L G TL +  FF  +L PI+  AG+       + N  ++L F++FGTI N  AI   LL     ++++ +T +     +  ++S LI AVDPVAV++VFE +H+++ ++  VFGE+L NDGV VV Y  F     I   NL   +       FF+ A G    +    AI  S  +K  Y  + +  V +  L Y+ Y+  + +  S I+++  C ++ KQY+  N++  +   V      LA  SE ++F+ +GL+  S      + D+ F    +F C + R I I    +I N FR +K +     FI S+GGLRGAI + L ++I  +   + ++ TAT  +++F+VF+ G TI+PLVN  K+  +     T+  S+  K  D    G++ I G     + +   + +FN K  K   M  +  E S   SS+V+ +   ++ +A ++A
Sbjct:    9 PDSSLLIIVGL--ALGWILHQTSLSGATLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLM---AQYDLFT-MSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSVLDYATGGLSFFVVALG-GAAVGIIFAIAASLTTKYTYDVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTISS---QHHFDLYFICATLFFCLIYRAIGIVVQCYILNRFRAKKFEMVDQ-FIMSYGGLRGAIAYGLVVSIPASITAKPMFITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKG-HYTFIENFERFNAKVIKPVLMRHQKRE-SFDASSIVRAYEKITLEDAIKLA 471          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 201.06 bits (510), Expect = 9.554e-55
Identity = 147/476 (30.88%), Postives = 245/476 (51.47%), Query Frame = 1
Query:  391 PESAFLITAGIIPAVAMLLLGVTLDG-TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNA-AILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIA 1806
            P+S+ LI  G+  A+  +L   +L G TL +  FF  +L PI+  AG+       + N  ++L F++FGTI N  AI   LL     ++++ +T +     +  ++S LI AVDPVAV++VFE +H+++ ++  VFGE+L NDGV VV Y  F     I   NL   +       FF+ A G    +    AI  S  +K  Y  + +  V +  L Y+ Y+  + +  S I+++  C ++ KQY+  N++  +   V      LA  SE ++F+ +GL+  S      + D+ F    +F C + R I I    +I N FR +K +     FI S+GGLRGAI + L ++I  +   + ++ TAT  +++F+VF+ G TI+PLVN  K+  +     T+  S+  K  D    G++ I G     + +   + +FN K  K   M  +  E S   SS+V+ +   ++ +A ++A
Sbjct:    9 PDSSLLIIVGL--ALGWILHQTSLSGATLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLM---AQYDLFT-MSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSVLDYATGGLSFFVVALG-GAAVGIIFAIAASLTTKYTYDVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTISS---QHHFDLYFICATLFFCLIYRAIGIVVQCYILNRFRAKKFEMVDQ-FIMSYGGLRGAIAYGLVVSIPASITAKPMFITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKG-HYTFIENFERFNAKVIKPVLMRHQKRE-SFDASSIVRAYEKITLEDAIKLA 471          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 200.29 bits (508), Expect = 3.491e-54
Identity = 147/476 (30.88%), Postives = 245/476 (51.47%), Query Frame = 1
Query:  391 PESAFLITAGIIPAVAMLLLGVTLDG-TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNA-AILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIA 1806
            P+S+ LI  G+  A+  +L   +L G TL +  FF  +L PI+  AG+       + N  ++L F++FGTI N  AI   LL     ++++ +T +     +  ++S LI AVDPVAV++VFE +H+++ ++  VFGE+L NDGV VV Y  F     I   NL   +       FF+ A G    +    AI  S  +K  Y  + +  V +  L Y+ Y+  + +  S I+++  C ++ KQY+  N++  +   V      LA  SE ++F+ +GL+  S      + D+ F    +F C + R I I    +I N FR +K +     FI S+GGLRGAI + L ++I  +   + ++ TAT  +++F+VF+ G TI+PLVN  K+  +     T+  S+  K  D    G++ I G     + +   + +FN K  K   M  +  E S   SS+V+ +   ++ +A ++A
Sbjct:   49 PDSSLLIIVGL--ALGWILHQTSLSGATLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLM---AQYDLFT-MSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSVLDYATGGLSFFVVALG-GAAVGIIFAIAASLTTKYTYDVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTISS---QHHFDLYFICATLFFCLIYRAIGIVVQCYILNRFRAKKFEMVDQ-FIMSYGGLRGAIAYGLVVSIPASITAKPMFITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKG-HYTFIENFERFNAKVIKPVLMRHQKRE-SFDASSIVRAYEKITLEDAIKLA 511          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 200.29 bits (508), Expect = 5.611e-54
Identity = 147/476 (30.88%), Postives = 245/476 (51.47%), Query Frame = 1
Query:  391 PESAFLITAGIIPAVAMLLLGVTLDG-TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNA-AILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIA 1806
            P+S+ LI  G+  A+  +L   +L G TL +  FF  +L PI+  AG+       + N  ++L F++FGTI N  AI   LL     ++++ +T +     +  ++S LI AVDPVAV++VFE +H+++ ++  VFGE+L NDGV VV Y  F     I   NL   +       FF+ A G    +    AI  S  +K  Y  + +  V +  L Y+ Y+  + +  S I+++  C ++ KQY+  N++  +   V      LA  SE ++F+ +GL+  S      + D+ F    +F C + R I I    +I N FR +K +     FI S+GGLRGAI + L ++I  +   + ++ TAT  +++F+VF+ G TI+PLVN  K+  +     T+  S+  K  D    G++ I G     + +   + +FN K  K   M  +  E S   SS+V+ +   ++ +A ++A
Sbjct:   69 PDSSLLIIVGL--ALGWILHQTSLSGATLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLM---AQYDLFT-MSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSVLDYATGGLSFFVVALG-GAAVGIIFAIAASLTTKYTYDVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTISS---QHHFDLYFICATLFFCLIYRAIGIVVQCYILNRFRAKKFEMVDQ-FIMSYGGLRGAIAYGLVVSIPASITAKPMFITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKG-HYTFIENFERFNAKVIKPVLMRHQKRE-SFDASSIVRAYEKITLEDAIKLA 531          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0299911)

HSP 1 Score: 198.749 bits (504), Expect = 4.690e-53
Identity = 136/418 (32.54%), Postives = 222/418 (53.11%), Query Frame = 1
Query:  472 LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMD-LVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFY---SAFND--MKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFK 1704
            L+   FF  +L PI++ AG+      F+ N+GTIL  A+ GTI N A +   L+   K     Y + +   L+D  L++ LI AVDPVAVL+VFE +H+++++Y VVFGESLLND V VV Y    ++N+  +  I        VG  FV  L    I ++      ++  F      H + ++ + +  + YL Y+  +    SGIL++ FC +  K YV +N+S  S+  V   L  L+  +E I+F+ +G+   +   +    +  F    I  C V R I +  L  +AN FR  KL  R   F+ S+GGLRGA+ FAL L + +N  + + ++ T T  +++F+VF+ G TIKPLV +  V   +    T+   ++E+  D    GI+ I+G +   +    ++++F+N+  +
Sbjct:  251 LTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGK--MGIYGESETPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTD----HVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHV---WNTWFVVLTIAFCSVFRVIGVILLSALANRFRLHKLS-RVDQFVMSYGGLRGAVAFALVLLVDENVVKQKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTG-NYNVRDKFKRFDNRFIR 657          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0299909)

HSP 1 Score: 197.593 bits (501), Expect = 6.443e-53
Identity = 136/418 (32.54%), Postives = 221/418 (52.87%), Query Frame = 1
Query:  472 LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMD-LVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFY---SAFND--MKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFK 1704
            L+   FF  +L PI++ AG+      F+ N+GTIL  A+ GTI N A +   L+   K     Y + +   L+D  L++ LI AVDPVAVL+VFE +H+++++Y VVFGESLLND V VV Y    ++N+  +  I        VG  FV  L    I ++      ++  F      H + ++ + +  + YL Y+  +    SGIL++ FC +  K YV +N+S  S+  V   L  L+  +E I+F+ +G+   +   +       F    I  C V R I +  L  +AN FR  KL  R   F+ S+GGLRGA+ FAL L + +N  + + ++ T T  +++F+VF+ G TIKPLV +  V   +    T+   ++E+  D    GI+ I+G +   +    ++++F+N+  +
Sbjct:  251 LTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGK--MGIYGESETPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTD----HVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHVWNTW---FVVLTIAFCSVFRVIGVILLSALANRFRLHKLS-RVDQFVMSYGGLRGAVAFALVLLVDENVVKQKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTG-NYNVRDKFKRFDNRFIR 657          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0334172)

HSP 1 Score: 201.06 bits (510), Expect = 1.321e-52
Identity = 152/534 (28.46%), Postives = 264/534 (49.44%), Query Frame = 1
Query:  472 LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMD-LVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFY---SAFND--MKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDLFQSDNDVRFRMYKKAWXXXXXXXXXXXXXGKVPDHLYNSMSIP-DLAILDKTITRRDVDDQMTHHNMQEGM 2049
            L+   FF  +L PI++ AG+      F+ N+GTIL  A+ GTI N A +   L+   K     Y + +   L+D  L++ LI AVDPVAVL+VFE +H+++++Y VVFGESLLND V VV Y    ++N+  +  I        VG  FV  L    I ++      ++  F      H + ++ + +  + YL Y+  +    SGIL++ FC +  K YV +N+S  S+  V   L  L+  +E I+F+ +G+   +   +    +  F    I  C V R I +  L  +AN FR  KL  R   F+ S+GGLRGA+ FAL L + +N  + + ++ T T  +++F+VF+ G TIKPLV +  V   +    T+   ++E+  D    GI+ I+G +   +    ++++F+N+  +   +     +   +   +++ +   ++ +A ++     + + +          FR Y   +           +      +L N+ S   D+A LD   +++D+ D   HH + E +
Sbjct:  251 LTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGK--MGIYGESETPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTD----HVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHV---WNTWFVVLTIAFCSVFRVIGVILLSALANRFRLHKLS-RVDQFVMSYGGLRGAVAFALVLLVDENVVKQKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTG-NYNVRDKFKRFDNRFIRPLLIR----DLKGAEPKIIETYSKLTMRDAMEVMRRNPSTIGQMTGTESMSALFRNYTNNYIGGRWAPPTIYTTCPSLTNLDNTCSRNLDMAELDYNPSKKDLTDARIHHLLAEEL 769          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0306016)

HSP 1 Score: 200.29 bits (508), Expect = 2.249e-52
Identity = 136/415 (32.77%), Postives = 221/415 (53.25%), Query Frame = 1
Query:  472 LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMD-LVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFY---SAFND--MKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNK 1695
            L+   FF  +L PI++ AG+      F+ N+GTIL  A+ GTI N A +   L+   K     Y + +   L+D  L++ LI AVDPVAVL+VFE +H+++++Y VVFGESLLND V VV Y    ++N+  +  I        VG  FV  L    I ++      ++  F      H + ++ + +  + YL Y+  +    SGIL++ FC +  K YV +N+S  S+  V   L  L+  +E I+F+ +G+   +   +    +  F    I  C V R I +  L  +AN FR  KL  R   F+ S+GGLRGA+ FAL L + +N  + + ++ T T  +++F+VF+ G TIKPLV +  V   +    T+   ++E+  D    GI+ I+G +   +    ++++F+N+
Sbjct:  251 LTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGK--MGIYGESETPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTD----HVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHV---WNTWFVVLTIAFCSVFRVIGVILLSALANRFRLHKLS-RVDQFVMSYGGLRGAVAFALVLLVDENVVKQKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTG-NYNVRDKFKRFDNR 654          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0306015)

HSP 1 Score: 200.29 bits (508), Expect = 2.596e-52
Identity = 136/415 (32.77%), Postives = 221/415 (53.25%), Query Frame = 1
Query:  472 LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMD-LVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFY---SAFND--MKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNK 1695
            L+   FF  +L PI++ AG+      F+ N+GTIL  A+ GTI N A +   L+   K     Y + +   L+D  L++ LI AVDPVAVL+VFE +H+++++Y VVFGESLLND V VV Y    ++N+  +  I        VG  FV  L    I ++      ++  F      H + ++ + +  + YL Y+  +    SGIL++ FC +  K YV +N+S  S+  V   L  L+  +E I+F+ +G+   +   +    +  F    I  C V R I +  L  +AN FR  KL  R   F+ S+GGLRGA+ FAL L + +N  + + ++ T T  +++F+VF+ G TIKPLV +  V   +    T+   ++E+  D    GI+ I+G +   +    ++++F+N+
Sbjct:  251 LTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGK--MGIYGESETPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTD----HVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHV---WNTWFVVLTIAFCSVFRVIGVILLSALANRFRLHKLS-RVDQFVMSYGGLRGAVAFALVLLVDENVVKQKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTG-NYNVRDKFKRFDNR 654          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a2 (solute carrier family 9 member 2 [Source:ZFIN;Acc:ZDB-GENE-070912-541])

HSP 1 Score: 197.208 bits (500), Expect = 4.554e-52
Identity = 133/476 (27.94%), Postives = 250/476 (52.52%), Query Frame = 1
Query:  391 PESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFV---FFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYL--IFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQI 1803
            PES  LI+ G +    M  +       +S+ +FF  +L PI++ +G+      F+ N+GT++WFA+ GT+ N   +   LF  +  +   +   D++L +  L++ ++ AV+PVAVLSVFE + I++ +Y V+FGE L ND V VV Y+ FN +  +      +   ++F+    F       +        + +F ++     + ++ +V+   +Y++Y+I +    S I+++  C +  K YV  N+S  S   +  V+  +  +SE ++F  +G+ +     I+T  +  + + L  +F     R++ I  L  I N FRK   +++   F  ++GGLRGA+ FAL+ T+ ++   R ++ T T  ++ F+VF+ G TI+PL+ L  +   +   +TI   +++++ + T  GI+ + G  S  +RW+  + KFNN+     F+ K  I  +   SS+V L++   +  A +I
Sbjct:  104 PESCLLISLGFVVGGVMHAVRKEPPAVISSNVFFLYMLPPIILESGYFMPTRPFFENVGTVMWFAVVGTLWNTMGIGISLF--AICQIEEFGVQDINLQENLLFAAILSAVEPVAVLSVFEDISINEQLYIVMFGECLFNDAVTVVLYNLFNHVAAME----VDEPAVIFMDIGGFFVVGLGGIFFGLLFGFLTAFTTRFTGKVREIEPLVIFMFSYMSYLIAELFALSSIMAILICTLSMKYYVEENVSQRSCTTIRHVIKMVGSVSETLIFFFLGVVS-----ITTEHEWNWGYILFTLFFTLFWRFLGILVLTQIINPFRKIPFNFQDQ-FGLAYGGLRGALSFALAFTLPNSIPHRKLFITDTIAVIIFTVFIQGITIRPLLKLMNIRKTNRNLETINDEIHKRLMEHTVAGIEDLCGQWS-HYRWKDMFMKFNNR-----FIRKILIRDNRPESSIVSLYKKLELRNALEI 561          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a1b (solute carrier family 9 member A1b [Source:ZFIN;Acc:ZDB-GENE-080225-42])

HSP 1 Score: 192.2 bits (487), Expect = 4.342e-51
Identity = 145/456 (31.80%), Postives = 241/456 (52.85%), Query Frame = 1
Query:  385 IFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVF---VFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERS 1740
            + PES  LI  G++    + +LG      L +++FF  +L PI++ AG+      F  N+GTIL FA+ GT L +A  M +  YG+  +        +DL+   L+  ++ AVDPVAVL+VF+ +HI++L++ +VFGESLLND V VV Y  F +       R   + G VF   V F       VL+ C    + +F S+   H + ++ + +   +Y+ Y+  +    SGI++L  C V+ + YV AN+S+ S   +   L   + +SE ++FI +G++  +G      T V  T   + LC +SR + +  L FI N +R  KL   K  FI ++GGLRGAI F+L+ L   ++   + ++ TA   ++FF+VFV G TI+PLV+L  V  +     ++   ++ +  +    GI+ + G       W  +  +FN ++  ++ +     ERS
Sbjct:   68 VVPESCVLIVVGLLVGGLIRVLGED-PPVLDSQLFFLCLLPPIILDAGYFLPIRPFMENVGTILTFAVLGT-LWSAFFMGVALYGA-CQLEGAELAGVDLLSCLLFGSIVSAVDPVAVLAVFQEIHINELLHILVFGESLLNDAVTVVLYHLFEEFVH----RGEVTAGDVFLGVVCFFVVSVGGVLVGCVYGFLAAFTSRFTAHTRVIEPLFVFLYSYMAYLSAEVFHLSGIMALIACGVVMRPYVEANISHKSYTTIKYFLKMWSSVSETLIFIFLGVSTVAGPHAWNWTFVSLT---LALCLLSRVLGVVGLTFIINKYRMVKLS-GKDQFIVAYGGLRGAIAFSLAFLLSSESCAMKDLFLTAVITVIFFTVFVQGMTIRPLVDLLAVKKKKQSKFSVNEEIHTQFLEHLLTGIEDVCGHYG-HHHWRDKISRFNKRYMMRFLIGG---ERS 508          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a5 (solute carrier family 9 member A5 [Source:ZFIN;Acc:ZDB-GENE-080225-43])

HSP 1 Score: 191.43 bits (485), Expect = 1.157e-49
Identity = 141/461 (30.59%), Postives = 234/461 (50.76%), Query Frame = 1
Query:  391 PESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDM-----KTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNY-EFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSS 1755
            PES  LI  G+     +LL        L   +FF  +L  IV  AG+      F+ N+G IL +A+ GT+ NA        YG K       K+D  L++  L+  LI AVDPVAVL+VFE +H+++ ++ +VFGESLLND V VV Y  +          +    +F+ +     F + + G   L+    A+I++F ++     + ++ + +  L YL Y+  +    S ILSL FC +   +YV AN+S  S   V   +  LA ++E I+FI +G++A   +  + +T +  +  +  L + +  ++  T  +  N+FR   LD +    + S+GGLRGA+ FAL + +   + + +  +   T ++VFF+V   G TIKPLV   KVP  ++   TI   ++E+  D     ++ I G +     W  ++ +F+     K ++SK  + +SV H S
Sbjct:  125 PESCMLILLGLALGTVVLLASKKQPYQLDPGLFFLFLLPTIVGDAGYFMPARLFFDNLGAILMYAVVGTLWNA-FCTGFCLYGVKMAGVIDEKVDAGLMEFLLFGALISAVDPVAVLAVFEEVHVNETLFIIVFGESLLNDAVTVVLYKVYISFVEVGPGNVNTADYFKGIA---SFLIVSIG-GTLVGLIFAVILAFFTRFTKKVRIIEPMFIFLLVYLAYLTAELFSLSAILSLTFCGIGCNKYVEANISQKSRTTVKYTMKTLASIAETIIFIFLGISAVDKSKWAWDTGLVVSTLIFILVFRAMGVIGQT--WFLNWFRLVPLD-KIDQVVMSYGGLRGAVAFALVVLLDKEHVKAKDYFVATTIVVVFFTVMFQGLTIKPLVKWLKVPRSTNRKPTINEEIHERAFDHILAAVEDIAGLNGYH-HWRDKWEQFD-----KNYLSKLLLRKSVYHKS 571          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060503-545])

HSP 1 Score: 185.267 bits (469), Expect = 5.651e-48
Identity = 143/474 (30.17%), Postives = 242/474 (51.05%), Query Frame = 1
Query:  325 VAKRSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGT--LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITN--LRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETR-YRKFNNKHFKKWFMSKKS 1728
            VA  +    + L H  +   +FPES  LI  G I  +  +++G     T  L    FF  +L  I++ A +      F+RN+G IL +AIFGT  NAA +  L  +G          L++ L+   L+  LI AVDPVAV++VFE +H++++++ +VFGESLLNDGV VV Y+ F+   ++    +   E    +  F + AFG S  +    AI++S +++   H Q ++   +  + YL+Y+  + +  S ILS+ FC V  ++Y+ AN+   S   V   +  LA  SE ++F+ +G+TA        NT   F    +   ++ R I ++   ++ N FR   ++    + + S+GGLRGA+ + L+  + ++    + +  + T I+V+F+V + G T+KPLV   KV   +H    +   LN +  D     ++ I G   +   W TR + +F  K+     M  K+
Sbjct:   66 VAGLAKLSVIQLNHSIT--GVFPESGLLIILGFI--LGGIVVGADKAQTFKLLPSTFFYYLLPQIILDASYFMPNKLFFRNLGAILIYAIFGTCWNAAAV-GLSLWGCHEA-GAMGDLNIGLLQFLLFGSLIAAVDPVAVIAVFEEVHVNEVLFILVFGESLLNDGVTVVLYNVFDGFVSLGGPMIDAAEIFKGICSFVVVAFGGS-FVGVAFAILLSLLTRCTKHVQIIEAGFVFLVGYLSYLTAEMLSLSAILSITFCGVCCQKYINANMDERSVTTVRHAMKMLANGSETMIFLFLGVTAIDTEIWVWNTG--FILLTLLFIFIYRIIGVFMFTWMLNKFRLVPVELIDQV-VMSYGGLRGAVAYGLAAMLDESRIPEKKLMISTTLIVVYFTVILQGITMKPLVQWLKVKRAAHSDLKLVEKLNNRAFDHILAAVEDICG--RIGDNWWTRGWNRFEEKYISWLLMKPKA 527          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060503-545])

HSP 1 Score: 185.267 bits (469), Expect = 5.651e-48
Identity = 143/474 (30.17%), Postives = 242/474 (51.05%), Query Frame = 1
Query:  325 VAKRSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGT--LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITN--LRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETR-YRKFNNKHFKKWFMSKKS 1728
            VA  +    + L H  +   +FPES  LI  G I  +  +++G     T  L    FF  +L  I++ A +      F+RN+G IL +AIFGT  NAA +  L  +G          L++ L+   L+  LI AVDPVAV++VFE +H++++++ +VFGESLLNDGV VV Y+ F+   ++    +   E    +  F + AFG S  +    AI++S +++   H Q ++   +  + YL+Y+  + +  S ILS+ FC V  ++Y+ AN+   S   V   +  LA  SE ++F+ +G+TA        NT   F    +   ++ R I ++   ++ N FR   ++    + + S+GGLRGA+ + L+  + ++    + +  + T I+V+F+V + G T+KPLV   KV   +H    +   LN +  D     ++ I G   +   W TR + +F  K+     M  K+
Sbjct:   66 VAGLAKLSVIQLNHSIT--GVFPESGLLIILGFI--LGGIVVGADKAQTFKLLPSTFFYYLLPQIILDASYFMPNKLFFRNLGAILIYAIFGTCWNAAAV-GLSLWGCHEA-GAMGDLNIGLLQFLLFGSLIAAVDPVAVIAVFEEVHVNEVLFILVFGESLLNDGVTVVLYNVFDGFVSLGGPMIDAAEIFKGICSFVVVAFGGS-FVGVAFAILLSLLTRCTKHVQIIEAGFVFLVGYLSYLTAEMLSLSAILSITFCGVCCQKYINANMDERSVTTVRHAMKMLANGSETMIFLFLGVTAIDTEIWVWNTG--FILLTLLFIFIYRIIGVFMFTWMLNKFRLVPVELIDQV-VMSYGGLRGAVAYGLAAMLDESRIPEKKLMISTTLIVVYFTVILQGITMKPLVQWLKVKRAAHSDLKLVEKLNNRAFDHILAAVEDICG--RIGDNWWTRGWNRFEEKYISWLLMKPKA 527          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: tbl3 (transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GENE-1012176])

HSP 1 Score: 217.238 bits (552), Expect = 5.375e-60
Identity = 153/488 (31.35%), Postives = 252/488 (51.64%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFY-----GSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMI 1830
             + PES  LI  G++    +  +G T    L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  LLF      G   R       ++ L+   L+  +I AVDPVAVL+VFE +HI+ L++ +VFGESLLND V VV Y  F +   +  + F   + L F+ FL      V +     II +F S+   H + ++ + +   +Y+ Y+  +    SGI++L    V+ + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G       + P+    +  C+V+R + +  L +  N FR  KL   K  FI ++GGLRGAI F+L   + DN+  R ++ TA   ++FF+VFV G TI+PLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN  + KK  ++    ERS +   ++  +    + +A ++    G G I
Sbjct:   78 GVVPESCLLIVVGLLVGGLIKAVGET-PPVLKSDVFFLFLLPPIILDAGYFLPLRPFSENLGTILMFAVIGTLWNAFFMGSLLFAVCQIGGEDLR-------NVGLLANLLFGSIISAVDPVAVLAVFEEIHINDLLHILVFGESLLNDAVTVVLYHLFEEFAALEQITF-RDISLGFLSFLVVALGGVFVGLVYGIIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIAAGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAG---PHKWNWPYVISTLIFCFVARVLGVLGLTWFINKFRIVKLT-PKDQFIIAYGGLRGAIAFSLGYLLDDNHFPREMFLTAIITVIFFTVFVQGMTIRPLVELLAVKKKQESKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKTYVKKCLIAG---ERS-TEPQLIAFYHKMEMKQAIELVESGGIGKI 547          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: tbl3 (transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GENE-1012176])

HSP 1 Score: 218.779 bits (556), Expect = 1.393e-59
Identity = 153/489 (31.29%), Postives = 252/489 (51.53%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFY-----GSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIK 1833
             + PES  LI  G++    +  +G T    L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  LLF      G   R       ++ L+   L+  +I AVDPVAVL+VFE +HI+ L++ +VFGESLLND V VV Y  F +   +  + F   + L F+ FL      V +     II +F S+   H + ++ + +   +Y+ Y+  +    SGI++L    V+ + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G       + P+    +  C+V+R + +  L +  N FR  KL   K  FI ++GGLRGAI F+L   + DN+  R ++ TA   ++FF+VFV G TI+PLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN  + KK  ++    ERS +   ++  +    + +A ++    G G I 
Sbjct:   74 GVVPESCLLIVVGLLVGGLIKAVGET-PPVLKSDVFFLFLLPPIILDAGYFLPLRPFSENLGTILMFAVIGTLWNAFFMGSLLFAVCQIGGEDLR-------NVGLLANLLFGSIISAVDPVAVLAVFEEIHINDLLHILVFGESLLNDAVTVVLYHLFEEFAALEQITF-RDISLGFLSFLVVALGGVFVGLVYGIIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIAAGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAG---PHKWNWPYVISTLIFCFVARVLGVLGLTWFINKFRIVKLT-PKDQFIIAYGGLRGAIAFSLGYLLDDNHFPREMFLTAIITVIFFTVFVQGMTIRPLVELLAVKKKQESKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKTYVKKCLIAG---ERS-TEPQLIAFYHKMEMKQAIELVESGGIGKIP 544          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: tbl3 (transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GENE-1012176])

HSP 1 Score: 216.083 bits (549), Expect = 1.397e-59
Identity = 153/490 (31.22%), Postives = 252/490 (51.43%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFY-----GSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKD 1836
             + PES  LI  G++    +  +G T    L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  LLF      G   R       ++ L+   L+  +I AVDPVAVL+VFE +HI+ L++ +VFGESLLND V VV Y  F +   +  + F   + L F+ FL      V +     II +F S+   H + ++ + +   +Y+ Y+  +    SGI++L    V+ + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G       + P+    +  C+V+R + +  L +  N FR  KL   K  FI ++GGLRGAI F+L   + DN+  R ++ TA   ++FF+VFV G TI+PLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN  + KK  ++    ERS +   ++  +    + +A ++    G G I  
Sbjct:  105 GVVPESCLLIVVGLLVGGLIKAVGET-PPVLKSDVFFLFLLPPIILDAGYFLPLRPFSENLGTILMFAVIGTLWNAFFMGSLLFAVCQIGGEDLR-------NVGLLANLLFGSIISAVDPVAVLAVFEEIHINDLLHILVFGESLLNDAVTVVLYHLFEEFAALEQITF-RDISLGFLSFLVVALGGVFVGLVYGIIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIAAGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAG---PHKWNWPYVISTLIFCFVARVLGVLGLTWFINKFRIVKLT-PKDQFIIAYGGLRGAIAFSLGYLLDDNHFPREMFLTAIITVIFFTVFVQGMTIRPLVELLAVKKKQESKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKTYVKKCLIAG---ERS-TEPQLIAFYHKMEMKQAIELVESGGIGKIPS 576          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: tbl3 (transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GENE-1012176])

HSP 1 Score: 219.164 bits (557), Expect = 1.634e-59
Identity = 153/488 (31.35%), Postives = 252/488 (51.64%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLF----YGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIK 1833
             + PES  LI  G++    +  +G T    L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  LLF     G +   N      + L+   L+  +I AVDPVAVL+VFE +HI+ L++ +VFGESLLND V VV Y  F +   +  + F   + L F+ FL      V +     II +F S+   H + ++ + +   +Y+ Y+  +    SGI++L    V+ + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G       + P+    +  C+V+R + +  L +  N FR  KL   K  FI ++GGLRGAI F+L   + DN+  R ++ TA   ++FF+VFV G TI+PLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN  + KK  ++    ERS +   ++  +    + +A ++    G G I 
Sbjct:  105 GVVPESCLLIVVGLLVGGLIKAVGET-PPVLKSDVFFLFLLPPIILDAGYFLPLRPFSENLGTILMFAVIGTLWNAFFMGSLLFAVCQIGGEDLRN------VGLLANLLFGSIISAVDPVAVLAVFEEIHINDLLHILVFGESLLNDAVTVVLYHLFEEFAALEQITF-RDISLGFLSFLVVALGGVFVGLVYGIIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIAAGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAG---PHKWNWPYVISTLIFCFVARVLGVLGLTWFINKFRIVKLT-PKDQFIIAYGGLRGAIAFSLGYLLDDNHFPREMFLTAIITVIFFTVFVQGMTIRPLVELLAVKKKQESKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKTYVKKCLIAG---ERS-TEPQLIAFYHKMEMKQAIELVESGGIGKIP 575          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: tbl3 (transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GENE-1012176])

HSP 1 Score: 219.55 bits (558), Expect = 1.911e-59
Identity = 153/488 (31.35%), Postives = 252/488 (51.64%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLF----YGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIK 1833
             + PES  LI  G++    +  +G T    L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  LLF     G +   N      + L+   L+  +I AVDPVAVL+VFE +HI+ L++ +VFGESLLND V VV Y  F +   +  + F   + L F+ FL      V +     II +F S+   H + ++ + +   +Y+ Y+  +    SGI++L    V+ + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G       + P+    +  C+V+R + +  L +  N FR  KL   K  FI ++GGLRGAI F+L   + DN+  R ++ TA   ++FF+VFV G TI+PLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN  + KK  ++    ERS +   ++  +    + +A ++    G G I 
Sbjct:  126 GVVPESCLLIVVGLLVGGLIKAVGET-PPVLKSDVFFLFLLPPIILDAGYFLPLRPFSENLGTILMFAVIGTLWNAFFMGSLLFAVCQIGGEDLRN------VGLLANLLFGSIISAVDPVAVLAVFEEIHINDLLHILVFGESLLNDAVTVVLYHLFEEFAALEQITF-RDISLGFLSFLVVALGGVFVGLVYGIIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIAAGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAG---PHKWNWPYVISTLIFCFVARVLGVLGLTWFINKFRIVKLT-PKDQFIIAYGGLRGAIAFSLGYLLDDNHFPREMFLTAIITVIFFTVFVQGMTIRPLVELLAVKKKQESKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKTYVKKCLIAG---ERS-TEPQLIAFYHKMEMKQAIELVESGGIGKIP 596          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a2 (solute carrier family 9 (sodium/hydrogen exchanger), member 2 [Source:MGI Symbol;Acc:MGI:105075])

HSP 1 Score: 223.402 bits (568), Expect = 8.959e-61
Identity = 158/507 (31.16%), Postives = 267/507 (52.66%), Query Frame = 1
Query:  385 IFPESAFLITAGIIPAVAMLLLGVTLDGTLSAK--IFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDL--FQSDNDVRFRMYKK 1881
            I PES  LI  G++  +  ++ GV      + K  +FF  +L PIV+ AG+      F+ N GTI W+A+ GT+ N+  +   LF     +   +   D+ L+   L+  LI AVDPVAVL+VFE +H+++ +Y +VFGESLLND V VV Y+   +F  MKTI  +  F  +     FF+   G  VL+   +  I +F ++  ++ + ++ + +   +YL+Y+  +    SGI+++  C +   +YV  N+S  S   +   +  L+ +SE ++FI MG+   S  G +   +  F  + +  C + R + ++ L  + N+FR   L + K  FI ++GGLRGAI FAL   +    +  + ++ TA  +++FF+VF+LG TI+PLV    V   +   + +   ++ +  D  K GI+ + G     F W  +++KF++K+ +K       I  +   SS+V L++   I  A ++A     GMI  +  F S ND R    +K
Sbjct:  108 IVPESCLLIMVGLL--LGGIIFGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENFGTIFWYAVVGTLWNSIGIGVSLF--GICQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIQTVDVFAGIA---NFFVVGIG-GVLIGILLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGV---STVGKNHEWNWAFVCFTLAFCLIWRALGVFVLTQVINWFRTIPLTF-KDQFIIAYGGLRGAICFALVFLLPATVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIHCRFFDHVKTGIEDVCGHWGHNF-WRDKFKKFDDKYLRKLL-----IRENQPKSSIVSLYKKLEIKHAIEMA---ETGMISTVPSFASLNDCREEKIRK 593          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a1 (solute carrier family 9 (sodium/hydrogen exchanger), member 1 [Source:MGI Symbol;Acc:MGI:102462])

HSP 1 Score: 202.601 bits (514), Expect = 1.067e-53
Identity = 156/495 (31.52%), Postives = 255/495 (51.52%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGT-LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLF----YGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVG-----LVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIK 1833
            +I PES  LI  G++  V  L+ GV      L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  L  LL+     G +   N      + L+D  L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +  +      ++SVG     L F+ F       V +     +I +F S+   H + ++ + +   +Y+ Y+  +    SGI++L    V+ + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G   S   +  F    +  C ++R + +  L +  N FR  KL   K  FI ++GGLRGAI F+L  L    ++    ++ TA   ++FF+VFV G TI+PLV+L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KK  ++    ERS     ++  +    + +A ++    G G I 
Sbjct:  131 SIVPESCLLIVVGLL--VGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLLYAVCLVGGEQINN------IGLLDTLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFAS------YDSVGISDIFLGFLSFFVVALGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAG---SHQWNWTFVISTLLFCLIARVLGVLVLTWFINKFRIVKLT-PKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKKYVKKCLIAG---ERS-KEPQLIAFYHKMEMKQAIELVESGGMGKIP 602          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a4 (solute carrier family 9 (sodium/hydrogen exchanger), member 4 [Source:MGI Symbol;Acc:MGI:105074])

HSP 1 Score: 198.364 bits (503), Expect = 1.930e-52
Identity = 144/486 (29.63%), Postives = 259/486 (53.29%), Query Frame = 1
Query:  358 LTHRTSPGNIFPESAFLITAGIIPAVAMLLLGV--TLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNA-AILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEA 1794
            L HR    ++ PES  LI  G +  V  ++ G        + + I+F  +L PIV+ +G+      F+ NIG+ILW+A  G ++NA  I + L F      +      D++L+   L+  LI AVDPVAVL+VFE   +++ +Y ++FGE+LLNDG++VV Y+   AF  M    ++   + +     F +   G  V        I +FI++   +   ++ +++   +YL+Y+  +T+  SGIL++  C V  K+YV  N+S TS   +   +  L+ +SE ++FI MG+   S  G +   +  F  + +  C + R I ++TL +++N FR       K  FI  + G+RGA  F+L+  +  + +  + ++ TAT ++ +F+VF  G TI PLV    V  +++  ++I   L+ ++ D  K GI+ + G  S  ++   +++KF++++ +K       I R++  SS+V L++   + +A
Sbjct:   89 LYHRLP--HLMPESCLLIIVGAL--VGGIIFGTHHKSPPVMDSSIYFLYLLPPIVLESGYFMPTRPFFENIGSILWWAGLGALINAFGIGLSLYFICQIKAFGLG---DINLLHNLLFGSLISAVDPVAVLAVFEEARVNEQLYMMIFGEALLNDGISVVLYNILIAFTKMHKFEDIEAVDILAGCARFVIVGCG-GVFFGIIFGFISAFITRFTQNISAIEPLIVFMFSYLSYLAAETLYLSGILAITACAVTMKKYVEENVSQTSYTTIKYFMKMLSSVSETLIFIFMGV---STIGKNHEWNWAFICFTLLFCQIWRAISVFTLFYVSNQFRTFPFSI-KDQFIIFYSGVRGAGSFSLAFLLPLSLFPRKKLFVTATLVVTYFTVFFQGITIGPLVRYLDV-RKTNKKESINEELHSRLMDHLKAGIEDVCGQWS-HYQVRDKFKKFDHRYLRKIL-----IRRNLPKSSIVSLYKKLEMKQA 555          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a3 (solute carrier family 9 (sodium/hydrogen exchanger), member 3 [Source:MGI Symbol;Acc:MGI:105064])

HSP 1 Score: 194.897 bits (494), Expect = 3.571e-51
Identity = 155/466 (33.26%), Postives = 250/466 (53.65%), Query Frame = 1
Query:  337 SLCRTV-CLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITN--LRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVS--RYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGD-NYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDR-------TKEGIKAIIGSSSLRFRWETRYRKFNNK 1695
            SL + V  L+H+ +  +I PESA LI  G++    +         TL+  +FF  +L PIV+ AG+      F+ N+GTIL +A+ GTI NAA    L  YG         +L + L+D  L+  LI AVDPVAVL+VFE +H++++++ +VFGESLLND V VV Y+ F    T+    +   + V  +  FF+ + G   L+    A ++S +++   H + ++   +  ++YL+Y+  + +  S IL++ FC +  ++YV AN+S  S   V   +  LA  +E I+F+ +G++A +    + NT     F L+ L ++S  R I +    +I N +R  +L+    + + S+GGLRGA+ +AL + + +   + + ++ + T I+VFF+V   G TIKPLV   KV    H        LNEK+  R         E I   IG + LR +W    RKF +K
Sbjct:   61 SLAKIVFHLSHKVT--SIVPESALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAAT-TGLSLYGVFLS-GLMGELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLG-GTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVNPDIWTWNT----AFVLLTLVFISVYRAIGVVLQTWILNRYRMVQLETIDQV-VMSYGGLRGAVAYALVVLLDEKKVKEKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEHREP----KLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSK 512          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a3 (solute carrier family 9 (sodium/hydrogen exchanger), member 3 [Source:MGI Symbol;Acc:MGI:105064])

HSP 1 Score: 194.897 bits (494), Expect = 3.571e-51
Identity = 155/466 (33.26%), Postives = 250/466 (53.65%), Query Frame = 1
Query:  337 SLCRTV-CLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITN--LRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVS--RYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGD-NYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDR-------TKEGIKAIIGSSSLRFRWETRYRKFNNK 1695
            SL + V  L+H+ +  +I PESA LI  G++    +         TL+  +FF  +L PIV+ AG+      F+ N+GTIL +A+ GTI NAA    L  YG         +L + L+D  L+  LI AVDPVAVL+VFE +H++++++ +VFGESLLND V VV Y+ F    T+    +   + V  +  FF+ + G   L+    A ++S +++   H + ++   +  ++YL+Y+  + +  S IL++ FC +  ++YV AN+S  S   V   +  LA  +E I+F+ +G++A +    + NT     F L+ L ++S  R I +    +I N +R  +L+    + + S+GGLRGA+ +AL + + +   + + ++ + T I+VFF+V   G TIKPLV   KV    H        LNEK+  R         E I   IG + LR +W    RKF +K
Sbjct:   61 SLAKIVFHLSHKVT--SIVPESALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAAT-TGLSLYGVFLS-GLMGELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLG-GTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVNPDIWTWNT----AFVLLTLVFISVYRAIGVVLQTWILNRYRMVQLETIDQV-VMSYGGLRGAVAYALVVLLDEKKVKEKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEHREP----KLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSK 512          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|Q01345|NHEB_ONCMY (Na(+)/H(+) exchanger beta OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.626e-62
Identity = 145/470 (30.85%), Postives = 253/470 (53.83%), Query Frame = 1
Query:  385 IFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEA 1794
            + PES  LI  G++    + ++G      L +++FF  +L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  LL+  +  +        +DL+   L+  ++ AVDPVAVL+VFE +HI++LV+ +VFGESLLND V VV Y+ F +   +  +   +    V  FF+ + G  VL+      + +F S+   H + ++ + +   +Y+ Y+  +    SGI++L  C V+ + YV AN+S+ S   +   L   + +SE ++FI +G++  +G      T   F    + LC VSR + +  L FI N FR  KL  +K  FI ++GGLRGAI F+L   + ++++ R ++ TA   ++FF+VFV G TI+PLV L  V  +     +I   ++ +  D    G++ + G     + W+ +  +FN  + K+W ++ ++ +       ++  +R   + +A
Sbjct:   96 VVPESCLLIVVGLLVGGLIKVIGEE-PPVLDSQLFFLCLLPPIILDAGYFLPIRPFTENVGTILVFAVIGTLWNAFFMGGLLY--ALCQIESVGLSGVDLLACLLFGSIVSAVDPVAVLAVFEEIHINELVHILVFGESLLNDAVTVVLYNLFEEFSKVGTVTVLDVFLGVVCFFVVSLG-GVLVGAIYGFLAAFTSRFTSHTRVIEPLFVFLYSYMAYLSSEMFHLSGIMALIACGVVMRPYVEANISHKSYTTIKYFLKMWSSVSETLIFIFLGVSTVAGPHAWNWT---FVITTVILCLVSRVLGVIGLTFIINKFRIVKLT-KKDQFIVAYGGLRGAIAFSLGYLLSNSHQMRNLFLTAIITVIFFTVFVQGMTIRPLVELLAVKKKKESKPSINEEIHTEFLDHLLTGVEGVCGHYG-HYHWKEKLNRFNKTYVKRWLIAGENFK----EPELIAFYRKMELKQA 552          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|P48763|SL9A2_RAT (Sodium/hydrogen exchanger 2 OS=Rattus norvegicus OX=10116 GN=Slc9a2 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.496e-60
Identity = 159/507 (31.36%), Postives = 270/507 (53.25%), Query Frame = 1
Query:  385 IFPESAFLITAGIIPAVAMLLLGVTLDGTLSAK--IFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDN-YEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDL--FQSDNDVRFRMYKK 1881
            I PES  LI  G++  +  ++ GV      + K  +FF  +L PIV+ AG+      F+ N+GTI W+A+ GT+ N+ I + L  +G   +   +   D+ L+   L+  LI AVDPVAVL+VFE +H+++ +Y +VFGESLLND V VV Y+   +F  MKTI  +  F  +     FF+   G  VL+   +  I +F ++  ++ + ++ + +   +YL+Y+  +    SGI+++  C +   +YV  N+S  S   +   +  L+ +SE ++FI MG+   S  G +   +  F  + +  C + R + ++ L  + N+FR   L + K  FI ++GGLRGAI FAL   +    +  + ++ TA  +++FF+VF+LG TI+PLV    V   +   + +   ++ +  D  K GI+ + G     F W  +++KF++K+ +K       I  +   SS+V L++   I  A ++A     GMI  +  F S ND R    +K
Sbjct:  108 IVPESCLLIMVGLL--LGGIIFGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENLGTIFWYAVVGTLWNS-IGIGLSLFGI-CQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIQTVDVFAGIA---NFFVVGIG-GVLIGILLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGV---STVGKNHEWNWAFVCFTLAFCLIWRALGVFVLTQVINWFRTIPLTF-KDQFIIAYGGLRGAICFALVFLLPATVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIHCRFFDHVKTGIEDVCGHWGHNF-WRDKFKKFDDKYLRKLL-----IRENQPKSSIVSLYKKLEIKHAIEMA---ETGMISTVPSFASLNDCREEKIRK 593          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|P50482|SL9A2_RABIT (Sodium/hydrogen exchanger 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC9A2 PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 4.141e-60
Identity = 159/507 (31.36%), Postives = 268/507 (52.86%), Query Frame = 1
Query:  385 IFPESAFLITAGIIPAVAMLLLGVTLDGTLSAK--IFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDL--FQSDNDVRFRMYKK 1881
            I PES  LI  G++  +  ++ GV      + K  +FF  +L PIV+ AG+      F+ N+GTI W+A+ GT+ N+  +   LF     +   +   D+ L+   L+  LI AVDPVAVL+VFE +H+++ +Y +VFGESLLND V VV Y+   +F  MKTI  +  F  +     FF+   G  VL+   +  I +F ++  ++ + ++ + +   +YL+Y+  +    SGI+++  C +   +YV  N+S  S   +   +  L+ +SE ++FI MG+   S  G +   +  F  + +  C + R + ++ L  + N+FR   L + K  FI ++GGLRGAI FAL  L     +  + ++ TA  +++FF+VF+LG TI+PLV    V   +   + +   ++ +  D  K GI+ + G     F W  +++KF++K+ +K       I  +   SS+V L++   I  A ++A     GMI  +  F S ND R    +K
Sbjct:  107 IVPESCLLIMVGLL--LGGIIFGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENLGTIFWYAVVGTLWNSIGIGVSLF--GICQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIA---NFFVVGIG-GVLIGIFLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGV---STVGKNHEWNWAFVCFTLAFCLIWRALGVFVLTRVINWFRTIPLTF-KDQFIIAYGGLRGAICFALVFLLPAAVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIHCRFFDHVKTGIEDVCGHWGHNF-WRDKFKKFDDKYLRKLL-----IRENQPKSSIVSLYKKLEIKHAIEMA---ETGMISTVPSFASLNDCREEKIRK 592          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|Q9UBY0|SL9A2_HUMAN (Sodium/hydrogen exchanger 2 OS=Homo sapiens OX=9606 GN=SLC9A2 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.107e-59
Identity = 160/508 (31.50%), Postives = 267/508 (52.56%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAK--IFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDL--FQSDNDVRFRMYKK 1881
             I PES  LI  G++  +  ++ GV      + K  +FF  +L PIV+ AG+      F+ NIGTI W+A+ GT+ N+  +   LF     +   +   D+ L+   L+  LI AVDPVAVL+VFE +H+++ +Y +VFGESLLND V VV Y+   +F  MKTI  +  F  +     FF+   G  VL+   +  I +F ++  ++ + ++ + +   +YL+Y+  +    SGI+++  C +   +YV  N+S  S   +   +  L+ +SE ++FI MG+   S  G +   +  F  + +  C + R + ++ L  + N FR   L + K  FI ++GGLRGAI FAL  L     +  + ++ TA  +++FF+VF+LG TI+PLV    V   +   + +   +  ++ D  K GI+ + G     F W  +++KF++K+ +K       I  +   SS+V L++   I  A ++A     GMI  +  F S ND R    +K
Sbjct:  106 TIVPESCLLIMVGLL--LGGIIFGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENIGTIFWYAVVGTLWNSIGIGVSLF--GICQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIA---NFFVVGIG-GVLIGIFLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGV---STVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRFRTIPLTF-KDQFIIAYGGLRGAICFALVFLLPAAVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNF-WRDKFKKFDDKYLRKLL-----IRENQPKSSIVSLYKKLEIKHAIEMA---ETGMISTVPTFASLNDCREEKIRK 592          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|M5A7P9|SL9A3_TRISC (Sodium/hydrogen exchanger 3 OS=Triakis scyllium OX=30494 GN=slc9a3 PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 6.440e-53
Identity = 151/457 (33.04%), Postives = 242/457 (52.95%), Query Frame = 1
Query:  469 TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDM-----KTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTL--GFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNY-EFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDR-------TKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEA 1794
            TL+  +FF  +L PIV+ AG+      F+ N+GTIL +A+ GT+ NAA    L  YG          L   L++  L+  LI AVDPVAVL+VFE +H++++++ +VFGESLLND V VV Y+ FN         +  L +F+ +   FV  L    + ++     A I+S +++   H + ++   +  ++YL+Y+  D +  S IL++ FC +  ++YV ANL   S   V   +  LA  +E I+F+ +G++A + T  + NT     F L+ L ++S Y VI  +   +I N +R  +L+    + + S+GGLRGA+ FAL + +  NY   R ++ + T I+V+F+V   G TIKPLV   KV    H        LNEK+  R         E I   IG + LR +W      F+ K+  K  M K +    +S   ++ + R+ ++ +A
Sbjct:  124 TLTPTVFFFYLLPPIVLDAGYFMPNRHFFGNLGTILTYAVIGTVWNAAT-TGLSLYGV-FLLGLMGDLKAGLLEFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFNSFVEVGAGNVQGLDYFKGIVSFFVVSLGGTAVGIIF----AFILSLVTRFTKHVRVIEPGFVFVISYLSYLTADMLSLSAILAITFCGICCQKYVKANLCEQSITTVRYAMKMLASGAETIIFMFLGISAVNPTIWTWNT----AFILLTLVFISVYRVIGVVIQTWILNHYRVVQLEIIDQV-VMSYGGLRGAVAFALVVLLDSNYVGERRLFVSTTIIVVYFTVIFQGLTIKPLVKWLKVKRSQHKEPL----LNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWT----NFDRKYLSKIMMRKSA---QISRDKILSVFRELNLKDA 558          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A0H3YF75 (Sodium/hydrogen exchanger OS=Schmidtea mediterranea OX=79327 GN=slc9a-9 PE=2 SV=1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 333/573 (58.12%), Postives = 445/573 (77.66%), Query Frame = 1
Query:   88 VDANQLLRNKRSAATSTGNSSGNGLYNPFEFVHIDDHKVYILGAAFVILFVFIKLASEKEFNYCCLACYKNCKFTTSFSVAKRSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIA 1806
            V+ NQ   N+    +   +     LYNPF   H +  K+Y  G  FVILFVF+K ASEK FNYC L C+  C   T      + + +  C  H+  PG+I PESAFL+++G + A+ +L LG+  +G+L   + FN++L PIVMGA W+TDK+TFYRN+GTIL FAI GTILNAAIL PL +YGSKSRW  +  +D D+VD+GL++ +ICAVDPVAVLSVFE+MHIDKLVYNVVFGESLLNDGVAVVFY AF +MKTI+ + F +S+ +V ++F+YAF ISV+LA  MAI+IS++SK+FY+ Q ++FV + SLNYLTY+I D IKGSGI+SL+FCV++Q+QYV ANLS TSN I+++V++QL+LLSEG+++I+MGLT+FS TG+  N+D+ F+ +LI  CY+SR+IV+Y LGFI N FR EKL+Y+K LFIQ+HGGLRGAIGF+L LT+ + ++ RY YQ+AT IMVFFSV+VLGA+IKPLV + K+ +E+H  + +F+SL EK+SDR KEGIK +IGSSSLRF+WE  YR FNN++FKKWFM+ K++ER   +S V+K++R QSI EAQ+I+
Sbjct:   21 VEKNQTSTNQYRNISQEIHFQSRNLYNPFASFHFESLKIYFAGTIFVILFVFVKYASEKTFNYCELVCFTGCDNKT----VPKIIPQKKCTKHQIKPGSILPESAFLVSSGAVIAIILLKLGINWEGSLDPNLIFNLLLVPIVMGAAWSTDKITFYRNLGTILLFAIVGTILNAAILAPLFYYGSKSRWGIFDTIDFDVVDSGLFATIICAVDPVAVLSVFESMHIDKLVYNVVFGESLLNDGVAVVFYRAFYEMKTISEINFIQSLSIVVLYFMYAFVISVILAFVMAIVISYVSKIFYNQQALEFVAVFSLNYLTYIIADFIKGSGIISLFFCVLIQRQYVQANLSVTSNTIISQVISQLSLLSEGVIYIMMGLTSFSPTGLLKNSDIRFSIFLIVSCYISRFIVVYFLGFIVNMFRNEKLEYKKALFIQAHGGLRGAIGFSLVLTLNEFFDNRYYYQSATAIMVFFSVYVLGASIKPLVKVLKISIETHGEQLVFLSLQEKISDRVKEGIKTVIGSSSLRFKWENWYRNFNNEYFKKWFMNNKTLERKAYNSGVLKVYRCQSILEAQEIS 589          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A401RFB5 (Sodium/hydrogen exchanger OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0017366 PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.774e-63
Identity = 167/491 (34.01%), Postives = 266/491 (54.18%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVV----KLHRDQSI--TEAQQIAGHYGAGMIKD 1836
            +I PES  LI  G+I    +  +       +S   FF  +L PIV+ AG+      F+ NIGTILW+A+ GT+ N    + L  YG     +F  K D+ L+   L+  LI AVDPVAVLSVFE +H+++ ++ +VFGESLLND V VV Y  F    T++++   + +  +F FFL  FG  +L+  T  II +  ++   + + ++ + +   +YL+Y+  +  + SGI+++  C +  K+YV AN+S  S+  +   +   + +SE ++FI +G+   S  G       P+  + +  C V R + +  L FI N FR   +  RK  FI ++GGLRGAI F+L   + D +  + ++ TAT +++FF+VFV G TIKPLV L +V   S    T+   ++ +  D    GI+ I G    ++ W+ R+  FNNK+  K F+     E+ +S SS+V    KL +  +I   EA Q+ G      + D
Sbjct:  108 SIVPESCLLIIVGLIMGGIIYGVNERSAPVMSTDAFFLYLLPPIVLDAGYFMPSRPFFENIGTILWYAVVGTMWNV-FGIGLSLYGICQIESFGLK-DISLLYNLLFGSLIAAVDPVAVLSVFEEIHVNEQLHILVFGESLLNDAVTVVLYKLFKTFCTMSSVGVSDILVGIFKFFLVGFG-GLLVGITYGIIAALTTRFTENIRVIEPLFVFLYSYLSYLTAEMFQFSGIVAVIACSMSMKRYVEANISQKSHTTIKYFMKMWSSVSETLIFIFLGV---STIGDKHEWSWPYVCFTMIFCLVWRAVGVIFLTFIVNKFRVNVVT-RKDQFIIAYGGLRGAICFSLVFLLPD-FPQKKLFTTATIVVIFFTVFVQGMTIKPLVELLEVKRTSQAPPTVSEQIHIRFLDHLLAGIEDICGHWG-QYYWKDRFENFNNKYLNKIFIR----EQHLSKSSIVVLYQKLEKKHAIELAEAGQLIGAPSLASLHD 585          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A3B3HU29 (Sodium/hydrogen exchanger OS=Oryzias latipes OX=8090 GN=LOC101169232 PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 8.513e-63
Identity = 165/480 (34.38%), Postives = 254/480 (52.92%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIG-DNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVV---KLHRDQSITEAQQIAG 1809
            +I PES  LI  G++      L+G +    L +  FF ++L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  +LF   +      T L   L+   L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +      +   +    V  F + AFG  VL+     I+ +F S+   H + ++ + +   +Y+ Y+  +    SGI++L  C  + + YV AN+S+ S+  +   L   + +SE ++FIL+G+    G     N +  F    +FLC V+R I +  L FI N FR  KL   K  FI ++GGLRGAI F+L   +  ++ E R+I+ TA   ++FF+VFV G TIKPLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KKW ++    ERS     +    KL   Q+I   +  AG
Sbjct:  104 SIVPESCLLIVVGLLVGGLSKLIGESELPKLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLTHLG--LLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFG-GVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGG---PHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRIVKLT-TKDQFIVAYGGLRGAIAFSLGFLLEVEDEEMRHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYG-HHHWKDKMNRFNRKYVKKWLIAG---ERSKEPQLIAFYHKLEFKQAIQLVESGAG 572          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A3B3I3P2 (Sodium/hydrogen exchanger OS=Oryzias latipes OX=8090 GN=LOC101169232 PE=3 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 1.089e-62
Identity = 165/480 (34.38%), Postives = 254/480 (52.92%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIG-DNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVV---KLHRDQSITEAQQIAG 1809
            +I PES  LI  G++      L+G +    L +  FF ++L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  +LF   +      T L   L+   L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +      +   +    V  F + AFG  VL+     I+ +F S+   H + ++ + +   +Y+ Y+  +    SGI++L  C  + + YV AN+S+ S+  +   L   + +SE ++FIL+G+    G     N +  F    +FLC V+R I +  L FI N FR  KL   K  FI ++GGLRGAI F+L   +  ++ E R+I+ TA   ++FF+VFV G TIKPLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KKW ++    ERS     +    KL   Q+I   +  AG
Sbjct:  104 SIVPESCLLIVVGLLVGGLSKLIGESELPKLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLTHLG--LLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFG-GVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGG---PHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRIVKLT-TKDQFIVAYGGLRGAIAFSLGFLLEVEDEEMRHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYG-HHHWKDKMNRFNRKYVKKWLIAG---ERSKEPQLIAFYHKLEFKQAIQLVESGAG 572          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A4W3HGV3 (Sodium/hydrogen exchanger OS=Callorhinchus milii OX=7868 PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 7.614e-62
Identity = 162/481 (33.68%), Postives = 260/481 (54.05%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVV----KLHRDQSITEAQQIAGH 1812
             I PES  LI  G+I    +  +  +    +S  +FF  +L PIV+ AG+      F+ NIGTILW+A+ GT+ N    + L  YG     +F  + D+ L+   L+  LI AVDPVAVLSVFE +H+++ ++ +VFGESLLND V VV Y  F    T+ ++  ++    +  FFL  FG  +++     II S  ++   H + ++ + +   +YL+Y+  +    SGI+++  C +  K+YV AN+S  S+  +   +   + +SE ++FI +G+   S  G + +   P+  + +  C   R + +  L FI N FR   +  RK  FI ++GGLRGAI F+L   +  N+  + ++ TAT +++FF+VFV G TIKPLV L +V   S    TI   ++ +  D    GI+ I G    ++ W+ ++  FNNK+  K  +     E  +S SS+V    KL +  +I  A+  AGH
Sbjct:  108 KIVPESCLLIIVGLIMGGIIYGVNESQAPVMSTDVFFLYLLPPIVLDAGYFMPSRPFFENIGTILWYAVVGTMWNV-FGIGLSLYGICQIESFGLQ-DISLLYNLLFGSLIAAVDPVAVLSVFEEIHVNEQLHILVFGESLLNDAVTVVLYKLFETFCTMPSIGTWDIFAGIVKFFLVGFG-GLIVGVVYGIIASLTTRFTEHIRVIEPLFVFLYSYLSYLTAEMFHFSGIVAIIACSMSMKRYVEANISQKSHTTIKYFMKMWSSVSETLIFIFLGV---STIGDNHDWSWPYVCFTMIFCLAWRAVGVIVLTFIVNKFRVNTVT-RKDQFIIAYGGLRGAICFSLVFLL-PNFPRKKLFITATIVVIFFTVFVQGMTIKPLVELLEVKKTSRTPPTISEQIHIRFLDHLLAGIEDICGHWG-QYYWKDKFEYFNNKYLNKILIR----EHHLSKSSIVILYQKLEKKHAIELAE--AGH 573          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: ENSAMXT00000013913.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:20541358:20558833:1 gene:ENSAMXG00000013508.2 transcript:ENSAMXT00000013913.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 4.176e-60
Identity = 156/471 (33.12%), Postives = 252/471 (53.50%), Query Frame = 1
Query:  385 IFPESAFLITAGIIPAVAMLLLGV--TLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDV-----PFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRD 1776
            + PES  LI  G++  V  ++ GV  T    LSA+ FF  +L PIV+ AG+      F+ N+GTILW+A+ GT+ N  + + L  YG   R   +   ++ L+   L+  LI AVDPVAVLSVFE +H+++ ++ +VFGESLLND V VV Y            + FES    F+       + +L      +++   +++     P+ FV L S  YL+Y+  + +  SGI+++  C V  KQYV AN+S  SN  +   L   + +SE ++FI +        G+ST  DV     PF    +FLC + R + +  L  + N  R+  + +R   FI ++GGLRGAI F+L   I D +  + ++ T T +++ F+VFV G TIKPLV L  V  +     T+   ++ ++ D    GI+ ++G     + W+ ++ +FN K+ K++ +     E     SS+V+L+++
Sbjct:   77 VVPESCLLIMVGLL--VGGVIYGVRHTAPPVLSAEAFFLYLLPPIVLDAGYFLPGRLFFENLGTILWYAVLGTLWNV-LGIGLSLYG-LCRLGGWGLEEVSLLHFLLFGSLIAAVDPVAVLSVFEEIHVNEQLHILVFGESLLNDAVTVVLY------------KLFES----FLRMPTVSSVDILAGGCQFVVVGLGAQVI---APL-FVFLYS--YLSYLTSEMLHFSGIMAIVTCAVTMKQYVEANVSERSNTTIKYFLKMWSSVSETLIFIFL--------GVSTIQDVHMWSWPFVSSTLFLCLLWRALGVLLLTAVVNKLRRNAVTFRDQ-FIIAYGGLRGAICFSLVFLIED-FPMKRLFITTTIVVILFTVFVQGMTIKPLVELLDVKRKKRALPTVSEEIHSRLLDHLLSGIEDVVGCWGQHY-WKDKFEQFNTKYLKRFLIR----EDKQPKSSIVRLYQE 506          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: ENSAMXT00000053304.1 (solute carrier family 9 member A1 [Source:NCBI gene;Acc:103040045])

HSP 1 Score: 214.157 bits (544), Expect = 7.505e-58
Identity = 150/465 (32.26%), Postives = 246/465 (52.90%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHR 1773
            +I PES  LI  G++      L+G T    L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ N+  +  LL+   +      T   + L+   L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +      +   +    +  F + A G  V++     ++ +F S+   H + ++ + +   +YL Y+  +    SGI++L  C  + + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G      T   F    I LC V+R + + +L ++ N FR  KL   K  FI ++GGLRGAI F+L  L   D++  R ++ TA   ++FF+VFV G TI+PLV+L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KK  ++    ERS     +   H+
Sbjct:  113 SIVPESCLLIVVGLLMGGIFKLVGET-PPILRSDLFFLYLLPPIILDAGYFLPIRPFTENLGTILIFAVVGTLWNSFFIGGLLYGVCQIEGTLST---VGLLPCLLFGAIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEYAGAGAVTVTDVFLGIVSFLVVALG-GVMVGAIYGVLSAFTSRFTAHTRVIEPLFVFVYSYLAYLSAEVFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGDHKWNWT---FVVTTIILCMVARVLGVISLTYLINKFRIVKLT-TKDQFIIAYGGLRGAIAFSLGYLLDTDHFPMRKMFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKKYVKKCLIAG---ERSKEPQLIAFYHK 564          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: ENSAMXT00000015459.2 (solute carrier family 9 member A1 [Source:NCBI gene;Acc:103040045])

HSP 1 Score: 214.157 bits (544), Expect = 7.505e-58
Identity = 150/465 (32.26%), Postives = 246/465 (52.90%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALS-LTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHR 1773
            +I PES  LI  G++      L+G T    L + +FF  +L PI++ AG+      F  N+GTIL FA+ GT+ N+  +  LL+   +      T   + L+   L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +      +   +    +  F + A G  V++     ++ +F S+   H + ++ + +   +YL Y+  +    SGI++L  C  + + YV AN+S+ S+  +   L   + +SE ++FI +G++  +G      T   F    I LC V+R + + +L ++ N FR  KL   K  FI ++GGLRGAI F+L  L   D++  R ++ TA   ++FF+VFV G TI+PLV+L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KK  ++    ERS     +   H+
Sbjct:  113 SIVPESCLLIVVGLLMGGIFKLVGET-PPILRSDLFFLYLLPPIILDAGYFLPIRPFTENLGTILIFAVVGTLWNSFFIGGLLYGVCQIEGTLST---VGLLPCLLFGAIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEYAGAGAVTVTDVFLGIVSFLVVALG-GVMVGAIYGVLSAFTSRFTAHTRVIEPLFVFVYSYLAYLSAEVFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGDHKWNWT---FVVTTIILCMVARVLGVISLTYLINKFRIVKLT-TKDQFIIAYGGLRGAIAFSLGYLLDTDHFPMRKMFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYG-HHHWKDKLNRFNKKYVKKCLIAG---ERSKEPQLIAFYHK 564          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: slc9a3.1 (sodium/hydrogen exchanger 3-like [Source:NCBI gene;Acc:103034097])

HSP 1 Score: 180.644 bits (457), Expect = 1.814e-46
Identity = 148/481 (30.77%), Postives = 245/481 (50.94%), Query Frame = 1
Query:  340 LCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGT--LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFY-----TKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNY--EFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRF--RWETR-YRKFNNKHFKKWFMSKKSIERS 1740
            LC+ V   + T   + FPES  LI  G I  +  ++ G     T  L+ + FF  +L  I++  G+      F+ N+G IL  A+ GT+ NA  +         S W  +       L++ L+   L+  L+ AVDPVAV++VFE +H++++++  VFGESLLNDGV VV Y+ F+   ++    +   E +  +  FF+ +FG S  +    AIIIS ++K     Q ++   +  L YL+Y+  + +  S ILS+ FC V  ++YV AN+   S   V   +   A  SE ++F+ +G+TA        NT   F    I    + R+I ++TL +  N +R   ++    L + S+GGLRGA+ + L+ ++ +    E   I  T T I+V+F+V + G T+KP+V   KV       +   + L EKV++R  E + A +     R    W TR +++F + +   WF+ K    ++
Sbjct:   75 LCKLVVQLN-TRLKSFFPESGLLIICGFI--LGGIVWGADKAQTFKLTPRNFFYFLLPQIILDTGYFMPNKLFFSNLGAILVHAVIGTVWNAGAV-------GVSLWGCWLGGAMGDLNIGLLQFLLFGSLLAAVDPVAVIAVFEEVHVNEVLFIWVFGESLLNDGVTVVLYNVFDAFVSLGGEKINAGEIIKGIVSFFVVSFGGSA-IGVIFAIIISLLTKYTGKVQIIEAGFIFVLGYLSYLTAEMLSLSAILSVTFCGVCCQKYVNANMDEKSVTAVRYAMKVFANGSETMIFVFLGVTAIDSVIWVWNTG--FICLTILFAIIYRFIGVFTLTWFLNQYRLVPIEVIDQL-VMSYGGLRGAVAYGLAASLDETRIPEKNLIIST-TLIVVYFTVVIQGLTMKPIVKWLKV----KRVEPTDLKLIEKVNNRACEHVLAAMEDIVGRIGDNWWTRGWKRFEDTYI-TWFLMKPEARKN 535          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: slc9a3.1 (sodium/hydrogen exchanger 3-like [Source:NCBI gene;Acc:103034097])

HSP 1 Score: 179.489 bits (454), Expect = 4.341e-46
Identity = 144/465 (30.97%), Postives = 238/465 (51.18%), Query Frame = 1
Query:  388 FPESAFLITAGIIPAVAMLLLGVTLDGT--LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFY-----TKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNY--EFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRF--RWETR-YRKFNNKHFKKWFMSKKSIERS 1740
            FPES  LI  G I  +  ++ G     T  L+ + FF  +L  I++  G+      F+ N+G IL  A+ GT+ NA  +         S W  +       L++ L+   L+  L+ AVDPVAV++VFE +H++++++  VFGESLLNDGV VV Y+ F+   ++    +   E +  +  FF+ +FG S  +    AIIIS ++K     Q ++   +  L YL+Y+  + +  S ILS+ FC V  ++YV AN+   S   V   +   A  SE ++F+ +G+TA        NT   F    I    + R+I ++TL +  N +R   ++    L + S+GGLRGA+ + L+ ++ +    E   I  T T I+V+F+V + G T+KP+V   KV       +   + L EKV++R  E + A +     R    W TR +++F + +   WF+ K    ++
Sbjct:   84 FPESGLLIICGFI--LGGIVWGADKAQTFKLTPRNFFYFLLPQIILDTGYFMPNKLFFSNLGAILVHAVIGTVWNAGAV-------GVSLWGCWLGGAMGDLNIGLLQFLLFGSLLAAVDPVAVIAVFEEVHVNEVLFIWVFGESLLNDGVTVVLYNVFDAFVSLGGEKINAGEIIKGIVSFFVVSFGGSA-IGVIFAIIISLLTKYTGKVQIIEAGFIFVLGYLSYLTAEMLSLSAILSVTFCGVCCQKYVNANMDEKSVTAVRYAMKVFANGSETMIFVFLGVTAIDSVIWVWNTG--FICLTILFAIIYRFIGVFTLTWFLNQYRLVPIEVIDQL-VMSYGGLRGAVAYGLAASLDETRIPEKNLIIST-TLIVVYFTVVIQGLTMKPIVKWLKV----KRVEPTDLKLIEKVNNRACEHVLAAMEDIVGRIGDNWWTRGWKRFEDTYI-TWFLMKPEARKN 529          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Sea Lamprey
Match: slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060503-545])

HSP 1 Score: 166.392 bits (420), Expect = 2.353e-43
Identity = 138/473 (29.18%), Postives = 236/473 (49.89%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEA-MHIDKLVYNVVFGESLLNDGVAVVFYSAFN--------DMKTITNLRFFE-----SVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVI--YTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNY-EFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSH 1749
            ++ PES  LI  GI+    +L      + TL+   FF  +L PIV+ A +       + N+GTIL +A+ GT+ NAA    L  YG+         + ++LVD G+++ + C+++ V++L+++E  + I  L     F  +++ND    V Y  F+        +++T+  ++ F      S+G   V  ++AF +S++  CT  +          H     FV L +  YL Y+  + +  S IL++ FC +  K+YV AN+S  S   +   +  LA  +E I+F+ +G++A      + NT     F L+ L +VS Y VI    L ++ N FR   L   +   + S+GGLRGA+ FAL   + + +   + ++ +AT I+VFF+V V G TIKPLV   KV        T+   L+E+  D     I+ + G     + W  ++ +F+ +H  +  M ++S  R+ S 
Sbjct:   45 SVVPESCLLIVLGIVLGGVVLGSSRYAEFTLTPTAFFFYLLPPIVLDASYTMPNRLLFDNLGTILVYAVVGTLWNAAA-TGLSLYGAHLAGALVI-MSVNLVDYGIFNDIFCSIENVSILALYETEIQIMPLSLIHTFNRTIINDLSNKVLYKVFDTFVEVGAENIQTVDYMKGFASFLVVSLGGTAVGVVFAFMLSLVTRCTKHV----------HAIEPGFVFLFA--YLAYLSAEMLSLSAILAITFCGICCKKYVDANISVQSQTTIKFTMKMLASGAETIIFMFLGISAVDTHKWTWNT----AFILLTLIFVSVYRVIGVVALTWLLNRFRMVPLGPIEQA-VMSYGGLRGAVAFALVALLDEGHVPEKRLFVSATIIVVFFTVIVQGLTIKPLVKWLKVKRSEEREPTLTEELHERAFDHILAAIEDVAGEYGHHY-WRDKFEQFDKRHLSRLLM-RQSARRNKSE 496          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000903.1 (pep scaffold:Pmarinus_7.0:GL477267:34875:46041:-1 gene:ENSPMAG00000000825.1 transcript:ENSPMAT00000000903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 6.189e-24
Identity = 71/215 (33.02%), Postives = 116/215 (53.95%), Query Frame = 1
Query:  475 SAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNA----------AILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILS 1080
             A++FF  +L PIV+ AG+      F  N+GTILW+A+ GT+ N             L+P L   S           + LV   L++ LI AVDPVAVL+VFE +H+++ ++ +VFGESLLND V VV Y+   AF+ MK +T++           F +   G  VL+   + ++ +  ++   H + ++ + +   +YL Y+I +  + SGI++
Sbjct:    2 PAQVFFLYLLPPIVLDAGYFMPVRPFLDNLGTILWYAVLGTLWNVFGVGLTLHAVCALVPSLGLAS-----------LGLVHLLLFASLISAVDPVAVLAVFEEIHVNEQLHILVFGESLLNDAVTVVLYNLFRAFSTMKVVTSVDVLLGAT---KFLVVGLG-GVLIGALLGMVAALTTRFSDHTRVIEPLFVFLYSYLAYLIAEMFQLSGIMA 201          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001296.1 (pep scaffold:Pmarinus_7.0:GL497132:72:2488:-1 gene:ENSPMAG00000001170.1 transcript:ENSPMAT00000001296.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 2.904e-9
Identity = 28/76 (36.84%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNA 609
            ++ PES  LI  G++  + +L+        +S  +FF  +L PIV+ AG+      F+ N+GTILW+A+ GT+ NA
Sbjct:   37 SLVPESCLLIVVGLLVGMIILVAREQSPPVMSTDVFFFYLLPPIVLDAGYFMPIRPFFENVGTILWYALVGTLWNA 112          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Yeast
Match: NHX1 (Na+/H+ and K+/H+ exchanger; required for intracellular sequestration of Na+ and K+; located in the vacuole and late endosome compartments; required for osmotolerance to acute hypertonic shock and for vacuolar fusion; ortholog of human NHE9, which is linked to autism [Source:SGD;Acc:S000002864])

HSP 1 Score: 137.887 bits (346), Expect = 3.858e-34
Identity = 101/355 (28.45%), Postives = 177/355 (49.86%), Query Frame = 1
Query:  469 TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFY--TKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDM--KTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFY--HHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVS----RYIVIYTLGFIANF-FRKEKLDYRKGLFIQS----------------HGGLRGAIGFALSLTIGDNYEF 1452
            T ++  FFN++L PI++ +G+  +++ F+ N+ +IL FAI GT ++A ++  +L+      W F     +D+   DA      + A DPV +LS+F A  +D  +Y ++FGESLLND +++V +        +  T    FE  GL    FL  F +S+L+   + I+++ + K  +   +  ++  ++L + Y +Y   +    SGI+SL FC +  K Y   N+S  S   +  +   LA LSE  +FI +GL  F      T  ++ +   LI +  +S    R+  ++ L    N+ +R + +    G+  ++                  GLRGA+G AL+L I   Y+F
Sbjct:  119 TFNSSYFFNVLLPPIILNSGYELNQVNFFNNMLSILIFAIPGTFISAVVIGIILYI-----WTFLGLESIDISFADAMSVGATLSATDPVTILSIFNAYKVDPKLYTIIFGESLLNDAISIVMFETCQKFHGQPATFSSVFEGAGL----FLMTFSVSLLIGVLIGILVALLLKHTHIRRYPQIESCLILLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYYNMSRRSQITIKYIFQLLARLSENFIFIYLGLELF------TEVELVYKPLLIIVAAISICVARWCAVFPLSQFVNWIYRVKTIRSMSGITGENISVPDEIPYNYQMMTFWAGLRGAVGVALALGIQGEYKF 458          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO34103 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7SQC1])

HSP 1 Score: 189.889 bits (481), Expect = 4.312e-52
Identity = 138/437 (31.58%), Postives = 240/437 (54.92%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGT--LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLF-YGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAF---NDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGL--FIQSHGGLRGAIGFALSLTIG-DNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRW 1665
            ++FPES+ +I  G+I    + L G+T +     S+ IFF  +L PIV+ AG+      F+ NIGTIL FA+ GT+ NA  +  LLF +   + +     + + L+   ++ +LI AVDPVAVL+VFE ++++ ++Y +VFGESLLND V VV Y  F   ++M  +T+    + + L F  FL       L+        +F++K   H + ++ + +  ++Y+ Y+  +    SGILS+  C ++ K YV  N+S  S+  +   +  L+  SE ++F+ +G+   +   + +   V  T  L+F+  V R I +  L ++AN  R  +L+   G+  FI  +GG+RGA+ F+L++ +   ++  + +  T T ++V F++FV G TIKP+V    V L+ H   +++  LN+K  +    GI+ + G     + W
Sbjct:   51 SVFPESSLVIILGVIFGGIIRLSGLTTEDVPFFSSDIFFLFMLPPIVLEAGYFLQDRAFFDNIGTILLFAVVGTLFNAFTVGGLLFHFPGFTLYGVSHIIGIPLMHYLVFGVLISAVDPVAVLAVFEEVNVNVMLYIIVFGESLLNDAVTVVLYHLFEKLSEMDEVTH----KEILLGFANFLVVSLGGTLMGVLWGFFTAFVTKYTDHVRVIEPIFVFIMSYMAYLCAEMFHLSGILSIVTCAIVMKPYVEMNISRKSHTTIKYFMKMLSSCSETLIFLFLGIALVTYDHVWSTELVFLT--LLFIS-VYRAIGVVFLTYLAN--RFGRLNKLSGVDQFIMCYGGIRGAVSFSLAILLNPKHFPDKGMLVTTTIVVVIFTIFVQGTTIKPIVKALNVKLQEHKKPSMYKELNDKFLEHLVAGIEEVSGFRGHGYYW 478          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO43052 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7RZU4])

HSP 1 Score: 149.828 bits (377), Expect = 4.883e-38
Identity = 108/330 (32.73%), Postives = 175/330 (53.03%), Query Frame = 1
Query:  466 GTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTIT--NLRFFE--SVGLVFVFFLYAFGISVLLACTMAIIISFISKL--FYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTD-VPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKL--DYRKGLFIQSHGGLRGAIGFALSL 1428
             T + +IFF ++L PI+  AG++  K  F+RN+G IL +A FGT ++      L+ YG    W   TK D D  +  L+  LI A DPV VL++F  +H+D  +Y +VFGES+LND VA+V Y A           +R F+  S       F+  F  S ++ C+M+ I + ++KL        ++  +L  ++Y T+++ +    SGI+++ FC + Q+ Y   NL+  S     + L  L  ++E  +F  +GL+ F+ T    N   + ++F  IF   V R++ IY L F  N  R   +  +++  +F     GLRGAI FAL++
Sbjct:  124 ATFNPEIFFYVLLPPIIFYAGYSMQKRYFFRNLGAILTYAFFGTTISCFATGSLI-YGFNV-WTGVTK-DFDYPECLLFGALISATDPVTVLAIFHDIHVDVDMYALVFGESVLNDAVAIVLYRAIESYLAYNPREMREFDLMSCAQALSDFVAIFTGSFVIGCSMSCINALVTKLTKLGSFPILETALLFLMSYCTFLMAEIANWSGIVAVLFCGITQQHYTYKNLTDESRARTLQTLELLNFMAENFIFTYIGLSVFAFTSHQWNPGFIGWSFLAIF---VGRFLNIYPLTFFLNLGRTRTIPANFQHMMFFS---GLRGAIAFALAV 444          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO40671 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7S6K9])

HSP 1 Score: 136.732 bits (343), Expect = 1.116e-33
Identity = 108/384 (28.12%), Postives = 186/384 (48.44%), Query Frame = 1
Query:  478 AKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKL-----DMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAF------NDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKL--FYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVP-FTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKV-----PLESHMAK 1572
             +IFF ++L PI+  AG+   K  F+RNIG IL +A  GT ++  +   +++         YTK      D D ++  L+  LI A DPV +L++F  +H+D  +Y +VFGES++ND VA+V + +       N        +FF SVG+    F+  F  S  L   M ++ + I+KL        ++  +   L++ T+++ +    +GI+++ FC + Q  Y   NLS  S     ++   L  L+E  +F  MGL+ F+      +   P F  +      + R++ IY L F+ N  R  K+ Y     +    GLRGA+ FAL++   ++   R +  T   ++V  +V + G +   +++  K+     P E    K
Sbjct:  120 PEIFFFVLLPPIIFFAGYDMKKRFFFRNIGAILAYAFAGTTISCMVFGVIVYA--------YTKFATVYKDFDFLECLLFGALISATDPVTILAIFHDLHVDVDLYALVFGESVMNDAVAIVLFRSIESYLLDNASGVFQVDKFFSSVGV----FIGVFSGSFFLGFLMGLVTALITKLTKISDFPLLETALFFLLSWSTFLMAEAAGLTGIVAVLFCGISQAHYTYNNLSDESKHNTKQIFALLNFLAENFIFSYMGLSVFT---FEYHQWKPGFIAWCFIGIAIGRFLNIYPLSFLLNLGRNRKIPYNLQ-HMMFFSGLRGAVAFALAMRNTESVP-RQMMLTTVLMIVLITVVINGGSTLSVLSYLKIRVGVNPEEEEQPK 486          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO49297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH57])

HSP 1 Score: 52.373 bits (124), Expect = 8.202e-7
Identity = 67/246 (27.24%), Postives = 115/246 (46.75%), Query Frame = 1
Query:  751 EAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMK----TITNLR-FFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKG-SGILS---LYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCY----VSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYE 1449
            E +   K +  ++ GESLLNDG+A+V Y  F ++     T T +  +F  V +   FF  A G          I + ++ ++F +   ++  + L   YLT+ IG+ + G SG+++   L   V  QK  +   +    +R        LA L+  ++FI+ G+     T  S     PF  +L+ + Y    V R +VI +L  I          ++  + +   GGLRGA+G AL+L +  ++E
Sbjct:    3 EFLGTSKQLATIIEGESLLNDGMAIVMYKIFYNLSFSSLTPTEIGLYFPRVAVGGYFFGLAAG---------KITVFWLQRVF-NDAMVEITITLVSTYLTFYIGEEVLGISGVIAVVILGIEVNAQKTSISPEVEVFLHRF----WEMLAYLANTLIFIMAGVVIVEQTLHSFE---PFDAFLLVVDYLGITVIRALVISSLSPILMHI-GYGFTWQTAVVV-CWGGLRGAVGLALALQVYIDHE 229          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: ENSORLT00000046726.1 (sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:101169232])

HSP 1 Score: 238.424 bits (607), Expect = 3.205e-66
Identity = 165/480 (34.38%), Postives = 254/480 (52.92%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIG-DNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVV---KLHRDQSITEAQQIAG 1809
            +I PES  LI  G++      L+G +    L +  FF ++L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  +LF   +      T L   L+   L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +      +   +    V  F + AFG  VL+     I+ +F S+   H + ++ + +   +Y+ Y+  +    SGI++L  C  + + YV AN+S+ S+  +   L   + +SE ++FIL+G+    G     N +  F    +FLC V+R I +  L FI N FR  KL   K  FI ++GGLRGAI F+L   +  ++ E R+I+ TA   ++FF+VFV G TIKPLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KKW ++    ERS     +    KL   Q+I   +  AG
Sbjct:  104 SIVPESCLLIVVGLLVGGLSKLIGESELPKLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLTHLG--LLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFG-GVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGG---PHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRIVKLT-TKDQFIVAYGGLRGAIAFSLGFLLEVEDEEMRHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYG-HHHWKDKMNRFNRKYVKKWLIAG---ERSKEPQLIAFYHKLEFKQAIQLVESGAG 572          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: ENSORLT00000036886.1 (sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:101169232])

HSP 1 Score: 238.424 bits (607), Expect = 3.205e-66
Identity = 165/480 (34.38%), Postives = 254/480 (52.92%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIG-DNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVV---KLHRDQSITEAQQIAG 1809
            +I PES  LI  G++      L+G +    L +  FF ++L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  +LF   +      T L   L+   L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +      +   +    V  F + AFG  VL+     I+ +F S+   H + ++ + +   +Y+ Y+  +    SGI++L  C  + + YV AN+S+ S+  +   L   + +SE ++FIL+G+    G     N +  F    +FLC V+R I +  L FI N FR  KL   K  FI ++GGLRGAI F+L   +  ++ E R+I+ TA   ++FF+VFV G TIKPLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KKW ++    ERS     +    KL   Q+I   +  AG
Sbjct:  104 SIVPESCLLIVVGLLVGGLSKLIGESELPKLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLTHLG--LLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFG-GVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGG---PHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRIVKLT-TKDQFIVAYGGLRGAIAFSLGFLLEVEDEEMRHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYG-HHHWKDKMNRFNRKYVKKWLIAG---ERSKEPQLIAFYHKLEFKQAIQLVESGAG 572          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: ENSORLT00000042935.1 (sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:101169232])

HSP 1 Score: 238.039 bits (606), Expect = 4.099e-66
Identity = 165/480 (34.38%), Postives = 254/480 (52.92%), Query Frame = 1
Query:  382 NIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIG-DNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVV---KLHRDQSITEAQQIAG 1809
            +I PES  LI  G++      L+G +    L +  FF ++L PI++ AG+      F  N+GTIL FA+ GT+ NA  +  +LF   +      T L   L+   L+  +I AVDPVAVL+VFE +HI++L++ +VFGESLLND V VV Y  F +      +   +    V  F + AFG  VL+     I+ +F S+   H + ++ + +   +Y+ Y+  +    SGI++L  C  + + YV AN+S+ S+  +   L   + +SE ++FIL+G+    G     N +  F    +FLC V+R I +  L FI N FR  KL   K  FI ++GGLRGAI F+L   +  ++ E R+I+ TA   ++FF+VFV G TIKPLV L  V  +    ++I   ++ +  D    GI+ I G       W+ +  +FN K+ KKW ++    ERS     +    KL   Q+I   +  AG
Sbjct:  104 SIVPESCLLIVVGLLVGGLSKLIGESELPKLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLTHLG--LLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFG-GVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGG---PHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRIVKLT-TKDQFIVAYGGLRGAIAFSLGFLLEVEDEEMRHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYG-HHHWKDKMNRFNRKYVKKWLIAG---ERSKEPQLIAFYHKLEFKQAIQLVESGAG 572          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: slc9a2 (sodium/hydrogen exchanger 2 [Source:NCBI gene;Acc:101173750])

HSP 1 Score: 214.927 bits (546), Expect = 4.812e-58
Identity = 147/476 (30.88%), Postives = 250/476 (52.52%), Query Frame = 1
Query:  391 PESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFN---DMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYL--IFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQI 1803
            PES  L++ G+I    M  +       L++ +FF  +L PIV+ +G+      F+ N+GT+LWFA+ GT+ N+  +   LF  +  +   +   D++L +  L++ +I AVDPVAVLSVFE + +++ +Y VVFGE L ND V VV YS F+   +M  +  +  F  V    V  L   G  VL     A    F SK+    +P+ F+ + S  YL Y++ +    S I+++  C +  K YV  N+S  S   +  V+  L  +SE ++F  +G+       I+T  +  + + L  +   ++ R + I  L  I N FR    +  K  F  ++GGLRGAI FAL+ T+ DN   ++++ TAT +++ F+VF+ G +I+PL+    V   +    TI + ++ ++ + T  GI+ + G  S  + W+ ++ KFNN+  ++  +     E     SS+V L++   +  A +I
Sbjct:  101 PESCLLVSIGLIVGGIMYSVHEKPPAVLTSNVFFLYMLPPIVLDSGYFMPTRPFFENVGTVLWFAVVGTLWNSIGIGMSLF--AICQIEAFGVQDINLQENLLFATIISAVDPVAVLSVFEDVSVNEQLYIVVFGECLFNDAVTVVLYSMFSFVTEMPVVEPVDVFLGVARFLVVGLGGMGFGVLFGFVAAFTTRFTSKV-REIEPL-FIFMYS--YLAYLVAELFAISSIMAIVCCALTMKYYVEENVSQRSCTTIRHVVKMLGAISETLIFFFLGVVT-----ITTEHEWNWGYILFTLLFAFIWRGLGILVLTQIINPFRTIPFN-TKDQFGMAYGGLRGAISFALAFTLPDNIGRKHLFVTATIVIILFTVFLQGISIRPLIEFINVRRTNRKTDTINIEIHTRLMEHTMAGIEDLCGQWS-HYYWKDKFMKFNNRILRRILLRDNRAE-----SSIVALYKKLELQNAIEI 558          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: slc9a2 (sodium/hydrogen exchanger 2 [Source:NCBI gene;Acc:101173750])

HSP 1 Score: 206.838 bits (525), Expect = 6.029e-56
Identity = 140/451 (31.04%), Postives = 239/451 (52.99%), Query Frame = 1
Query:  466 GTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFN---DMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYL--IFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQI 1803
              L++ +FF  +L PIV+ +G+      F+ N+GT+LWFA+ GT+ N+  +   LF  +  +   +   D++L +  L++ +I AVDPVAVLSVFE + +++ +Y VVFGE L ND V VV YS F+   +M  +  +  F  V    V  L   G  VL     A    F SK+    +P+ F+ + S  YL Y++ +    S I+++  C +  K YV  N+S  S   +  V+  L  +SE ++F  +G+       I+T  +  + + L  +   ++ R + I  L  I N FR    +  K  F  ++GGLRGAI FAL+ T+ DN   ++++ TAT +++ F+VF+ G +I+PL+    V   +    TI + ++ ++ + T  GI+ + G  S  + W+ ++ KFNN+  ++  +     E     SS+V L++   +  A +I
Sbjct:   10 AVLTSNVFFLYMLPPIVLDSGYFMPTRPFFENVGTVLWFAVVGTLWNSIGIGMSLF--AICQIEAFGVQDINLQENLLFATIISAVDPVAVLSVFEDVSVNEQLYIVVFGECLFNDAVTVVLYSMFSFVTEMPVVEPVDVFLGVARFLVVGLGGMGFGVLFGFVAAFTTRFTSKV-REIEPL-FIFMYS--YLAYLVAELFAISSIMAIVCCALTMKYYVEENVSQRSCTTIRHVVKMLGAISETLIFFFLGVVT-----ITTEHEWNWGYILFTLLFAFIWRGLGILVLTQIINPFRTIPFNT-KDQFGMAYGGLRGAISFALAFTLPDNIGRKHLFVTATIVIILFTVFLQGISIRPLIEFINVRRTNRKTDTINIEIHTRLMEHTMAGIEDLCGQWS-HYYWKDKFMKFNNRILRRILLRDNRAE-----SSIVALYKKLELQNAIEI 442          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000062012.1 (SMESG000062012.1)

HSP 1 Score: 1764.2 bits (4568), Expect = 0.000e+0
Identity = 891/892 (99.89%), Postives = 891/892 (99.89%), Query Frame = 1
Query:   34 MSLKYLAIFIFLFITIKIVDANQLLRNKRSAATSTGNSSGNGLYNPFEFVHIDDHKVYILGAAFVILFVFIKLASEKEFNYCCLACYKNCKFTTSFSVAKRSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDLFQSDNDVRFRMYKKAWXXXXXXXXXXXXXGKVPDHLYNSMSIPDLAILDKTITRRDVDDQMTHHNMQEGMGXXXXXXXXXXXXXXXXXXXHYSEIDSHRSLCYKVPRRVIDLRFNKKNKDPEDILATMQRKFNTAPKMNKSVTFNHTEPPEGKSIFTFGQQNNSISDLIDDNHITFSVTDSTDLSKFNQSYANIAYEPDDKDLSEFVTKSRHMSTFDPFMGNGTADIGILNQKPPWLNETKDSSLKLPQSPNKSSTQNESNTHLRKDNISAENNNQNSKSTVSKNFVHKF 2709
            MSLKYLAIFIFLFITIKIVDANQLLRNKRSAATSTGNSSGNGLYNPFEFVHIDDHKVYILGAAFVILFVFIKLASEKEFNYCCLACYKNCKFTTSFSVAKRSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDLFQSDNDVRFRMYKKAWSSYASLHSLSESHGKVPDHLYNSMSIPDLAILDKTITRRDVDDQMTHHNMQEGMGRKFYKRKFTTKKTKQRKKKHYSEIDSHRSLCYKVPRRVIDLRFNKKNKDPEDILATMQRKFNTAPKMNKSVTFNHTEPP GKSIFTFGQQNNSISDLIDDNHITFSVTDSTDLSKFNQSYANIAYEPDDKDLSEFVTKSRHMSTFDPFMGNGTADIGILNQKPPWLNETKDSSLKLPQSPNKSSTQNESNTHLRKDNISAENNNQNSKSTVSKNFVHKF
Sbjct:    1 MSLKYLAIFIFLFITIKIVDANQLLRNKRSAATSTGNSSGNGLYNPFEFVHIDDHKVYILGAAFVILFVFIKLASEKEFNYCCLACYKNCKFTTSFSVAKRSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDLFQSDNDVRFRMYKKAWSSYASLHSLSESHGKVPDHLYNSMSIPDLAILDKTITRRDVDDQMTHHNMQEGMGRKFYKRKFTTKKTKQRKKKHYSEIDSHRSLCYKVPRRVIDLRFNKKNKDPEDILATMQRKFNTAPKMNKSVTFNHTEPPGGKSIFTFGQQNNSISDLIDDNHITFSVTDSTDLSKFNQSYANIAYEPDDKDLSEFVTKSRHMSTFDPFMGNGTADIGILNQKPPWLNETKDSSLKLPQSPNKSSTQNESNTHLRKDNISAENNNQNSKSTVSKNFVHKF 892          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000050804.1 (SMESG000050804.1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 333/573 (58.12%), Postives = 445/573 (77.66%), Query Frame = 1
Query:   88 VDANQLLRNKRSAATSTGNSSGNGLYNPFEFVHIDDHKVYILGAAFVILFVFIKLASEKEFNYCCLACYKNCKFTTSFSVAKRSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIA 1806
            V+ NQ   N+    +   +     LYNPF   H +  K+Y  G  FVILFVF+K ASEK FNYC L C+  C   T      + + +  C  H+  PG+I PESAFL+++G + A+ +L LG+  +G+L   + FN++L PIVMGA W+TDK+TFYRN+GTIL FAI GTILNAAIL PL +YGSKSRW  +  +D D+VD+GL++ +ICAVDPVAVLSVFE+MHIDKLVYNVVFGESLLNDGVAVVFY AF +MKTI+ + F +S+ +V ++F+YAF ISV+LA  MAI+IS++SK+FY+ Q ++FV + SLNYLTY+I D IKGSGI+SL+FCV++Q+QYV ANLS TSN I+++V++QL+LLSEG+++I+MGLT+FS TG+  N+D+ F+ +LI  CY+SR+IV+Y LGFI N FR EKL+Y+K LFIQ+HGGLRGAIGF+L LT+ + ++ RY YQ+AT IMVFFSV+VLGA+IKPLV + K+ +E+H  + +F+SL EK+SDR KEGIK +IGSSSLRF+WE  YR FNN++FKKWFM+ K++ER   +S V+K++R QSI EAQ+I+
Sbjct:   21 VEKNQTSTNQYRNISQEIHFQSRNLYNPFASFHFESLKIYFAGTIFVILFVFVKYASEKTFNYCELVCFTGCDNKT----VPKIIPQKKCTKHQIKPGSILPESAFLVSSGAVIAIILLKLGINWEGSLDPNLIFNLLLVPIVMGAAWSTDKITFYRNLGTILLFAIVGTILNAAILAPLFYYGSKSRWGIFDTIDFDVVDSGLFATIICAVDPVAVLSVFESMHIDKLVYNVVFGESLLNDGVAVVFYRAFYEMKTISEINFIQSLSIVVLYFVYAFVISVILAFVMAIVISYVSKIFYNQQALEFVAVFSLNYLTYIIADFIKGSGIISLFFCVLIQRQYVQANLSVTSNTIISQVISQLSLLSEGVIYIMMGLTSFSPTGLLKNSDIRFSIFLIVSCYISRFIVVYFLGFIVNMFRNEKLEYKKALFIQAHGGLRGAIGFSLVLTLNEFFDNRYYYQSATAIMVFFSVYVLGASIKPLVKVLKISIETHGEQLVFLSLQEKISDRVKEGIKTVIGSSSLRFKWENWYRNFNNEYFKKWFMNNKTLERKAYNSGVLKVYRCQSILEAQEIS 589          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000013689.1 (SMESG000013689.1)

HSP 1 Score: 198.364 bits (503), Expect = 3.260e-53
Identity = 145/486 (29.84%), Postives = 251/486 (51.65%), Query Frame = 1
Query:  472 LSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTI--TNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRK----GLFIQSHGGLRGAIGFALSLTI-------GDNY---EFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRKFNNKHFKKWFMSKK------SIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIKDLFQSDNDVR 1863
            L+ ++FF I+L PIV+ + +     TF   +G +L FA+FGTIL+ AI+   LF   K   NF   ++  L+   L+S  I AVDPVAVL++F+ + +DK +Y ++FGESLLND V +V Y    ++  I  TN++   ++ L FV F +   +  LL   +  ++S +   F   + +  V++++  YL+Y+I  +I  SGI+S+  C ++Q  Y   N+  +    V   +   A +SE I+F+ +G+  F    +  +  + F     FLC ++R+IVI+ L  + NF    K+D RK     +FI ++GGLRGA+ F+L+  I       GD     E + ++   T +++  +V V+G TIKPL  L KV  E     +++  LN  V +     ++ II     R  +  +   F+N + + W +++        I + +   S+   + +     AQ+   +   G+   L +++ D R
Sbjct:   93 LTPELFFLILLPPIVLDSAYQMYNRTFGNILGIVLIFAVFGTILSFAIIGMSLFGLQKLNNNFLPDVNDKLMAILLFSSFIVAVDPVAVLAIFKDLKVDKELYYMIFGESLLNDAVTIVLYDIIKELMIIGDTNVK---NISLGFVSF-FTVSLGGLLVGVITGVLSVLLTRFQSKREIHCVMIIATAYLSYIIAYSIHWSGIMSIIGCGIVQAAYGFRNIEKSMQLTVRNFVELTAGVSESIIFVYLGIEFFKVEKVFDH--IEFQISAFFLCLIARFIVIFVLRLLINF---AKVDQRKISWTEMFIAAYGGLRGAVAFSLATLIIPEIVWKGDTENRKEMKMLFVKTTLMIIILTVAVMGTTIKPLAKLLKVKSEEKKILSVYNELNNAVIENLTATLEGIIDQKG-RNSYLIQLANFDNLYIRPWLVNEPCDNKVFKILKRLEQVSLALHYANLDGEYAQRKLTNIPKGLWPKLKENEQDER 568          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000069099.1 (SMESG000069099.1)

HSP 1 Score: 173.711 bits (439), Expect = 5.222e-45
Identity = 137/429 (31.93%), Postives = 226/429 (52.68%), Query Frame = 1
Query:  385 IFPESAFLITAGIIPAVAMLLL--GVTLDGTLS-----AKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANF--FRKEKLDYRKGLFIQSHGGLRGAIGFALSLTIGDNYEF-RYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIG 1641
            I PES  L+  G++  +       G   +  LS     +  FFN++L PI++ A +A    TF  NI  +L FA+  T+LN   +   L Y S  R    +   +++    ++S LI AVDPVAVL++F+ +H+D  +Y +VFGESLLNDGV+VV Y     +     +   E V  V  F L   G  V + C +++    +++  Y     + V+++   YL+Y++   IK SGI+S+    V Q  Y   N++  S  ++  +   L+ +SE ++FI +G++  + T IS  +   FTF+ +FLC   RYI    L  + N+  F   K+ + +  FI ++GGLRG I + L+L I       ++  Q  T  ++FF++F +G T+KPLV L ++ +      ++FV ++E   D    G++ IIG
Sbjct:   69 IIPESNLLLFCGVVLGLCFKWFYKGAASNPALSFFSINSDRFFNLLLPPIILEASFAMYHRTFASNIVGVLVFAVIATMLNFVFIGLGLTYISHYRGLSLSVSQVNISTFWVFSALIVAVDPVAVLAIFQEIHVDNNLYYLVFGESLLNDGVSVVLYETMIILSRFDKITINELVRTVISFLLVCLGGGV-IGCIISVFTCLMTRFTYKTPLTEPVLVMLFGYLSYLLAGMIKWSGIISMIVYGVFQATYGFQNITQKSLILIKRLSKILSNVSEAVIFIHLGVSV-TDTHISLTS---FTFWSVFLCLYGRYIFTLLLSGMINYFDFNIRKIAWNEQ-FIIAYGGLRGGIAYCLALLIDSTVPVSKHDIQQTTIFIIFFTIFFMGMTMKPLVTLLQIEIAKPDELSLFVQISESAIDHLLAGMEEIIG 491          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000006858.1 (SMESG000006858.1)

HSP 1 Score: 166.777 bits (421), Expect = 9.699e-43
Identity = 135/442 (30.54%), Postives = 234/442 (52.94%), Query Frame = 1
Query:  469 TLSAKIFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLFYGSKSRWNFY--TKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYNVVFGESLLNDGVAVVFYS---AFNDMKTITNLRFFESVGL-VFVFFLYAFGISVLLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSLYFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGTGISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKE--KLDYRKGLFIQSHGGLRGAIGFALSLTI----------GDNYEFRYIYQTATFIMVFFSVFVLGATIKPLVNLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAI---IGSSSLRFRWETRYRKFNNKHFKKWFMSKKSI 1731
            T++  +FF I+L PIV+ + +     +FYR  G  + +A+ GTI N  ++   L+  +    + Y   +L++ L    L+S LI AVDPVAVL++F  + +++ +Y +VFGESLLND V VV Y    AF   + I++L+    +GL +  FF  + G  +L+     II   +++++      +  V++ L Y++Y++ DTI  SGI+++  C ++Q +Y   N+S  S  ++  ++   A LSEG++F+ +G    S + I       F F+ +F+C V+R +V   L  + N    E  K+   + L +  +GGLRGA+ + L++ I           D    R +  T T  ++ F+V   G T+KPLV L K+ +      ++F + N  + D    GI+ I   IG + +R     +  +FNN + +K F+ K S+
Sbjct:   96 TMNPNLFFLILLPPIVLNSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLYGVTTGGVSVYGGPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPISSLQ----IGLGIISFFTVSLG-GLLIGLIFGIITCLVTRIY--DNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGE---SLSHIEKGWHSGFVFWSLFICIVARAVVCGLLALVNNLVNLEDRKISMTE-LIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQITTTLFIILFTVGAHGLTMKPLVKLLKIKIAKVEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIR----EKIIRFNNHYLRK-FLQKSSV 521          
The following BLAST results are available for this feature:
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC9A24.387e-6031.50solute carrier family 9 member A2 [Source:HGNC Sym... [more]
SLC9A11.704e-5331.52solute carrier family 9 member A1 [Source:HGNC Sym... [more]
SLC9A34.324e-5232.95solute carrier family 9 member A3 [Source:HGNC Sym... [more]
SLC9A34.700e-5232.95solute carrier family 9 member A3 [Source:HGNC Sym... [more]
SLC9A46.594e-5228.89solute carrier family 9 member A4 [Source:HGNC Sym... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhx-12.883e-6131.75Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
nhx-99.554e-5530.88Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
nhx-99.554e-5530.88Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
nhx-93.491e-5430.88Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
nhx-95.611e-5430.88Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nhe24.690e-5332.54gene:FBgn0040297 transcript:FBtr0299911[more]
Nhe26.443e-5332.54gene:FBgn0040297 transcript:FBtr0299909[more]
Nhe21.321e-5228.46gene:FBgn0040297 transcript:FBtr0334172[more]
Nhe22.249e-5232.77gene:FBgn0040297 transcript:FBtr0306016[more]
Nhe22.596e-5232.77gene:FBgn0040297 transcript:FBtr0306015[more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9a24.554e-5227.94solute carrier family 9 member 2 [Source:ZFIN;Acc:... [more]
slc9a1b4.342e-5131.80solute carrier family 9 member A1b [Source:ZFIN;Ac... [more]
slc9a51.157e-4930.59solute carrier family 9 member A5 [Source:ZFIN;Acc... [more]
slc9a3.15.651e-4830.17solute carrier family 9 member A3, tandem duplicat... [more]
slc9a3.15.651e-4830.17solute carrier family 9 member A3, tandem duplicat... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbl35.375e-6031.35transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GE... [more]
tbl31.393e-5931.29transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GE... [more]
tbl31.397e-5931.22transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GE... [more]
tbl31.634e-5931.35transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GE... [more]
tbl31.911e-5931.35transducin (beta)-like 3 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc9a28.959e-6131.16solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a11.067e-5331.52solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a41.930e-5229.63solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a33.571e-5133.26solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a33.571e-5133.26solute carrier family 9 (sodium/hydrogen exchanger... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01345|NHEB_ONCMY1.626e-6230.85Na(+)/H(+) exchanger beta OS=Oncorhynchus mykiss O... [more]
sp|P48763|SL9A2_RAT1.496e-6031.36Sodium/hydrogen exchanger 2 OS=Rattus norvegicus O... [more]
sp|P50482|SL9A2_RABIT4.141e-6031.36Sodium/hydrogen exchanger 2 OS=Oryctolagus cunicul... [more]
sp|Q9UBY0|SL9A2_HUMAN2.107e-5931.50Sodium/hydrogen exchanger 2 OS=Homo sapiens OX=960... [more]
sp|M5A7P9|SL9A3_TRISC6.440e-5333.04Sodium/hydrogen exchanger 3 OS=Triakis scyllium OX... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF750.000e+058.12Sodium/hydrogen exchanger OS=Schmidtea mediterrane... [more]
A0A401RFB54.774e-6334.01Sodium/hydrogen exchanger OS=Chiloscyllium punctat... [more]
A0A3B3HU298.513e-6334.38Sodium/hydrogen exchanger OS=Oryzias latipes OX=80... [more]
A0A3B3I3P21.089e-6234.38Sodium/hydrogen exchanger OS=Oryzias latipes OX=80... [more]
A0A4W3HGV37.614e-6233.68Sodium/hydrogen exchanger OS=Callorhinchus milii O... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000013913.24.176e-6033.12pep primary_assembly:Astyanax_mexicanus-2.0:24:205... [more]
ENSAMXT00000053304.17.505e-5832.26solute carrier family 9 member A1 [Source:NCBI gen... [more]
ENSAMXT00000015459.27.505e-5832.26solute carrier family 9 member A1 [Source:NCBI gen... [more]
slc9a3.11.814e-4630.77sodium/hydrogen exchanger 3-like [Source:NCBI gene... [more]
slc9a3.14.341e-4630.97sodium/hydrogen exchanger 3-like [Source:NCBI gene... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc9a3.12.353e-4329.18solute carrier family 9 member A3, tandem duplicat... [more]
ENSPMAT00000000903.16.189e-2433.02pep scaffold:Pmarinus_7.0:GL477267:34875:46041:-1 ... [more]
ENSPMAT00000001296.12.904e-936.84pep scaffold:Pmarinus_7.0:GL497132:72:2488:-1 gene... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NHX13.858e-3428.45Na+/H+ and K+/H+ exchanger; required for intracell... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO341034.312e-5231.58Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO430524.883e-3832.73Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO406711.116e-3328.13Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO492978.202e-727.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046726.13.205e-6634.38sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000036886.13.205e-6634.38sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000042935.14.099e-6634.38sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:... [more]
slc9a24.812e-5830.88sodium/hydrogen exchanger 2 [Source:NCBI gene;Acc:... [more]
slc9a26.029e-5631.04sodium/hydrogen exchanger 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062012.10.000e+099.89SMESG000062012.1[more]
SMESG000050804.10.000e+058.12SMESG000050804.1[more]
SMESG000013689.13.260e-5329.84SMESG000013689.1[more]
SMESG000069099.15.222e-4531.93SMESG000069099.1[more]
SMESG000006858.19.699e-4330.54SMESG000006858.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000707 ID=SMED30000707|Name=Sodium/hydrogen exchanger|organism=Schmidtea mediterranea sexual|type=transcript|length=2796bp
GAATTTTCAAAAAAAAATATGTAGAATTATTAAATGTCACTCAAATATTT
AGCAATTTTTATTTTCTTATTTATTACAATCAAGATTGTTGATGCGAACC
AGTTACTAAGGAATAAAAGAAGTGCGGCCACTTCAACTGGGAATTCTAGT
GGAAATGGATTGTACAATCCATTCGAATTCGTTCATATTGACGATCACAA
AGTTTATATCTTAGGAGCAGCTTTTGTTATTCTTTTTGTGTTTATAAAAT
TGGCCTCAGAAAAAGAGTTCAATTATTGTTGTTTAGCATGCTATAAAAAT
TGTAAATTCACCACAAGCTTTAGTGTAGCGAAAAGATCTTTATGTCGCAC
TGTCTGTCTAACTCATCGAACATCTCCTGGAAATATATTTCCAGAAAGTG
CATTTCTGATTACCGCTGGAATTATCCCAGCTGTCGCAATGTTATTATTG
GGAGTAACTTTAGATGGGACTTTGAGTGCCAAAATTTTCTTCAATATAAT
TCTTTTTCCAATCGTTATGGGTGCCGGTTGGGCGACCGACAAGTTGACTT
TCTATCGCAACATTGGAACCATCCTATGGTTCGCTATTTTTGGGACAATC
CTGAATGCTGCGATTCTGATGCCACTGTTATTTTATGGAAGCAAATCAAG
ATGGAATTTCTATACTAAATTAGACATGGATTTAGTTGATGCCGGTTTAT
ACTCTATACTAATTTGTGCAGTCGATCCGGTGGCCGTGCTTTCAGTGTTT
GAAGCTATGCATATCGATAAATTAGTTTATAATGTTGTCTTTGGAGAGTC
ATTGCTCAATGATGGAGTTGCAGTGGTGTTTTATAGTGCGTTCAATGACA
TGAAAACTATTACGAATCTCCGATTCTTCGAAAGTGTTGGATTAGTATTC
GTATTCTTTTTGTATGCTTTTGGGATATCTGTTCTTCTCGCATGCACAAT
GGCAATAATAATCAGTTTCATTAGTAAACTATTTTATCACCACCAACCGA
TGCAATTTGTAGTTTTACTATCATTAAACTACCTAACCTACGTAATTGGG
GACACTATAAAAGGTTCTGGAATTCTAAGTTTGTATTTTTGTGTTGTCAT
GCAGAAACAATATGTTGTAGCAAATTTATCGTATACGAGCAATCGAATCG
TAACGGAAGTTTTAACGCAACTCGCTCTTTTGTCAGAAGGCATCGTCTTT
ATTCTTATGGGTTTAACAGCATTTTCCGGAACTGGAATATCCACTAATAC
GGATGTTCCTTTCACTTTTTATCTGATTTTCTTGTGTTACGTATCTCGAT
ATATTGTTATTTACACGCTGGGATTCATTGCAAACTTTTTCCGCAAAGAA
AAGCTCGATTATAGAAAAGGACTTTTTATCCAGTCTCACGGCGGTTTAAG
AGGTGCGATTGGATTCGCTTTGTCATTGACAATTGGAGATAATTACGAAT
TCCGATACATTTATCAAACTGCTACATTTATCATGGTTTTCTTTTCTGTT
TTTGTTCTCGGAGCTACTATTAAGCCTCTGGTGAATTTATGCAAAGTTCC
TCTAGAATCGCACATGGCTAAAACCATATTTGTCAGCCTCAATGAGAAAG
TTTCTGACAGAACAAAAGAAGGAATAAAAGCAATAATTGGTTCTTCTTCA
CTTCGTTTTAGATGGGAAACGAGATATAGAAAATTCAATAATAAGCATTT
TAAAAAATGGTTCATGAGTAAAAAGTCCATAGAAAGAAGTGTTTCTCATT
CTTCTGTTGTTAAACTCCATCGAGATCAGAGTATTACAGAGGCTCAGCAA
ATTGCCGGTCACTATGGTGCAGGAATGATTAAGGACTTGTTTCAATCGGA
CAATGATGTGCGGTTTCGCATGTATAAAAAAGCTTGGAGTAGTTATGCAT
CATTGCATTCTTTATCAGAGTCTCATGGAAAGGTCCCTGATCATTTGTAT
AATTCGATGAGTATACCTGATTTAGCAATTTTAGACAAAACTATAACTAG
AAGAGATGTTGATGATCAAATGACACATCACAATATGCAAGAAGGAATGG
GTCGAAAATTTTATAAAAGAAAGTTTACTACTAAAAAAACTAAACAAAGA
AAAAAGAAGCATTATTCTGAAATTGATAGTCATCGGTCCCTGTGTTACAA
GGTTCCCCGCCGTGTCATTGACTTGCGGTTTAATAAGAAAAACAAAGATC
CCGAGGATATTTTAGCGACTATGCAAAGGAAATTTAATACAGCTCCAAAA
ATGAACAAATCTGTAACATTTAATCACACTGAGCCTCCTGAAGGGAAATC
CATTTTTACATTTGGACAACAAAACAACTCAATTTCAGATCTGATTGATG
ATAATCACATAACGTTTTCCGTCACGGACTCAACAGATTTAAGCAAATTC
AACCAATCATATGCCAATATTGCCTATGAACCCGATGATAAAGATCTTTC
GGAATTTGTTACAAAATCCAGACACATGAGCACATTTGATCCTTTTATGG
GGAACGGAACCGCTGATATTGGAATTCTGAATCAGAAACCTCCTTGGTTG
AATGAAACAAAAGATTCTTCACTCAAACTACCTCAGTCCCCCAACAAAAG
CTCCACTCAGAATGAATCGAATACTCATCTTCGAAAAGACAATATTTCAG
CTGAAAACAATAATCAAAATTCTAAATCAACAGTTTCGAAAAACTTTGTT
CATAAATTCTAAAATTTTTGTTTTTTACATATTTTTTTTAAAATTTACAA
TCACGTTTGTTTCACAATGAAAATTAACTATTTTACTCTTGATTGC
back to top

protein sequence of SMED30000707-orf-1

>SMED30000707-orf-1 ID=SMED30000707-orf-1|Name=SMED30000707-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=893bp
MSLKYLAIFIFLFITIKIVDANQLLRNKRSAATSTGNSSGNGLYNPFEFV
HIDDHKVYILGAAFVILFVFIKLASEKEFNYCCLACYKNCKFTTSFSVAK
RSLCRTVCLTHRTSPGNIFPESAFLITAGIIPAVAMLLLGVTLDGTLSAK
IFFNIILFPIVMGAGWATDKLTFYRNIGTILWFAIFGTILNAAILMPLLF
YGSKSRWNFYTKLDMDLVDAGLYSILICAVDPVAVLSVFEAMHIDKLVYN
VVFGESLLNDGVAVVFYSAFNDMKTITNLRFFESVGLVFVFFLYAFGISV
LLACTMAIIISFISKLFYHHQPMQFVVLLSLNYLTYVIGDTIKGSGILSL
YFCVVMQKQYVVANLSYTSNRIVTEVLTQLALLSEGIVFILMGLTAFSGT
GISTNTDVPFTFYLIFLCYVSRYIVIYTLGFIANFFRKEKLDYRKGLFIQ
SHGGLRGAIGFALSLTIGDNYEFRYIYQTATFIMVFFSVFVLGATIKPLV
NLCKVPLESHMAKTIFVSLNEKVSDRTKEGIKAIIGSSSLRFRWETRYRK
FNNKHFKKWFMSKKSIERSVSHSSVVKLHRDQSITEAQQIAGHYGAGMIK
DLFQSDNDVRFRMYKKAWSSYASLHSLSESHGKVPDHLYNSMSIPDLAIL
DKTITRRDVDDQMTHHNMQEGMGRKFYKRKFTTKKTKQRKKKHYSEIDSH
RSLCYKVPRRVIDLRFNKKNKDPEDILATMQRKFNTAPKMNKSVTFNHTE
PPEGKSIFTFGQQNNSISDLIDDNHITFSVTDSTDLSKFNQSYANIAYEP
DDKDLSEFVTKSRHMSTFDPFMGNGTADIGILNQKPPWLNETKDSSLKLP
QSPNKSSTQNESNTHLRKDNISAENNNQNSKSTVSKNFVHKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR018422Cation/H_exchanger_CPA1
IPR004709NaH_exchanger
IPR006153Cation/H_exchanger
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006814sodium ion transport
GO:0006885regulation of pH
GO:0006812cation transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
GO:1902600hydrogen ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0015385sodium:proton antiporter activity
GO:0015299solute:proton antiporter activity
GO:0015297antiporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004709Na+/H+ exchangerPRINTSPR01084NAHEXCHNGRcoord: 151..162
score: 47.26
coord: 180..188
score: 64.68
coord: 165..179
score: 35.01
coord: 224..234
score: 57.8
IPR004709Na+/H+ exchangerTIGRFAMTIGR00840TIGR00840coord: 117..584
e-value: 3.0E-93
score: 311.0
IPR006153Cation/H+ exchangerPFAMPF00999Na_H_Exchangercoord: 108..501
e-value: 8.9E-43
score: 146.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 843..892
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 843..886
NoneNo IPR availablePANTHERPTHR10110:SF98SODIUM/HYDROGEN EXCHANGERcoord: 111..721
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..21
score: 0.631
NoneNo IPR availableTMHMMTMhelixcoord: 118..140
NoneNo IPR availableTMHMMTMhelixcoord: 413..435
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 333..355
NoneNo IPR availableTMHMMTMhelixcoord: 281..313
NoneNo IPR availableTMHMMTMhelixcoord: 474..496
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
NoneNo IPR availableTMHMMTMhelixcoord: 376..398
NoneNo IPR availableTMHMMTMhelixcoord: 145..167
NoneNo IPR availableTMHMMTMhelixcoord: 57..74
IPR018422Cation/H+ exchanger, CPA1 familyPANTHERPTHR10110SODIUM/HYDROGEN EXCHANGERcoord: 111..721