Serine/threonine-protein kinase OSR1

Overview
NameSerine/threonine-protein kinase OSR1
Smed IDSMED30000705
Length (bp)1651
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase OSR1 (SMED30000705) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase OSR1 (SMED30000705) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase OSR1 (SMED30000705) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase OSR1 (SMED30000705) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000705

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30000705SMESG000066296.1 dd_Smed_v4_1366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000705SMESG000066296.1 dd_Smed_v4_1366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30000705SMESG000066296.1 dd_Smed_v4_1366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000705SMESG000066296.1 DN295577ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30000705SMESG000066296.1 DN295577ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30000705SMESG000066296.1 dd_Smed_v4_1366_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000705SMESG000066296.1 dd_Smed_v4_1366_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30000705SMESG000066296.1 dd_Smed_v4_1366_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Human
Match: STK39 (serine/threonine kinase 39 [Source:HGNC Symbol;Acc:HGNC:17717])

HSP 1 Score: 345.125 bits (884), Expect = 6.282e-112
Identity = 210/498 (42.17%), Postives = 290/498 (58.23%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR------------------------DEKQEKNPKDFSGEWNFDIXXXXXXXXXXXXQ-PVQKSKISVTE-------NVFYR--------ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK   N+ +  +GVL+E  IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + K+++RE L + LL    P   +R  KVR                        DEK E+    FS E +  +K ++ + +      P Q   +SV +       N  YR        + LR RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL ++V +P  ++   F L S    S +  E  L G+A++
Sbjct:   56 WPICRDAYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQ-KAKNREYLIEKLLT-RTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQL 542          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Human
Match: OXSR1 (oxidative stress responsive kinase 1 [Source:HGNC Symbol;Acc:HGNC:8508])

HSP 1 Score: 316.62 bits (810), Expect = 7.203e-102
Identity = 163/319 (51.10%), Postives = 212/319 (66.46%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR 1016
            W  N+ DY ++  IG GAT+ V  A C      K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LDIIK    K +  SGVLDE+TIATI+++VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP +RP+A ELL+  F + K++++E L +  L    P   ER  KVR
Sbjct:   10 WSINRDDYELQEVIGSGATAVVQAAYC-APKKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQ-KAKNKEFLQEKTLQ-RAPTISERAKKVR 319          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Human
Match: OXSR1 (oxidative stress responsive kinase 1 [Source:HGNC Symbol;Acc:HGNC:8508])

HSP 1 Score: 317.005 bits (811), Expect = 3.461e-101
Identity = 163/319 (51.10%), Postives = 212/319 (66.46%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR 1016
            W  N+ DY ++  IG GAT+ V  A C      K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LDIIK    K +  SGVLDE+TIATI+++VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP +RP+A ELL+  F + K++++E L +  L    P   ER  KVR
Sbjct:   10 WSINRDDYELQEVIGSGATAVVQAAYC-APKKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQ-KAKNKEFLQEKTLQ-RAPTISERAKKVR 319          

HSP 2 Score: 58.9214 bits (141), Expect = 1.342e-8
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 3
Query: 1119 QKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            Q++KI ++      + LR RN K+  EL DI F +  G+D+ + +++EL+ A L+DG DL++VA NL ++V EP + R   F L S    S +  +  L G+A++
Sbjct:  428 QETKIPIS------LVLRLRNSKK--ELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQL 524          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 196.823 bits (499), Expect = 5.977e-56
Identity = 110/278 (39.57%), Postives = 160/278 (57.55%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKS 938
            +G+G+  +VY+A        K   +I+ +++    + L EI KEI  M+   + ++V YY S    T+L I+M+ C  GS+ DII+       + +  L E+ IATI++  LKGL Y+H    +HRD+K GN+L+  +   ++ADFGVAG L         M+   KR T +GTP WMAPEV+Q++ GYN  ADIWS+GIT IEMA G+ PYA   PM+ + +   N PP        S+ +T+       F K CL K P QR +A +LLQ PF++S
Sbjct:   36 LGEGSYGSVYKAI------HKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIR-------LRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQL------TDTMA---KRNTVIGTPFWMAPEVIQEI-GYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTD-------FVKQCLVKSPEQRATATQLLQHPFVRS 283          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 195.667 bits (496), Expect = 1.067e-55
Identity = 109/278 (39.21%), Postives = 158/278 (56.83%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKS 938
            +G+G+  +VY+A        K   +I+ +++    + L EI KEI  M+   + ++V YY S    T+L I+M+ C  GS+ DII+       + +  L E+ IATI++  LKGL Y+H    +HRD+K GN+L+  +   ++ADFGVAG L              KR T +GTP WMAPEV+Q++ GYN  ADIWS+GIT IEMA G+ PYA   PM+ + +   N PP        S+ +T+       F K CL K P QR +A +LLQ PF++S
Sbjct:   36 LGEGSYGSVYKAI------HKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIR-------LRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLT---------DTMAKRNTVIGTPFWMAPEVIQEI-GYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTD-------FVKQCLVKSPEQRATATQLLQHPFVRS 283          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Celegans
Match: gck-3 (Germinal center kinase 3 [Source:UniProtKB/Swiss-Prot;Acc:G5EEN4])

HSP 1 Score: 325.865 bits (834), Expect = 6.516e-105
Identity = 167/344 (48.55%), Postives = 220/344 (63.95%), Query Frame = 3
Query:   54 PIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIK---ATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN--CDIPPAPERKVRDEKQEKNPKDFSGEWNFD 1070
            P  +WP   S Y +  SIG GAT+TV+ A C +  N K A+K INLEKC +S  +DE+  EI+ M    + N+V+YY S +A  EL ++M L   GS+LDI+K       K     GVLDE +IAT++++VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+G+LA+       +S    R TFVGTPCWMAPEVM+QV+GY+ KADIWS+GI  IE+ATG APY KY PMKVLMLTLQNDPP ++T A   +QY  YG  ++   + CL KDP++RP+A ELL+  F K K +D++ L   L+     +P       +     K  KD  G W F+
Sbjct:   97 PADRWPTEPSAYKLDESIGVGATATVFTAYC-LPRNEKVAIKCINLEKCQTS--VDELSHEIQAMSQCNHPNVVSYYTSFIAQEELWVVMRLLNCGSMLDILKRKVKAIGKEQAQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIKAGNILLADDGTIQIADFGVSGWLAS---SGGDLSRQKVRHTFVGTPCWMAPEVMEQVQGYDFKADIWSLGILAIELATGTAPYHKYPPMKVLMLTLQNDPPTLETNAERKDQYKAYGKSFKTLIRDCLQKDPAKRPTASELLKYSFFK-KGKDKKYLVHTLIENLASVPVVAHHSSKKVASGKLRKDAHGNWEFE 433          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Celegans
Match: gck-3 (Germinal center kinase 3 [Source:UniProtKB/Swiss-Prot;Acc:G5EEN4])

HSP 1 Score: 326.635 bits (836), Expect = 1.320e-104
Identity = 167/344 (48.55%), Postives = 220/344 (63.95%), Query Frame = 3
Query:   54 PIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIK---ATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN--CDIPPAPERKVRDEKQEKNPKDFSGEWNFD 1070
            P  +WP   S Y +  SIG GAT+TV+ A C +  N K A+K INLEKC +S  +DE+  EI+ M    + N+V+YY S +A  EL ++M L   GS+LDI+K       K     GVLDE +IAT++++VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+G+LA+       +S    R TFVGTPCWMAPEVM+QV+GY+ KADIWS+GI  IE+ATG APY KY PMKVLMLTLQNDPP ++T A   +QY  YG  ++   + CL KDP++RP+A ELL+  F K K +D++ L   L+     +P       +     K  KD  G W F+
Sbjct:   97 PADRWPTEPSAYKLDESIGVGATATVFTAYC-LPRNEKVAIKCINLEKCQTS--VDELSHEIQAMSQCNHPNVVSYYTSFIAQEELWVVMRLLNCGSMLDILKRKVKAIGKEQAQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIKAGNILLADDGTIQIADFGVSGWLAS---SGGDLSRQKVRHTFVGTPCWMAPEVMEQVQGYDFKADIWSLGILAIELATGTAPYHKYPPMKVLMLTLQNDPPTLETNAERKDQYKAYGKSFKTLIRDCLQKDPAKRPTASELLKYSFFK-KGKDKKYLVHTLIENLASVPVVAHHSSKKVASGKLRKDAHGNWEFE 433          

HSP 2 Score: 60.077 bits (144), Expect = 2.796e-9
Identity = 39/96 (40.62%), Postives = 57/96 (59.38%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV----AEPTMRERVFALNSP-PASGVISEADLNGYAKVLL 1433
            + LR RN  Q  EL DI F+Y    D+V+ +A ELV A+L+D  DL++VA NL +L+    ++   R   FALNS   A+ +  E  L G+A++ L
Sbjct:  501 MVLRVRN--QQRELNDIKFDYTKSADTVEGIAHELVTAELIDCHDLVIVAANLQKLIDFAESKSDRRSITFALNSGVHANEIPDERTLTGFAQISL 594          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Celegans
Match: gck-3 (Germinal center kinase 3 [Source:UniProtKB/Swiss-Prot;Acc:G5EEN4])

HSP 1 Score: 276.174 bits (705), Expect = 5.176e-87
Identity = 137/280 (48.93%), Postives = 180/280 (64.29%), Query Frame = 3
Query:  246 MRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIK---ATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN--CDIPPAPERKVRDEKQEKNPKDFSGEWNFD 1070
            M    + N+V+YY S +A  EL ++M L   GS+LDI+K       K     GVLDE +IAT++++VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+G+LA+       +S    R TFVGTPCWMAPEVM+QV+GY+ KADIWS+GI  IE+ATG APY KY PMKVLMLTLQNDPP ++T A   +QY  YG  ++   + CL KDP++RP+A ELL+  F K K +D++ L   L+     +P       +     K  KD  G W F+
Sbjct:    1 MSQCNHPNVVSYYTSFIAQEELWVVMRLLNCGSMLDILKRKVKAIGKEQAQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIKAGNILLADDGTIQIADFGVSGWLAS---SGGDLSRQKVRHTFVGTPCWMAPEVMEQVQGYDFKADIWSLGILAIELATGTAPYHKYPPMKVLMLTLQNDPPTLETNAERKDQYKAYGKSFKTLIRDCLQKDPAKRPTASELLKYSFFK-KGKDKKYLVHTLIENLASVPVVAHHSSKKVASGKLRKDAHGNWEFE 276          

HSP 2 Score: 59.6918 bits (143), Expect = 2.729e-9
Identity = 39/96 (40.62%), Postives = 57/96 (59.38%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV----AEPTMRERVFALNSP-PASGVISEADLNGYAKVLL 1433
            + LR RN  Q  EL DI F+Y    D+V+ +A ELV A+L+D  DL++VA NL +L+    ++   R   FALNS   A+ +  E  L G+A++ L
Sbjct:  344 MVLRVRN--QQRELNDIKFDYTKSADTVEGIAHELVTAELIDCHDLVIVAANLQKLIDFAESKSDRRSITFALNSGVHANEIPDERTLTGFAQISL 437          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 201.06 bits (510), Expect = 9.021e-57
Identity = 108/280 (38.57%), Postives = 167/280 (59.64%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRK---CAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIK 935
            IG+G+   VY+     ++NR     A+KII+LE+      +++I++EI+ +    ++ +  Y+ S + G++L I+M+    GS LD+ K         SG LDE+ IA I++++LKGL Y+H    +HRD+K  N+LV +   +++ADFGVAG L              KR TFVG+P WMAPE+++Q   Y+ KADIWS+GIT IE+A G+ P++   PM+VL L  +N PP +        Q + +   +++F ++CL KDP  RPSA  LL+  FIK
Sbjct:   20 IGRGSFGEVYKG----IDNRTGRVVAIKIIDLEQAEDE--IEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTK---------SGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLT---------ETVKKRITFVGSPFWMAPELIKQ-SSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVL--------QGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 266          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 201.06 bits (510), Expect = 9.966e-57
Identity = 108/280 (38.57%), Postives = 167/280 (59.64%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRK---CAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIK 935
            IG+G+   VY+     ++NR     A+KII+LE+      +++I++EI+ +    ++ +  Y+ S + G++L I+M+    GS LD+ K         SG LDE+ IA I++++LKGL Y+H    +HRD+K  N+LV +   +++ADFGVAG L              KR TFVG+P WMAPE+++Q   Y+ KADIWS+GIT IE+A G+ P++   PM+VL L  +N PP +        Q + +   +++F ++CL KDP  RPSA  LL+  FIK
Sbjct:   25 IGRGSFGEVYKG----IDNRTGRVVAIKIIDLEQAEDE--IEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTK---------SGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLT---------ETVKKRITFVGSPFWMAPELIKQ-SSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVL--------QGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 271          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Fly
Match: fray (gene:FBgn0023083 transcript:FBtr0083638)

HSP 1 Score: 341.273 bits (874), Expect = 1.184e-110
Identity = 181/355 (50.99%), Postives = 234/355 (65.92%), Query Frame = 3
Query:   30 GTAPDASHPIVQ--WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDK--RFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEW 1061
             T P A+ P  +  WPN+K DY ++  IG GAT+ V+ A C I  N KCA+K INLEK ++S  +DE+ KEI+ M +  +EN+VTY+ S V   EL +++ L + GSLLDIIK      +   GV DE TIAT++K+VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+ +LA      TG  L  +  R TFVGTPCWMAPEVM+Q  GY+ KADIWS GIT IEMATG APY KY PMKVLMLTLQNDPP +DT A   +QY  YG  +RK    CL K+PS+RP+A ELL+  F K K++DR+ L++ LL     P+ E +V  +  ++ P       +  +GEW
Sbjct:   17 ATLPGAAAPPEKYTWPNSKDDYELRDVIGVGATAVVHGAYC-IPRNEKCAIKRINLEKWNTS--MDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLA------TGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFK-KAKDRKYLTQTLLQSG--PSMETRVH-KAAKRQPGASGRLHRTVTGEW 358          

HSP 2 Score: 58.151 bits (139), Expect = 1.275e-8
Identity = 37/91 (40.66%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV-AEPTMRERVFALNSPPASG-VISEADLNGYAKV 1427
            + LR RN ++  EL DI F +V+GKD+ + +A ELV+A L+D  D   +A +L +L+ A  TM+   F L+S    G V  E  L GYA++
Sbjct:  460 LVLRMRNLRR--ELHDIRFEFVVGKDTAEGIATELVDAGLVDALDTQPMATHLDQLIAASATMKTITFQLSSGVQPGEVPDERSLVGYAQI 548          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Fly
Match: fray (gene:FBgn0023083 transcript:FBtr0347418)

HSP 1 Score: 341.273 bits (874), Expect = 1.184e-110
Identity = 181/355 (50.99%), Postives = 234/355 (65.92%), Query Frame = 3
Query:   30 GTAPDASHPIVQ--WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDK--RFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEW 1061
             T P A+ P  +  WPN+K DY ++  IG GAT+ V+ A C I  N KCA+K INLEK ++S  +DE+ KEI+ M +  +EN+VTY+ S V   EL +++ L + GSLLDIIK      +   GV DE TIAT++K+VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+ +LA      TG  L  +  R TFVGTPCWMAPEVM+Q  GY+ KADIWS GIT IEMATG APY KY PMKVLMLTLQNDPP +DT A   +QY  YG  +RK    CL K+PS+RP+A ELL+  F K K++DR+ L++ LL     P+ E +V  +  ++ P       +  +GEW
Sbjct:   17 ATLPGAAAPPEKYTWPNSKDDYELRDVIGVGATAVVHGAYC-IPRNEKCAIKRINLEKWNTS--MDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLA------TGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFK-KAKDRKYLTQTLLQSG--PSMETRVH-KAAKRQPGASGRLHRTVTGEW 358          

HSP 2 Score: 58.151 bits (139), Expect = 1.275e-8
Identity = 37/91 (40.66%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV-AEPTMRERVFALNSPPASG-VISEADLNGYAKV 1427
            + LR RN ++  EL DI F +V+GKD+ + +A ELV+A L+D  D   +A +L +L+ A  TM+   F L+S    G V  E  L GYA++
Sbjct:  460 LVLRMRNLRR--ELHDIRFEFVVGKDTAEGIATELVDAGLVDALDTQPMATHLDQLIAASATMKTITFQLSSGVQPGEVPDERSLVGYAQI 548          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Fly
Match: fray (gene:FBgn0023083 transcript:FBtr0290210)

HSP 1 Score: 341.273 bits (874), Expect = 1.184e-110
Identity = 181/355 (50.99%), Postives = 234/355 (65.92%), Query Frame = 3
Query:   30 GTAPDASHPIVQ--WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDK--RFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEW 1061
             T P A+ P  +  WPN+K DY ++  IG GAT+ V+ A C I  N KCA+K INLEK ++S  +DE+ KEI+ M +  +EN+VTY+ S V   EL +++ L + GSLLDIIK      +   GV DE TIAT++K+VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+ +LA      TG  L  +  R TFVGTPCWMAPEVM+Q  GY+ KADIWS GIT IEMATG APY KY PMKVLMLTLQNDPP +DT A   +QY  YG  +RK    CL K+PS+RP+A ELL+  F K K++DR+ L++ LL     P+ E +V  +  ++ P       +  +GEW
Sbjct:   17 ATLPGAAAPPEKYTWPNSKDDYELRDVIGVGATAVVHGAYC-IPRNEKCAIKRINLEKWNTS--MDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLA------TGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFK-KAKDRKYLTQTLLQSG--PSMETRVH-KAAKRQPGASGRLHRTVTGEW 358          

HSP 2 Score: 58.151 bits (139), Expect = 1.275e-8
Identity = 37/91 (40.66%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV-AEPTMRERVFALNSPPASG-VISEADLNGYAKV 1427
            + LR RN ++  EL DI F +V+GKD+ + +A ELV+A L+D  D   +A +L +L+ A  TM+   F L+S    G V  E  L GYA++
Sbjct:  460 LVLRMRNLRR--ELHDIRFEFVVGKDTAEGIATELVDAGLVDALDTQPMATHLDQLIAASATMKTITFQLSSGVQPGEVPDERSLVGYAQI 548          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Fly
Match: fray (gene:FBgn0023083 transcript:FBtr0290107)

HSP 1 Score: 341.273 bits (874), Expect = 1.184e-110
Identity = 181/355 (50.99%), Postives = 234/355 (65.92%), Query Frame = 3
Query:   30 GTAPDASHPIVQ--WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDK--RFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEW 1061
             T P A+ P  +  WPN+K DY ++  IG GAT+ V+ A C I  N KCA+K INLEK ++S  +DE+ KEI+ M +  +EN+VTY+ S V   EL +++ L + GSLLDIIK      +   GV DE TIAT++K+VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+ +LA      TG  L  +  R TFVGTPCWMAPEVM+Q  GY+ KADIWS GIT IEMATG APY KY PMKVLMLTLQNDPP +DT A   +QY  YG  +RK    CL K+PS+RP+A ELL+  F K K++DR+ L++ LL     P+ E +V  +  ++ P       +  +GEW
Sbjct:   17 ATLPGAAAPPEKYTWPNSKDDYELRDVIGVGATAVVHGAYC-IPRNEKCAIKRINLEKWNTS--MDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLA------TGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFK-KAKDRKYLTQTLLQSG--PSMETRVH-KAAKRQPGASGRLHRTVTGEW 358          

HSP 2 Score: 58.151 bits (139), Expect = 1.275e-8
Identity = 37/91 (40.66%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV-AEPTMRERVFALNSPPASG-VISEADLNGYAKV 1427
            + LR RN ++  EL DI F +V+GKD+ + +A ELV+A L+D  D   +A +L +L+ A  TM+   F L+S    G V  E  L GYA++
Sbjct:  460 LVLRMRNLRR--ELHDIRFEFVVGKDTAEGIATELVDAGLVDALDTQPMATHLDQLIAASATMKTITFQLSSGVQPGEVPDERSLVGYAQI 548          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Fly
Match: fray (gene:FBgn0023083 transcript:FBtr0347417)

HSP 1 Score: 341.273 bits (874), Expect = 1.184e-110
Identity = 181/355 (50.99%), Postives = 234/355 (65.92%), Query Frame = 3
Query:   30 GTAPDASHPIVQ--WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDK--RFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEW 1061
             T P A+ P  +  WPN+K DY ++  IG GAT+ V+ A C I  N KCA+K INLEK ++S  +DE+ KEI+ M +  +EN+VTY+ S V   EL +++ L + GSLLDIIK      +   GV DE TIAT++K+VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+ +LA      TG  L  +  R TFVGTPCWMAPEVM+Q  GY+ KADIWS GIT IEMATG APY KY PMKVLMLTLQNDPP +DT A   +QY  YG  +RK    CL K+PS+RP+A ELL+  F K K++DR+ L++ LL     P+ E +V  +  ++ P       +  +GEW
Sbjct:   17 ATLPGAAAPPEKYTWPNSKDDYELRDVIGVGATAVVHGAYC-IPRNEKCAIKRINLEKWNTS--MDELLKEIQAMSSCFHENVVTYHTSFVVREELWLVLRLLEGGSLLDIIKHKMRTSNCKQGVFDEATIATVLKEVLKGLEYFHSNGQIHRDIKAGNILIGDDGTIQIADFGVSAWLA------TGRDLSRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQNDPPTLDTGADDKDQYKAYGKTFRKMIVECLQKEPSKRPTASELLKHAFFK-KAKDRKYLTQTLLQSG--PSMETRVH-KAAKRQPGASGRLHRTVTGEW 358          

HSP 2 Score: 58.151 bits (139), Expect = 1.275e-8
Identity = 37/91 (40.66%), Postives = 55/91 (60.44%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV-AEPTMRERVFALNSPPASG-VISEADLNGYAKV 1427
            + LR RN ++  EL DI F +V+GKD+ + +A ELV+A L+D  D   +A +L +L+ A  TM+   F L+S    G V  E  L GYA++
Sbjct:  460 LVLRMRNLRR--ELHDIRFEFVVGKDTAEGIATELVDAGLVDALDTQPMATHLDQLIAASATMKTITFQLSSGVQPGEVPDERSLVGYAQI 548          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Zebrafish
Match: stk39 (serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GENE-140106-194])

HSP 1 Score: 342.813 bits (878), Expect = 2.215e-111
Identity = 198/482 (41.08%), Postives = 274/482 (56.85%), Query Frame = 3
Query:   54 PIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP---------KDFSGEWNFDIXXXXXXXXXXXXQPVQKSKISVTENVFYRI--------------------------------TLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNS 1373
            P   WP  K  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK T NK +  +GVLDE+TIA+I+K+VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FL+        ++    R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY +Y PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP++RP+A ELL+  F + K+++RE L + LL       P    R +K  + P         +D   EW+ D   +  +         +  ++   EN    +                                 LR RN K+  EL DI F +  G+D+ D +++EL  A L++G D+++VA NL ++V +P T +   F L S
Sbjct:   58 PTTGWPIVKEAYELQEVIGSGATAVVQAALCSPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSVLDIIKHTFNKGEHRNGVLDESTIASILKEVLEGLDYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLST----GGDVTRHKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSAPYHRYPPMKVLMLTLQNDPPSLETGVEDKEMLKKYGKSFRKLISLCLQKDPAKRPTAAELLKCKFFQ-KAKNREYLMEKLLT----KGPNISQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDERSEEGKAAVNHERSRRVKENENQHGEVNANSLPLEDLSIQHPQVQPLEKPSSAHGAVNMVLRLRNSKK--ELNDIRFEFTPGQDTADGVSQELFSAGLVNGHDVVVVAANLQKIVEDPVTYKVLTFKLVS 525          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Zebrafish
Match: oxsr1b (oxidative stress responsive kinase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-723])

HSP 1 Score: 314.694 bits (805), Expect = 1.114e-100
Identity = 166/341 (48.68%), Postives = 217/341 (63.64%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF 1067
            W  NK DY ++  IG GAT+ V  A C +    K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LD+IK   +K +  +GVLDE +IAT++K+VL+GL Y+H+NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        M+ +  R TFVGTPCWMAPEVM+QVKGY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG   RK    CL K+P +RP++ ELL+  F + K+++ E L + LL+     AP    R  K  + P       K   GEW +
Sbjct:   10 WSINKDDYELQEVIGSGATAVVQAAYC-VPRKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDVIKHIISKGEHKTGVLDEPSIATVLKEVLQGLEYLHKNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLAT----GGDMTRNKVRKTFVGTPCWMAPEVMEQVKGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPCLETGITDKEMVKKYGKSLRKMISQCLQKEPEKRPTSSELLKHKFFQ-KAKNNEFLQEKLLHR----APTITERARKVRRVPGSSGRLHKTEDGEWEW 338          

HSP 2 Score: 58.5362 bits (140), Expect = 1.218e-8
Identity = 36/78 (46.15%), Postives = 51/78 (65.38%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERV-FALNSPPASGV 1391
            + LR RN K+  EL DI F ++ G+D+ D +++ELV A L+DG DL++VA NL ++V EP   + V F L    ASGV
Sbjct:  429 LVLRLRNLKK--ELNDIRFEFMPGRDTADGVSQELVSAGLVDGKDLVIVAANLQKIVEEPHSNKNVTFKL----ASGV 500          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Zebrafish
Match: oxsr1a (oxidative stress responsive kinase 1a [Source:ZFIN;Acc:ZDB-GENE-070620-25])

HSP 1 Score: 310.457 bits (794), Expect = 4.808e-99
Identity = 163/341 (47.80%), Postives = 216/341 (63.34%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF 1067
            W  +K DY ++  IG GAT+ V  A C      K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LD IK   +K +  SGV+DE +IATI+++VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        M+ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP +RP+A ELL+  F  +K+++ + L + LL      AP    R  K  + P       K   GEW +
Sbjct:   10 WSIDKDDYELQEVIGSGATAVVQAAYCKP-RKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDFIKYIISKGEHKSGVMDEPSIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDMTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADLWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPCLETGVTDKEMVKKYGKSFRKMISLCLQKDPEKRPTAAELLKHKFF-TKAKNTDYLKEKLLER----APTIGERSRKVRRVPGSSGRLHKTEDGEWEW 338          

HSP 2 Score: 58.9214 bits (141), Expect = 9.393e-9
Identity = 39/95 (41.05%), Postives = 59/95 (62.11%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERV-FALNSPPASGVIS-----EADLNGYAKV 1427
            + LR RN K+  EL DI F ++ G+D+ D +++ELV A L+DG DL++VA NL ++V +P   + V F L    ASGV S     +  L G+A++
Sbjct:  424 LVLRLRNTKK--ELNDIRFEFMPGRDTADGVSQELVSAGLVDGRDLVIVAANLQKIVDDPQTHKNVTFKL----ASGVDSSEIPDDVKLMGFAQL 512          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Zebrafish
Match: oxsr1a (oxidative stress responsive kinase 1a [Source:ZFIN;Acc:ZDB-GENE-070620-25])

HSP 1 Score: 240.736 bits (613), Expect = 2.850e-76
Identity = 114/212 (53.77%), Postives = 149/212 (70.28%), Query Frame = 3
Query:  216 LDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKY 851
            +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LD IK   +K +  SGV+DE +IATI+++VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        M+ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +
Sbjct:    1 MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDFIKYIISKGEHKSGVMDEPSIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDMTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADLWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPCLETGVTDKEMVKKYGKSF 208          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Zebrafish
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 194.126 bits (492), Expect = 8.404e-56
Identity = 113/304 (37.17%), Postives = 173/304 (56.91%), Query Frame = 3
Query:   75 NKSDYIIK-GSIGQGATSTVYEASCPILNNRK---CAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKML 974
            N  +Y  K   IG+G+   VY+     +NNR     A+KII+LE+        +  +EI  +    +  +  YY S + G++L I+M+    GS LD+++          G L+E  IATI++++LKGL Y+H    +HRD+K  N+L+ +   +++ADFGVAG L    +         KR TFVGTP WMAPEV++Q   Y+ KADIWS+GIT IE+A G+ P A+  PM+VL L  +N+PP ++ +         Y   ++ F + CL K+P  RP+AKELL+  FI   ++    LS+++
Sbjct:   15 NPEEYFTKLERIGKGSFGEVYKG----INNRTKEVVAIKIIDLEEAEDEIEDIQ--QEITVLSQCDSPYVTKYYGSYLTGSKLWIIMEYLGGGSALDLLRP---------GTLEEVYIATILREILKGLDYLHSERKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQI---------KRNTFVGTPFWMAPEVIKQ-SAYDFKADIWSLGITAIELAKGEPPNAELHPMRVLFLIPKNNPPTLEGS---------YSKAFKDFVEACLNKEPRFRPTAKELLKHKFITRYTKKTSYLSELI 284          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Xenopus
Match: hipk3 (homeodomain interacting protein kinase 3 [Source:Xenbase;Acc:XB-GENE-1010053])

HSP 1 Score: 350.903 bits (899), Expect = 9.599e-114
Identity = 202/461 (43.82%), Postives = 281/461 (60.95%), Query Frame = 3
Query:   39 PDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRE-LLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNFDIXXXXXXXXXXXXQPVQKSKI-------SVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNS 1373
            P A+ PI  WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LDIIK    + +  +GVL+E+ IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + KS++RE L+ K+L+       P   +R +K  + P       K+  G+W +    + ++ SS       K K+       SV  N    +T   +N ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL +++ +P T +   F L S
Sbjct:  120 PPAAQPI-GWPICRDSYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNIVTYYTSFVVKEELWLVMKLLSGGSMLDIIKHVVGRGEHKNGVLEESIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSSFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMRKYGKSFRKLISLCLQKDPSKRPTAAELLKCKFFQ-KSKNREYLIEKLLIK-----TPNIALRGKKVRRVPGSSGHLHKNEDGDWEWS-DDELEEKSSEFKDSYSKEKVIFNPTPKSVDNNELKSLTFFIKNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKMIDDPLTYKSLTFKLVS 563          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Xenopus
Match: sap130 (Sin3A associated protein 130kDa [Source:Xenbase;Acc:XB-GENE-6083596])

HSP 1 Score: 342.813 bits (878), Expect = 2.945e-112
Identity = 196/462 (42.42%), Postives = 268/462 (58.01%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFI-KSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNPKDFSGEWNFDIXXXXXXXXXXX-----XQPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            W  N+ DY ++  IG GAT+ V  A C      K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LDIIK    K +  +GVLDE +IAT++K+VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK    CL KDP +RP+A ELL+  F  K+K    E +  + +    P    R      +    +D   EW+ D   ++ +           +P  K  + +  N                EL DI F +  G+D+ D +++ELV A L+DG DL++VA NL ++V EP T R   F L S    S +  +  L G+A++
Sbjct:   11 WSINRDDYELQEVIGSGATAVVQAAFCAP-KKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIIAKGEHKNGVLDEASIATMLKEVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVQDKEMLKKYGKSFRKMISSCLQKDPEKRPTAAELLKHKFFQKAKELGAEWVPSLFIFTSAPIQVRRVPGSSGRLHKTEDGGWEWSDDELDEESEEGKAAILQLRVRPPAKFPLYINRNT-------------KKELNDIRFEFTPGRDTADGVSQELVSAGLVDGRDLVIVAANLQKIVDEPQTHRSVTFKLASGVDPSDIPDDGKLVGFAQL 452          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Xenopus
Match: hipk3 (homeodomain interacting protein kinase 3 [Source:Xenbase;Acc:XB-GENE-1010053])

HSP 1 Score: 345.125 bits (884), Expect = 4.130e-111
Identity = 210/510 (41.18%), Postives = 295/510 (57.84%), Query Frame = 3
Query:   39 PDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRE-LLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF-DIXXXXXXXXXXXXQPVQKSK---------ISVTENVFYRI---------------------------TLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            P A+ PI  WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LDIIK    + +  +GVL+E+ IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + KS++RE L+ K+L+       P   +R +K  + P       K+  G+W + D + ++  S   D    +KS+         I+   N+  RI                            LR RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL +++ +P T +   F L S    + +  E  L G+A++
Sbjct:  120 PPAAQPI-GWPICRDSYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNIVTYYTSFVVKEELWLVMKLLSGGSMLDIIKHVVGRGEHKNGVLEESIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSSFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMRKYGKSFRKLISLCLQKDPSKRPTAAELLKCKFFQ-KSKNREYLIEKLLIK-----TPNIALRGKKVRRVPGSSGHLHKNEDGDWEWSDDELEEKSSEFKDSYSKEKSRRDNESNNAEITTDSNMQTRIQNLSLQDTQAQSNESHVESGLPSAVNLVLRLRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKMIDDPLTYKSLTFKLVSGCDGTEIPDEVKLIGFAQL 613          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Xenopus
Match: hipk3 (homeodomain interacting protein kinase 3 [Source:Xenbase;Acc:XB-GENE-1010053])

HSP 1 Score: 337.421 bits (864), Expect = 1.898e-109
Identity = 204/491 (41.55%), Postives = 284/491 (57.84%), Query Frame = 3
Query:   39 PDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRE-LLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF-DIXXXXXXXXXXXXQPVQKS----KISVTENVFYRI--------------------------------TLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNS 1373
            P A+ PI  WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LDIIK    + +  +GVL+E+ IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + KS++RE L+ K+L+       P   +R +K  + P       K+  G+W + D + ++  S   D    +KS    +I+   N+  RI                                    RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL +++ +P T +   F L S
Sbjct:   12 PPAAQPI-GWPICRDSYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNIVTYYTSFVVKEELWLVMKLLSGGSMLDIIKHVVGRGEHKNGVLEESIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSSFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMRKYGKSFRKLISLCLQKDPSKRPTAAELLKCKFFQ-KSKNREYLIEKLLIK-----TPNIALRGKKVRRVPGSSGHLHKNEDGDWEWSDDELEEKSSEFKDSYSKEKSAFSPQITTDSNMQTRIQNLSLQDTQVRNGIALPIYLSFEFLYNLNVWSVFFFRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKMIDDPLTYKSLTFKLVS 486          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Xenopus
Match: hipk3 (homeodomain interacting protein kinase 3 [Source:Xenbase;Acc:XB-GENE-1010053])

HSP 1 Score: 336.265 bits (861), Expect = 1.070e-108
Identity = 204/491 (41.55%), Postives = 284/491 (57.84%), Query Frame = 3
Query:   39 PDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRE-LLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF-DIXXXXXXXXXXXXQPVQKS----KISVTENVFYRI--------------------------------TLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNS 1373
            P A+ PI  WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LDIIK    + +  +GVL+E+ IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + KS++RE L+ K+L+       P   +R +K  + P       K+  G+W + D + ++  S   D    +KS    +I+   N+  RI                                    RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL +++ +P T +   F L S
Sbjct:   43 PPAAQPI-GWPICRDSYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNIVTYYTSFVVKEELWLVMKLLSGGSMLDIIKHVVGRGEHKNGVLEESIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSSFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMRKYGKSFRKLISLCLQKDPSKRPTAAELLKCKFFQ-KSKNREYLIEKLLIK-----TPNIALRGKKVRRVPGSSGHLHKNEDGDWEWSDDELEEKSSEFKDSYSKEKSAFSPQITTDSNMQTRIQNLSLQDTQVRNGIALPIYLSFEFLYNLNVWSVFFFRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKMIDDPLTYKSLTFKLVS 517          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Mouse
Match: Stk39 (serine/threonine kinase 39 [Source:MGI Symbol;Acc:MGI:1858416])

HSP 1 Score: 342.043 bits (876), Expect = 1.078e-110
Identity = 210/497 (42.25%), Postives = 289/497 (58.15%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR------------------------DEKQEKNPKDFSGEWNFDIXXXXXXXXXXXXQ-PVQKSKISVTE-------NVFYR-------ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK   N+ +  +GVL+E  IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + K+++RE L + LL    P   +R  KVR                        DEK E+     S E +  +K ++ + S      P Q   +SV +       N  YR       + LR RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL ++V +P  ++   F L S    S +  E  L G+A++
Sbjct:   68 WPICRDAYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQ-KAKNREYLIEKLLT-RTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAASQEKSRRVKEENSEISVNAGGIPEQIQSLSVHDSQAQPNANEDYREGPCAVNLVLRLRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQL 553          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Mouse
Match: Oxsr1 (oxidative-stress responsive 1 [Source:MGI Symbol;Acc:MGI:1917378])

HSP 1 Score: 316.235 bits (809), Expect = 3.726e-101
Identity = 157/305 (51.48%), Postives = 206/305 (67.54%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN 980
            W  N+ DY ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LDIIK    K +  SGVLDE TIATI+++VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP +RP+A ELL+  F + K++++E L + +L 
Sbjct:   10 WSINRDDYELQEVIGSGATAVVQAAYCAPKKER-VAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDEPTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQ-KAKNKEFLQEKILQ 306          

HSP 2 Score: 58.9214 bits (141), Expect = 1.175e-8
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 3
Query: 1119 QKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            Q++KI ++      + LR RN K+  EL DI F +  G+D+ + +++EL+ A L+DG DL++VA NL ++V EP + R   F L S    S +  +  L G+A++
Sbjct:  428 QETKIPIS------LVLRLRNSKK--ELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQL 524          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 192.971 bits (489), Expect = 1.175e-55
Identity = 110/293 (37.54%), Postives = 168/293 (57.34%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRK---CAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKML 974
            IG+G+   V++     ++NR     A+KII+LE+        +  +EI  +    +  +  YY S + G++L I+M+    GS LD+++A         G  DE  IAT++K++LKGL Y+H    +HRD+K  N+L+ +   +++ADFGVAG L    +         KR TFVGTP WMAPEV+QQ   Y+ KADIWS+GIT IE+A G+ P +   PM+VL L  +N+PP +           ++   +++F   CL KDPS RP+AKELL+  FI   S+    L++++
Sbjct:   30 IGKGSFGEVFKG----IDNRTQQVVAIKIIDLEEAEDEIEDIQ--QEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRA---------GPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQI---------KRNTFVGTPFWMAPEVIQQ-SAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTL---------IGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 288          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Mouse
Match: Stk4 (serine/threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1929004])

HSP 1 Score: 195.282 bits (495), Expect = 1.519e-55
Identity = 109/278 (39.21%), Postives = 157/278 (56.47%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKS 938
            +G+G+  +VY+A        K   +I+ +++    + L EI KEI  M+   + ++V YY S    T+L I+M+ C  GS+ DII+       + +  L E+ IATI++  LKGL Y+H    +HRD+K GN+L+  +   ++ADFGVAG L              KR T +GTP WMAPEV+Q++ GYN  ADIWS+GIT IEMA G+ PYA   PM+ + +   N PP        S+ + +       F K CL K P QR +A +LLQ PF+KS
Sbjct:   36 LGEGSYGSVYKAI------HKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIR-------LRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLT---------DTMAKRNTVIGTPFWMAPEVIQEI-GYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMD-------FVKQCLVKSPEQRATATQLLQHPFVKS 283          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 193.356 bits (490), Expect = 2.026e-55
Identity = 110/293 (37.54%), Postives = 168/293 (57.34%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRK---CAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKML 974
            IG+G+   V++     ++NR     A+KII+LE+        +  +EI  +    +  +  YY S + G++L I+M+    GS LD+++A         G  DE  IAT++K++LKGL Y+H    +HRD+K  N+L+ +   +++ADFGVAG L    +         KR TFVGTP WMAPEV+QQ   Y+ KADIWS+GIT IE+A G+ P +   PM+VL L  +N+PP +           ++   +++F   CL KDPS RP+AKELL+  FI   S+    L++++
Sbjct:   30 IGKGSFGEVFKG----IDNRTQQVVAIKIIDLEEAEDEIEDIQ--QEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRA---------GPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQI---------KRNTFVGTPFWMAPEVIQQ-SAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTL---------IGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 288          
BLAST of Serine/threonine-protein kinase OSR1 vs. UniProt/SwissProt
Match: sp|Q9UEW8|STK39_HUMAN (STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens OX=9606 GN=STK39 PE=1 SV=3)

HSP 1 Score: 345.125 bits (884), Expect = 3.017e-111
Identity = 210/498 (42.17%), Postives = 290/498 (58.23%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR------------------------DEKQEKNPKDFSGEWNFDIXXXXXXXXXXXXQ-PVQKSKISVTE-------NVFYR--------ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK   N+ +  +GVL+E  IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + K+++RE L + LL    P   +R  KVR                        DEK E+    FS E +  +K ++ + +      P Q   +SV +       N  YR        + LR RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL ++V +P  ++   F L S    S +  E  L G+A++
Sbjct:   56 WPICRDAYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQ-KAKNREYLIEKLLT-RTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQL 542          
BLAST of Serine/threonine-protein kinase OSR1 vs. UniProt/SwissProt
Match: sp|Q9Z1W9|STK39_MOUSE (STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus OX=10090 GN=Stk39 PE=1 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 7.540e-110
Identity = 210/497 (42.25%), Postives = 289/497 (58.15%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR------------------------DEKQEKNPKDFSGEWNFDIXXXXXXXXXXXXQ-PVQKSKISVTE-------NVFYR-------ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK   N+ +  +GVL+E  IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + K+++RE L + LL    P   +R  KVR                        DEK E+     S E +  +K ++ + S      P Q   +SV +       N  YR       + LR RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL ++V +P  ++   F L S    S +  E  L G+A++
Sbjct:   68 WPICRDAYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQ-KAKNREYLIEKLLT-RTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAASQEKSRRVKEENSEISVNAGGIPEQIQSLSVHDSQAQPNANEDYREGPCAVNLVLRLRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQL 553          
BLAST of Serine/threonine-protein kinase OSR1 vs. UniProt/SwissProt
Match: sp|O88506|STK39_RAT (STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus OX=10116 GN=Stk39 PE=1 SV=2)

HSP 1 Score: 340.887 bits (873), Expect = 1.778e-109
Identity = 210/499 (42.08%), Postives = 290/499 (58.12%), Query Frame = 3
Query:   60 VQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR------------------------DEKQEKNPKDFSGEWNFDIXXXXXXXXXXXXQ-PVQKSKISVTE-------NVFYR-------ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            V WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK   N+ +  +GVL+E  IATI+K+VL+GL Y+H NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KAD+WS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDPS+RP+A ELL+  F + K+++RE L + LL    P   +R  KVR                        DEK E+     S E +  +K ++ + S      P Q   +SV +       N  YR       + LR RN ++  EL DI F +  G+D+ D +++EL  A L+DG D+++VA NL ++V +P  ++   F L S    + +  E  L G+A++
Sbjct:   63 VGWPICRDAYELQEVIGSGATAVVQAALCKPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQ-KAKNREYLIEKLLT-RTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAASQEKSRRVKEENPEISVNAGGIPEQIQSLSVHDSQGQPNANEDYREGPCAVNLVLRLRNSRK--ELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGAEIPDEVKLIGFAQL 550          
BLAST of Serine/threonine-protein kinase OSR1 vs. UniProt/SwissProt
Match: sp|G5EEN4|GCK3_CAEEL (Germinal center kinase 3 OS=Caenorhabditis elegans OX=6239 GN=gck-3 PE=1 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.679e-103
Identity = 167/344 (48.55%), Postives = 220/344 (63.95%), Query Frame = 3
Query:   54 PIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIK---ATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN--CDIPPAPERKVRDEKQEKNPKDFSGEWNFD 1070
            P  +WP   S Y +  SIG GAT+TV+ A C +  N K A+K INLEKC +S  +DE+  EI+ M    + N+V+YY S +A  EL ++M L   GS+LDI+K       K     GVLDE +IAT++++VLKGL Y H NG +HRD+K GN+L+ DD  IQIADFGV+G+LA+       +S    R TFVGTPCWMAPEVM+QV+GY+ KADIWS+GI  IE+ATG APY KY PMKVLMLTLQNDPP ++T A   +QY  YG  ++   + CL KDP++RP+A ELL+  F K K +D++ L   L+     +P       +     K  KD  G W F+
Sbjct:   97 PADRWPTEPSAYKLDESIGVGATATVFTAYC-LPRNEKVAIKCINLEKCQTS--VDELSHEIQAMSQCNHPNVVSYYTSFIAQEELWVVMRLLNCGSMLDILKRKVKAIGKEQAQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIKAGNILLADDGTIQIADFGVSGWLAS---SGGDLSRQKVRHTFVGTPCWMAPEVMEQVQGYDFKADIWSLGILAIELATGTAPYHKYPPMKVLMLTLQNDPPTLETNAERKDQYKAYGKSFKTLIRDCLQKDPAKRPTASELLKYSFFK-KGKDKKYLVHTLIENLASVPVVAHHSSKKVASGKLRKDAHGNWEFE 433          

HSP 2 Score: 60.077 bits (144), Expect = 3.557e-8
Identity = 39/96 (40.62%), Postives = 57/96 (59.38%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELV----AEPTMRERVFALNSP-PASGVISEADLNGYAKVLL 1433
            + LR RN  Q  EL DI F+Y    D+V+ +A ELV A+L+D  DL++VA NL +L+    ++   R   FALNS   A+ +  E  L G+A++ L
Sbjct:  501 MVLRVRN--QQRELNDIKFDYTKSADTVEGIAHELVTAELIDCHDLVIVAANLQKLIDFAESKSDRRSITFALNSGVHANEIPDERTLTGFAQISL 594          
BLAST of Serine/threonine-protein kinase OSR1 vs. UniProt/SwissProt
Match: sp|Q5R495|OXSR1_PONAB (Serine/threonine-protein kinase OSR1 OS=Pongo abelii OX=9601 GN=OXSR1 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 5.636e-101
Identity = 157/305 (51.48%), Postives = 207/305 (67.87%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN 980
            W  N+ DY ++  IG GAT+ V  A C      K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LDIIK    K +  SGVLDE+TIATI+++VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP +RP+A ELL+  F + K++++E L + +L 
Sbjct:   10 WSINRDDYELQEVIGSGATAVVQAAYC-APKKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQ-KAKNKEFLQEKILQ 306          

HSP 2 Score: 58.9214 bits (141), Expect = 6.443e-8
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 3
Query: 1119 QKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP-PASGVISEADLNGYAKV 1427
            Q++KI ++      + LR RN K+  EL DI F +  G+D+ + +++EL+ A L+DG DL++VA NL ++V EP + R   F L S    S +  +  L G+A++
Sbjct:  428 QETKIPIS------LVLRLRNSKK--ELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQL 524          
BLAST of Serine/threonine-protein kinase OSR1 vs. TrEMBL
Match: A0A4S2LUR6 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006110 PE=4 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 7.439e-176
Identity = 248/350 (70.86%), Postives = 286/350 (81.71%), Query Frame = 3
Query:   45 ASHP-----IVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVR---DEKQEKNPKDFSGEWNFD 1070
            A HP      VQWP  KS Y    SIGQGATSTV+EASCP+ N RKCA+KIINLEKCS+S  L+EI +EI+ M+N+KNENIV YYAS V  TELCI+MDLCQRGSLLD+IK TQ+KRDIS GV DENTIATI++DVL+GL+YIHENGLVHRDLKCGNLLVKDD VIQIADFGVAGFLA +P+ AT  S+D +RFTFVGTPCWMAPEVMQQ +GYNQKADIWS+GIT IEMATGQAPYAKY PMKVLMLTLQNDPPDIDT A  SNQY NYG K+RKFT+ CL KDP QR SA+ELL   +IK+K++DRELL +++L  +IPP   R  +   D  +++ PK+ S EWNFD
Sbjct:    8 APHPGSLESPVQWPMTKSSYDFGKSIGQGATSTVFEASCPV-NGRKCAIKIINLEKCSTSASLEEINREIKSMKNMKNENIVAYYASFVDQTELCIVMDLCQRGSLLDVIKYTQSKRDISYGVFDENTIATILRDVLRGLAYIHENGLVHRDLKCGNLLVKDDGVIQIADFGVAGFLATQPLTATD-SVDLRRFTFVGTPCWMAPEVMQQARGYNQKADIWSLGITTIEMATGQAPYAKYAPMKVLMLTLQNDPPDIDTVATVSNQYINYGQKFRKFTRACLMKDPGQRLSARELLSHTYIKAKAKDRELLCRVMLGGEIPPPISRSNKHADDRSEKRGPKNNSTEWNFD 355          

HSP 2 Score: 80.8777 bits (198), Expect = 2.641e-12
Identity = 38/40 (95.00%), Postives = 38/40 (95.00%), Query Frame = 3
Query: 1155 YRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEA 1274
            YRITLRKRNPKQNNELQDISFNYV GKDS DVLARELVEA
Sbjct:  492 YRITLRKRNPKQNNELQDISFNYVPGKDSADVLARELVEA 531          
BLAST of Serine/threonine-protein kinase OSR1 vs. TrEMBL
Match: A0A4S2LV50 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006110 PE=4 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 9.759e-176
Identity = 248/350 (70.86%), Postives = 286/350 (81.71%), Query Frame = 3
Query:   45 ASHP-----IVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVR---DEKQEKNPKDFSGEWNFD 1070
            A HP      VQWP  KS Y    SIGQGATSTV+EASCP+ N RKCA+KIINLEKCS+S  L+EI +EI+ M+N+KNENIV YYAS V  TELCI+MDLCQRGSLLD+IK TQ+KRDIS GV DENTIATI++DVL+GL+YIHENGLVHRDLKCGNLLVKDD VIQIADFGVAGFLA +P+ AT  S+D +RFTFVGTPCWMAPEVMQQ +GYNQKADIWS+GIT IEMATGQAPYAKY PMKVLMLTLQNDPPDIDT A  SNQY NYG K+RKFT+ CL KDP QR SA+ELL   +IK+K++DRELL +++L  +IPP   R  +   D  +++ PK+ S EWNFD
Sbjct:    8 APHPGSLESPVQWPMTKSSYDFGKSIGQGATSTVFEASCPV-NGRKCAIKIINLEKCSTSASLEEINREIKSMKNMKNENIVAYYASFVDQTELCIVMDLCQRGSLLDVIKYTQSKRDISYGVFDENTIATILRDVLRGLAYIHENGLVHRDLKCGNLLVKDDGVIQIADFGVAGFLATQPLTATD-SVDLRRFTFVGTPCWMAPEVMQQARGYNQKADIWSLGITTIEMATGQAPYAKYAPMKVLMLTLQNDPPDIDTVATVSNQYINYGQKFRKFTRACLMKDPGQRLSARELLSHTYIKAKAKDRELLCRVMLGGEIPPPISRSNKHADDRSEKRGPKNNSTEWNFD 355          

HSP 2 Score: 135.961 bits (341), Expect = 3.050e-30
Identity = 78/102 (76.47%), Postives = 86/102 (84.31%), Query Frame = 3
Query: 1155 YRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVIS-EADLNGYAKVLLRFAHEDLP 1457
            YRITLRKRNPKQNNELQDISFNYV GKDS DVLARELVEADLLDGCDLLLVAHN+SEL++ P  RERVF LNSPPA G +  E++L+GYAKVL+R      P
Sbjct:  492 YRITLRKRNPKQNNELQDISFNYVPGKDSADVLARELVEADLLDGCDLLLVAHNMSELISNPGQRERVFPLNSPPAPGQVPVESELHGYAKVLIRLVGSPTP 593          
BLAST of Serine/threonine-protein kinase OSR1 vs. TrEMBL
Match: A0A4E0RBM9 (Serine/threonine-protein kinase OSR1 OS=Fasciola hepatica OX=6192 GN=D915_005022 PE=4 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 1.785e-174
Identity = 242/344 (70.35%), Postives = 284/344 (82.56%), Query Frame = 3
Query:   48 SHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVR---DEKQEKNPKDFSGEWNFD 1070
            + P VQWP  KS +    SIGQGATS V+EA CP  N+R+CA+KIINLEKCS+S  L+EI +EI+ M+N+KNENIV YYAS V  TELCI+MDLCQRGSLLD+IK TQ+KRD+S GV DENTIATI++DVL+GL+YIHENGLVHRDLKCGNLLVKDD +IQIADFGVAGFLA +P+ ATG S+D +RFTFVGTPCWMAPEVMQQ +GYNQKADIWS+GIT IEMATGQAPYAKY PMKVLMLTLQNDPPDIDT A  SNQY NYG K+RKFT+ CL KDP QR SA+ELL   +IK+K++DRELL ++LL  +IPP   R  +   D  + ++PK+ S EWNFD
Sbjct:   13 TEPAVQWPMTKSAFEFGKSIGQGATSVVFEALCPA-NSRRCAIKIINLEKCSTSASLEEINREIKSMKNMKNENIVAYYASFVDATELCIVMDLCQRGSLLDVIKYTQSKRDVSYGVFDENTIATILRDVLRGLAYIHENGLVHRDLKCGNLLVKDDGIIQIADFGVAGFLATQPLTATG-SVDLRRFTFVGTPCWMAPEVMQQARGYNQKADIWSLGITTIEMATGQAPYAKYAPMKVLMLTLQNDPPDIDTVATVSNQYINYGQKFRKFTRACLLKDPGQRLSARELLGHTYIKAKAKDRELLCRVLLGGEIPPPVTRISKHSDDRTERRDPKNNSTEWNFD 354          

HSP 2 Score: 132.109 bits (331), Expect = 6.910e-29
Identity = 77/102 (75.49%), Postives = 86/102 (84.31%), Query Frame = 3
Query: 1155 YRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVIS-EADLNGYAKVLLRFAHEDLP 1457
            YRITLRKRN KQNNELQDISFNYV GKDS DVLARELVEADLLDGCDLLLVAHN+SEL++ P  RERVF LNSPPA G +  E++L+GYAKVL+R     +P
Sbjct:  503 YRITLRKRNLKQNNELQDISFNYVPGKDSADVLARELVEADLLDGCDLLLVAHNMSELISNPAARERVFPLNSPPAPGQVPVESELHGYAKVLIRLVGSPVP 604          
BLAST of Serine/threonine-protein kinase OSR1 vs. TrEMBL
Match: A0A504YNK3 (Serine/threonine-protein kinase OSR1 OS=Fasciola gigantica OX=46835 GN=FGIG_03036 PE=4 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 1.804e-174
Identity = 242/344 (70.35%), Postives = 284/344 (82.56%), Query Frame = 3
Query:   48 SHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVR---DEKQEKNPKDFSGEWNFD 1070
            + P VQWP  KS +    SIGQGATS V+EA CP  N+R+CA+KIINLEKCS+S  L+EI +EI+ M+N+KNENIV YYAS V  TELCI+MDLCQRGSLLD+IK TQ+KRD+S GV DENTIATI++DVL+GL+YIHENGLVHRDLKCGNLLVKDD +IQIADFGVAGFLA +P+ ATG S+D +RFTFVGTPCWMAPEVMQQ +GYNQKADIWS+GIT IEMATGQAPYAKY PMKVLMLTLQNDPPDIDT A  SNQY NYG K+RKFT+ CL KDP QR SA+ELL   +IK+K++DRELL ++LL  +IPP   R  +   D  + ++PK+ S EWNFD
Sbjct:   13 TEPAVQWPMTKSAFEFGKSIGQGATSVVFEALCPA-NSRRCAIKIINLEKCSTSASLEEINREIKSMKNMKNENIVAYYASFVDATELCIVMDLCQRGSLLDVIKYTQSKRDVSYGVFDENTIATILRDVLRGLAYIHENGLVHRDLKCGNLLVKDDGIIQIADFGVAGFLATQPLTATG-SVDLRRFTFVGTPCWMAPEVMQQARGYNQKADIWSLGITTIEMATGQAPYAKYAPMKVLMLTLQNDPPDIDTVATVSNQYINYGQKFRKFTRACLLKDPGQRLSARELLGHTYIKAKAKDRELLCRVLLGGEIPPPVTRISKHSDDRTERRDPKNNSTEWNFD 354          

HSP 2 Score: 132.109 bits (331), Expect = 6.294e-29
Identity = 77/102 (75.49%), Postives = 86/102 (84.31%), Query Frame = 3
Query: 1155 YRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVIS-EADLNGYAKVLLRFAHEDLP 1457
            YRITLRKRN KQNNELQDISFNYV GKDS DVLARELVEADLLDGCDLLLVAHN+SEL++ P  RERVF LNSPPA G +  E++L+GYAKVL+R     +P
Sbjct:  503 YRITLRKRNLKQNNELQDISFNYVPGKDSADVLARELVEADLLDGCDLLLVAHNMSELISNPAARERVFPLNSPPAPGQVPVESELHGYAKVLIRLVGSPVP 604          
BLAST of Serine/threonine-protein kinase OSR1 vs. TrEMBL
Match: A0A4Z2CQZ5 (Serine/threonine-protein kinase OSR1 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008286 PE=4 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 1.952e-173
Identity = 244/340 (71.76%), Postives = 285/340 (83.82%), Query Frame = 3
Query:   60 VQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVRDEKQEK-NPKDFSGEWNFD 1070
            +QWP  K+ Y    SIGQGATS V+EA CP  N +KCA+KIINLEKCS+S  L+EI +EI+ MRN+KNENIV YYAS VA TELCI+MDLCQRGSLLD+IK TQNKRDI+ GV DENTIATI++DVL+GLSYIHENGLVHRDLKCGNLLVKDD +IQIADFGVAGFLA +P+ ATG S+D +R+TFVGTPCWMAPEVMQQ +GYNQKADIWS+GIT IEMATGQAPYAK+ PMKVLMLTLQND PDID+ A  +NQY NYGHK+RKFTK CL KDP+QR SA+ELL   +IKSK++DRELL ++LL  ++PP   R  K  D++ EK +PK+ S EWNFD
Sbjct:   17 IQWPMTKASYEFGKSIGQGATSIVFEALCPS-NGKKCAIKIINLEKCSTSASLEEINREIKSMRNMKNENIVAYYASFVAQTELCIIMDLCQRGSLLDVIKYTQNKRDITYGVFDENTIATILRDVLRGLSYIHENGLVHRDLKCGNLLVKDDGIIQIADFGVAGFLATQPLTATG-SVDLRRYTFVGTPCWMAPEVMQQARGYNQKADIWSLGITTIEMATGQAPYAKFAPMKVLMLTLQNDSPDIDSVATVNNQYLNYGHKFRKFTKACLMKDPAQRLSARELLGHTYIKSKAKDRELLCRVLLGGEMPPPITRVNKHPDDRSEKRDPKNNSTEWNFD 354          

HSP 2 Score: 133.265 bits (334), Expect = 2.974e-29
Identity = 76/96 (79.17%), Postives = 85/96 (88.54%), Query Frame = 3
Query: 1155 YRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVIS-EADLNGYAKVLLRF 1439
            YRITLRKRNPKQNNELQDISFNYV GKDS DVLARELVEADLLDGCDLLLVAH++SEL++ P  RERVF LNSPPA G +  E++L+GYAKVL+R 
Sbjct:  520 YRITLRKRNPKQNNELQDISFNYVPGKDSADVLARELVEADLLDGCDLLLVAHHMSELISNPGARERVFPLNSPPAPGQVPIESELHGYAKVLIRI 615          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Cavefish
Match: oxsr1b (oxidative stress responsive kinase 1 [Source:NCBI gene;Acc:103043241])

HSP 1 Score: 348.977 bits (894), Expect = 1.585e-114
Identity = 208/478 (43.51%), Postives = 285/478 (59.62%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNFDIXXXXXXXXXXXX---------------QPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERV-FALNSP-PASGVISEADLNGYAKV 1427
            W   K DY ++  IG GAT+ V  A C +    K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LD+IK   ++ +  +GVLDE +IATI+K+VL+GL Y+H+NG +HRDLK GN+L+ +D  +QIADFGV+ FL+        ++ +  R TFVGTPCWMAPEVM+QVKGY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG   RK   +CL KDP +RP++ ELL+  F + K+++ E L + LL      AP    R +K  + P       K   GEW +     D++S  G                   V KS I    ++F  + L  RN K+  EL DI F ++ G+D+ D +++ELV A L+DG DL++VA NL ++V EP   + V F L S    S +  +  L G+A++
Sbjct:   10 WSICKDDYELQEVIGSGATAVVQAAYC-VPRKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDVIKHIISRGEHKTGVLDEASIATILKEVLQGLEYLHKNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLST----GGDITRNKVRKTFVGTPCWMAPEVMEQVKGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGITDKEMVKKYGKSLRKMVSLCLQKDPEKRPTSLELLKHKFFQ-KAKNNEFLQEKLLQ----KAPTISERSKKVRRVPGSSGRLHKTEDGEWEWSDDELDEESEEGKAAVAALRVKLDLLFLKAQVCKSLIRKASDLF-SLFLFARNLKK--ELNDIRFEFMPGRDTADGVSQELVSAGLVDGRDLVIVAANLQKIVDEPQTNKNVTFKLASGVEGSEIPDDVKLMGFAQL 472          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Cavefish
Match: stk39 (serine/threonine kinase 39 [Source:NCBI gene;Acc:103028154])

HSP 1 Score: 339.732 bits (870), Expect = 1.226e-110
Identity = 206/496 (41.53%), Postives = 290/496 (58.47%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR------------------------DEKQEKN-------------PKDFSGEWNF-DIXXXXXXXXXXXXQPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSPPASGVI-SEADLNGYAKV 1427
            WP  K  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  ++E+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK T ++ +  +GVLDE TIA+I+K+VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++    R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY +Y PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP++RP+A ELL+  F + K+++RE L + LL C  P   +R  KVR                        DE+ E+               ++  GE N  ++  +         QP++K+  +V       + LR RN ++  EL DI F +  G+D+ D +++EL  A L++G D+++VA NL ++V +P T +   F L S   S  I  E  L G+A++
Sbjct:   22 WPIVKEAYELQEVIGSGATAVVQAALCTPRQER-VAVKRINLEKCQTS--MEELLKEIQAMSQCNHPNVVTYYTSFVVKDELWLVMKLLSGGSVLDIIKHTCSRGEHKNGVLDEPTIASILKEVLEGLDYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRHKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSAPYHRYPPMKVLMLTLQNDPPMLETGVEDKEMLKKYGKSFRKLITLCLQKDPAKRPTASELLKCKFFQ-KAKNREYLVEKLL-CKGPNISQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDERSEEGKAAVNQGRSRRVKEENQDGEVNANNVPIESLSIQHPQVQPLEKNPNTVGA---VNMVLRLRNSRK--ELNDIRFEFTPGQDTADGVSQELFSAGLVNGHDVIVVAANLQKIVEDPVTYKVLTFKLASGCDSTEIPDEVKLIGFAQL 503          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Cavefish
Match: stk39 (serine/threonine kinase 39 [Source:NCBI gene;Acc:103028154])

HSP 1 Score: 337.806 bits (865), Expect = 4.252e-109
Identity = 200/478 (41.84%), Postives = 281/478 (58.79%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR------------------------DEKQEKN-------------PKDFSGEWNF-DIXXXXXXXXXXXXQPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSP 1376
            WP  K  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  ++E+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK T ++ +  +GVLDE TIA+I+K+VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++    R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY +Y PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP++RP+A ELL+  F + K+++RE L + LL C  P   +R  KVR                        DE+ E+               ++  GE N  ++  +         QP++K+  +V       + LR RN ++  EL DI F +  G+D+ D +++EL  A L++G D+++VA NL ++V +P T +   F L  P
Sbjct:   22 WPIVKEAYELQEVIGSGATAVVQAALCTPRQER-VAVKRINLEKCQTS--MEELLKEIQAMSQCNHPNVVTYYTSFVVKDELWLVMKLLSGGSVLDIIKHTCSRGEHKNGVLDEPTIASILKEVLEGLDYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRHKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSAPYHRYPPMKVLMLTLQNDPPMLETGVEDKEMLKKYGKSFRKLITLCLQKDPAKRPTASELLKCKFFQ-KAKNREYLVEKLL-CKGPNISQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDERSEEGKAAVNQGRSRRVKEENQDGEVNANNVPIESLSIQHPQVQPLEKNPNTVGA---VNMVLRLRNSRK--ELNDIRFEFTPGQDTADGVSQELFSAGLVNGHDVIVVAANLQKIVEDPVTYKVLTFKLVLP 485          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Cavefish
Match: oxsr1b (oxidative stress responsive kinase 1 [Source:NCBI gene;Acc:103043241])

HSP 1 Score: 312.383 bits (799), Expect = 9.040e-100
Identity = 164/341 (48.09%), Postives = 217/341 (63.64%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF 1067
            W   K DY ++  IG GAT+ V  A C +    K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LD+IK   ++ +  +GVLDE +IATI+K+VL+GL Y+H+NG +HRDLK GN+L+ +D  +QIADFGV+ FL+        ++ +  R TFVGTPCWMAPEVM+QVKGY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG   RK   +CL KDP +RP++ ELL+  F + K+++ E L + LL      AP    R +K  + P       K   GEW +
Sbjct:   10 WSICKDDYELQEVIGSGATAVVQAAYC-VPRKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDVIKHIISRGEHKTGVLDEASIATILKEVLQGLEYLHKNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLST----GGDITRNKVRKTFVGTPCWMAPEVMEQVKGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGITDKEMVKKYGKSLRKMVSLCLQKDPEKRPTSLELLKHKFFQ-KAKNNEFLQEKLLQ----KAPTISERSKKVRRVPGSSGRLHKTEDGEWEW 338          

HSP 2 Score: 58.9214 bits (141), Expect = 7.711e-9
Identity = 37/91 (40.66%), Postives = 57/91 (62.64%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERV-FALNSP-PASGVISEADLNGYAKV 1427
            + LR RN K+  EL DI F ++ G+D+ D +++ELV A L+DG DL++VA NL ++V EP   + V F L S    S +  +  L G+A++
Sbjct:  426 LVLRLRNLKK--ELNDIRFEFMPGRDTADGVSQELVSAGLVDGRDLVIVAANLQKIVDEPQTNKNVTFKLASGVEGSEIPDDVKLMGFAQL 514          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Cavefish
Match: stk39 (serine/threonine kinase 39 [Source:NCBI gene;Acc:103028154])

HSP 1 Score: 311.227 bits (796), Expect = 3.315e-99
Identity = 162/319 (50.78%), Postives = 214/319 (67.08%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER--KVR 1016
            WP  K  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  ++E+ KEI+ M    + N+VTYY S V   EL ++M L   GS+LDIIK T ++ +  +GVLDE TIA+I+K+VL+GL Y+H+NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        ++    R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY +Y PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP++RP+A ELL+  F + K+++RE L + LL C  P   +R  KVR
Sbjct:   22 WPIVKEAYELQEVIGSGATAVVQAALCTPRQER-VAVKRINLEKCQTS--MEELLKEIQAMSQCNHPNVVTYYTSFVVKDELWLVMKLLSGGSVLDIIKHTCSRGEHKNGVLDEPTIASILKEVLEGLDYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDVTRHKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSAPYHRYPPMKVLMLTLQNDPPMLETGVEDKEMLKKYGKSFRKLITLCLQKDPAKRPTASELLKCKFFQ-KAKNREYLVEKLL-CKGPNISQRAKKVR 331          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Sea Lamprey
Match: stk39 (serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GENE-140106-194])

HSP 1 Score: 232.646 bits (592), Expect = 8.717e-72
Identity = 107/195 (54.87%), Postives = 143/195 (73.33%), Query Frame = 3
Query:  396 VLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN 980
            VL+E  IA+I+K+VL+GL Y+H NG +HRD+K GN+L+ +D  IQIADFGV+ FLA        ++ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT +E+A+G APY KY PMKVLMLTLQNDPP ++T          YG  +RK    CL KDP++RP+A ELL+S F + K++++E L++ LL+
Sbjct:    1 VLEEPVIASILKEVLEGLDYLHRNGQIHRDVKAGNILLGEDGTIQIADFGVSAFLAT----GGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAMELASGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMVKKYGKSFRKLISQCLQKDPAKRPTAAELLKSKFFQ-KAKNKEYLAEKLLH 190          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 189.504 bits (480), Expect = 1.225e-54
Identity = 110/295 (37.29%), Postives = 171/295 (57.97%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRK---CAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLK--CGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKML 974
            IG+G+   V++     ++NR     A+KII+LE+        +  +EI  +    +  +  Y+ S + GT+L I+M+    GS LD+IK          G L+E+ IATI++++LKGL Y+H    +HRD+K    N+L+ +   +++ADFGVAG L    +         KR TFVGTP WMAPEV++Q   Y+ KADIWS+GIT IE+A G+ P ++  PM+VL L  +N+PP ++          NY   +++F   CL KDP  RP+AKELL+  FI+  ++    L++++
Sbjct:   32 IGKGSFGEVFKG----IDNRTKEVVAIKIIDLEEAEDEIEDIQ--QEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKP---------GPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQI---------KRNTFVGTPFWMAPEVIKQ-SAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLE---------GNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKKTSYLTELI 292          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010511.1 (pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1 gene:ENSPMAG00000009510.1 transcript:ENSPMAT00000010511.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.4 bits (433), Expect = 7.379e-46
Identity = 107/297 (36.03%), Postives = 161/297 (54.21%), Query Frame = 3
Query:  171 AMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEV--MQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQND--PPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFI---KSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP 1040
            A+K+I LE     T+   I++EI  M+  ++ NIV Y+ S +   +L I M+ C  GSL DI   T        G L E  IA + ++ LKGL+Y+H    +HRD+K  N+L+ D   +++ADFGV+  + A            KR +F+GTP WMAPEV  +++  GYNQ+ D+W++GIT IE+A  Q P     PM+ L L  +++  PP +      S  + N       F K  L K+P +RP+A +LLQ PF+    ++S   ELL +M       PAP R   D+++ + P
Sbjct:   13 AIKVIKLESGDDFTV---IQQEIIMMQECQHINIVAYFGSYLRWDKLWICMEYCGGGSLQDIYHVT--------GPLSERQIAYVSRETLKGLAYLHSKCKMHRDIKGANILLTDHGEVKLADFGVSAQITAT---------IAKRMSFIGTPYWMAPEVAAVERKGGYNQQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSNFQPPRLKDKVKWSGIFHN-------FIKQSLIKNPKKRPTADKLLQDPFVIQPLNRSLATELLDQMK-----SPAPPRNFYDDEEPEPP 277          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 169.088 bits (427), Expect = 4.951e-45
Identity = 103/305 (33.77%), Postives = 165/305 (54.10%), Query Frame = 3
Query:   78 KSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEV--MQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQN--DPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIK---SKSRDRELLSKM 971
            + D+ +   +G G    V++A   +      A+KII LE     ++   I++EI  M+  K+ NIV YY S +   +L I M+ C  GSL DI   T        G L E  IA + ++ L+GL+Y+H  G +HRD+K  N+L+ DD  +++ADFGV+  + A            KR +F+GTP WMAPEV  +++  GYN + D+W++GIT IE+A  Q P     PM+ L L  ++   PP +      S  + N       F K+ L K+P +RP+A+++L   +++   S+++  ELL ++
Sbjct:   11 QEDFELAERLGSGTYGDVHKARN-VQTGELVAIKIIKLEPGDDFSV---IQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVT--------GPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITA---------TIAKRKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHN-------FIKMALTKNPKKRPTAEKMLTHSYVQQPLSRAQALELLERV 287          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 155.606 bits (392), Expect = 8.294e-41
Identity = 100/292 (34.25%), Postives = 155/292 (53.08%), Query Frame = 3
Query:   69 PNNKSDYI---IKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIK 935
            P + S+Y+   IK  IG+G+T  V  A     + R+ A+K ++L K     LL     E+  MR   +EN+V  Y S +   EL ++M+  + G+L DI+  T+         ++E  IAT+   VL+ L+Y+H  G++HRD+K  ++L+  D  I+++DF   GF A    E T      +R + VGTP WMAPEV+ ++  Y  + D+WS+GI VIEM  G+ PY    P++ +     N PP +     +S          R F    L +DP+ R +A ELLQ PF++
Sbjct:  412 PGDPSEYLENFIK--IGEGSTGVVCLA-VDRRSGRQVAVKKMHLRKQQRRELL---FNEVVIMREYHHENVVDMYNSYLVADELWVVMEFLEGGALTDIVTHTR---------MNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDF---GFCAQVSKEVT------RRKSLVGTPYWMAPEVISRLP-YGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPL-------LRGFLDQMLVRDPALRATALELLQHPFLQ 671          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 168.703 bits (426), Expect = 1.084e-46
Identity = 101/285 (35.44%), Postives = 153/285 (53.68%), Query Frame = 3
Query:   87 YIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQ-QVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKS 938
            Y I+  IG+G    VY+A    +     A+K++NLE       L  + +EI  +  LK+  I  Y A+++    + I+M+ C  GS  D++K     R   +G L E  ++ I+ +V  GL Y+HE   +HRD+K  N+L+ ++ ++++ DFGV+G + +            KR TFVGTP WMAPEV+  +V GYN+KADIWS+GIT  E+  G  P +KY PMKV+    +  PP +            +    + F   CL K P+ RPSA  LL   F+K+
Sbjct:   18 YSIQSCIGRGNFGDVYKA-VDRVTQEIVAIKVVNLEHSDEDIEL--LAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLK-----RSYVNG-LPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTL----------KRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP---------FSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKN 274          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 171.014 bits (432), Expect = 9.016e-46
Identity = 100/297 (33.67%), Postives = 166/297 (55.89%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKN-ENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRD-----RELLSKMLL 977
            IG+G    VY+    +   R  A+K++NL+  S S  ++++++EI+ + +LK   NI  YY S +  T L I+M+ C  GSL  +++          G +DE  I  IM+++L  L  IH++ ++HRD+K  N+L+ ++  +++ DFGVA        +    SL  +R T  GTP WMAPEV+ +   Y+ K DIWS+GIT  E+ATG  PY     ++ + L +++ PP ++  +        Y    ++F  +CL +DP +R SA +LL+S FI++         +EL+S+ LL
Sbjct:   29 IGRGKFGVVYKGYN-VKTGRVYAIKVLNLD--SDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRP---------GKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAA-------QVNQTSL--RRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRS--------YSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELISRYLL 296          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 164.466 bits (415), Expect = 1.530e-43
Identity = 103/288 (35.76%), Postives = 148/288 (51.39%), Query Frame = 3
Query:   69 PNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFI 932
            P+ K   ++K  IGQGA+  VY A   I  N   A+K +NLEK     L   I  EI  M+  K+ NIV +  S V   +L ++M+  + GSL D++         +  +L E  I  + ++ L GL ++H  G++HRD+K  N+L+  +  I++ DFG    +           L+ KR T VGTP WMAPEV+ + K Y  K DIWS+GI +IEM  G+ PY   TP++ L L   N  P +        +  N     +KF   CLC +P  R SA ELL   +I
Sbjct:  616 PSTKYANLVK--IGQGASGGVYTA-YEIGTNVSVAIKQMNLEKQPKKEL---IINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVV---------THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQIN---------ELNLKRTTMVGTPYWMAPEVVSR-KEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKL-------KEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYI 871          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 147.902 bits (372), Expect = 1.939e-38
Identity = 93/293 (31.74%), Postives = 146/293 (49.83%), Query Frame = 3
Query:  108 GQGATSTVY----------------EASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYY-ASLVAGTELCILMDLCQRGSLLDIIKAT-QNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFI 932
            GQGA+  VY                ++ C  +   + A+K I L +     L   I  E+  M + + ENIV +  A ++   EL ++M+  + G L DI+ A  ++     S  L+EN +A I+K+  +GL ++H   ++HRD+K  N+L+    +++I DFG    L  +           KR T VGTP WMAPE++ Q KGY++K D+WS+GI +IEM  G+ PY    P+K L L   N  P +    + S Q        ++F   CL  +   R S ++LL   F+
Sbjct:  367 GQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQL---IMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEK---------RSKRATMVGTPYWMAPEIVNQ-KGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQ-------TKQFLDACLQVNVESRASVRKLLTFEFL 639          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 147.902 bits (372), Expect = 4.120e-38
Identity = 102/305 (33.44%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  108 GQGATSTVYEAS----------CPILNNR--------KCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYY-ASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLS 965
            GQGA+ +VY A             ++NN         K A+K + L K     L   I  EI  M++ +++NIV +  A L    +L ++M+  + GSL DII+ +    D S   L E  IA I+++  +GL ++H+  ++HRD+K  N+L+   A ++I DFG    L  +           KR T VGTP WMAPEV++Q + Y++K D+WS+GI  IEM  G+ PY    P+K L L   N  P +    + S +        ++F  VCLC D   R S +ELL   F       ++L S
Sbjct:  553 GQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKEL---IVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTN-DNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDK---------RSKRATMVGTPYWMAPEVVKQ-REYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLE-------IKRFLSVCLCVDVRYRASTEELLHHGFFNMACDPKDLTS 836          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Nematostella
Match: EDO33129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST31])

HSP 1 Score: 304.679 bits (779), Expect = 1.651e-97
Identity = 160/318 (50.31%), Postives = 211/318 (66.35%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKA--TQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVM-QQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAA-ASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPER 1007
            WPN K DY ++  IG GAT+ V  A C   N R  A+K I+LEKC +S  +DE+ KEI  M    +EN+V YY S V   EL I+M L   GS+LD+IK    Q    +  GVL+E+ IAT++++VLKGL Y H+NGL+HRD+K GN+L+  D  +Q+ADFGV+  ++    +    +    R TFVGTPCWMAPEVM QQV GYN KADIWS GIT IE+ATG APYAK+  MKVLMLTLQNDPP ++T A  S+  Y  Y   ++K   +CL K+P+ RP A ELL++PF K K++ ++ LS+ L+   +PP  ER
Sbjct:    9 WPNTKDDYKLQEVIGYGATAVVQAAICESKNER-VAIKRIDLEKCGAS--IDEMMKEIHAMSQCNHENVVNYYTSFVVRQELWIVMRLLNGGSMLDVIKQRIKQQPGLVDEGVLEEDIIATVLREVLKGLEYFHKNGLIHRDVKAGNILLATDGSVQLADFGVSSAIS----DYGDRTKPKMRKTFVGTPCWMAPEVMEQQVHGYNHKADIWSFGITAIELATGTAPYAKFPAMKVLMLTLQNDPPRMETCADGSTRDYKKYSKVFKKMVSLCLQKEPANRPDANELLKNPFFK-KAKGKDYLSEALVPL-MPPLGER 317          

HSP 2 Score: 66.2402 bits (160), Expect = 1.271e-11
Identity = 39/93 (41.94%), Postives = 58/93 (62.37%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERV-FALNSPPASGVISEADLNGYAKVLLR 1436
            +TLR RN K+  EL DI F++  GKD+ + +A+ELV A L+DG DL++VA NL ++V EP   + + F L S   S    E  L G+A++ + 
Sbjct:  416 LTLRLRNEKK--ELNDIRFDFTFGKDTAEGVAQELVSAGLIDGQDLVIVAANLQKVVDEPQESKFLTFPLKSSGTSETPDEKALIGFAQLTIH 506          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 190.274 bits (482), Expect = 3.942e-55
Identity = 110/289 (38.06%), Postives = 170/289 (58.82%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRK---CAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELL 962
            IG+G+   V++     ++NR     A+KII+LE+        +  +EI  +    +  +  Y+ S + GT+L I+M+    GS LD++KA         G ++E  IATI+++VLKGL Y+H    +HRD+K  N+L+ +   +++ADFGVAG L             +KR TFVGTP WMAPEV++Q   Y+ KADIWS+GIT IE+A G+ P +   PM+VL L  +N+PP++           N+   +++F  +CL KDP+ RP+AKELL+  FIK+  ++  L+
Sbjct:   17 IGKGSFGEVFKG----IDNRTNEVVAIKIIDLEEAEDEIEDIQ--QEITVLSQCDSLYVTKYHGSYLKGTKLWIIMEYLGGGSALDLMKA---------GNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLT---------DTLNKRNTFVGTPFWMAPEVIKQ-SAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPELT---------GNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRFIKTAKKNAYLV 271          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 177.948 bits (450), Expect = 2.904e-51
Identity = 103/290 (35.52%), Postives = 157/290 (54.14%), Query Frame = 3
Query:  105 IGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKML 974
            +G+G+  +V++A        K + +++ +++    T L EI KEI  M+   +  +V YY S    T+L I+M+ C  GS+ D++K       I +  L E  I  ++K  LKGL Y+H    +HRD+K GN+L+  +   ++ADFGVAG L              KR T +GTP WMAPEV+Q+V GY+  ADIWS+GIT +EMA G+ PYA   PM+ + +     PP              +   ++ F   CL K+P +R +A ELLQ  FI+  ++   +LS M+
Sbjct:   30 LGEGSYGSVFKAM------HKESGQVVAIKQVPVDTDLQEIIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMK-------IRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLT---------DTMAKRNTVIGTPFWMAPEVIQEV-GYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPG-------QWSEDFKDFVSKCLVKNPEERATATELLQHSFIQG-AKQISILSSMI 288          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 167.548 bits (423), Expect = 8.202e-46
Identity = 104/293 (35.49%), Postives = 149/293 (50.85%), Query Frame = 3
Query:   57 IVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIK 935
            IV   + K  Y     IGQGA+ TVY A   +    + A+K +NL +     L   I  EI  MR  K+ NIV Y  S + G EL ++M+    GSL D++  T          +DE  IA + ++ L+ L ++H NG++HRD+K  N+L+  D  +++ DFG           AT     +KR T VGTP WMAPEV+ + K Y  + D+WS+GI  IEM  G+ PY    P++ L L   N  P++      S         ++ F    L  D  +R SA+ELLQ PF+K
Sbjct:  216 IVSIGDPKKKYTKFEKIGQGASGTVYTA-IEVATGHEVAIKQMNLSQQPKKEL---IINEILVMRENKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTET---------CMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFC---------ATITPEQNKRSTMVGTPYWMAPEVVTR-KQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPV-------FKDFLAQSLEMDVEKRSSARELLQHPFLK 478          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 159.844 bits (403), Expect = 1.427e-44
Identity = 94/257 (36.58%), Postives = 142/257 (55.25%), Query Frame = 3
Query:  225 IKKEIRGMRNLKNE-NIVTYYASLVAGT------ELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVM----QQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKS-KSRDREL 959
            IK EI  +R   N  NI TYY + +  +      +L ++M+ C  GS+ D++K  +NK       L E  I+ I ++VL G+S++H N ++HRD+K  N+L+ + A +++ DFGV+  L        G     +R TF+GTP WMAPEV+    Q    Y+ + D+WSIGIT IEMA  Q P     PM+ L L  ++DPP + +  + S        ++  F   CL KD   RP+A +LLQ  FIK  +S +R++
Sbjct:   61 IKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNK------ALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLD----RTIG-----RRNTFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALFLIPRSDPPKLKSKKSWSK-------RFHHFVNTCLIKDYQHRPTADQLLQHEFIKDVRSSERKI 295          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Medaka
Match: stk39 (serine/threonine kinase 39 [Source:NCBI gene;Acc:101156210])

HSP 1 Score: 335.495 bits (859), Expect = 6.959e-109
Identity = 203/500 (40.60%), Postives = 287/500 (57.40%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF---DIXXXXXXXXXXXXQ-------------------------PVQKSKISVTENVFY-----RITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTM-RERVFALNSPPASG-----VISEADLNGYAKV 1427
            WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LDI+K  ++K D  +  L+E  IATI+K+VL+GL Y+H NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        M+ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY +Y PMKVLMLTLQNDPP ++T          YG  +RK   +CL K+P++RP+A ELL+  FI+ K++++E L + LL+     AP+   R  K  + P       K   G+W +   ++    ++  +  +Q                          VQ  ++   EN  +      + LR RN K+  EL DI F +  G+D+ D +++EL  A L++G D+++VA NL ++V  PT  R   F L    ASG     +  E  L G+A++
Sbjct:   22 WPITREAYELQEVIGSGATAVVQAALCTPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVTYYTSFVVKDELWLVMTLLSGGSMLDILKH-RSKEDEKNRALEEPIIATILKEVLEGLDYLHRNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDMTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSAPYHRYPPMKVLMLTLQNDPPSLETGVEDKEMLKKYGKSFRKLISMCLQKEPAKRPTAAELLKCKFIQ-KAKNKEYLVEKLLSG----APKISQRARKVRRVPGSSGHLHKTEDGDWEWSDDELDEGSEEGKAAVNQGRSRRVKYEAKDNEEDANSVPIEGLSVQHPQVEPYENAAFLKGVVNMVLRLRNSKK--ELNDIRFEFTPGRDTADGVSQELYSAGLVNGLDVVIVAANLQKIVDNPTTYRVLTFKL----ASGCDDTEIPDEVKLIGFAQL 502          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Medaka
Match: oxsr1b (serine/threonine-protein kinase OSR1 [Source:NCBI gene;Acc:101156367])

HSP 1 Score: 322.783 bits (826), Expect = 6.773e-104
Identity = 169/341 (49.56%), Postives = 216/341 (63.34%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF 1067
            W  N+ DY +   IG GAT+ V  A C I    K A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LD+IK   ++ +  SGVLDE +IAT++KDVL GL Y+H+NG +HRDLK GN+L+ DD  +QIADFGV+ FLAA       M+ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK    CL KDP +RP++ ELL+  F + K+++ E L   LL      AP    R ++  + P       K   GEW +
Sbjct:   10 WSINRDDYELHEVIGSGATAVVQAAYC-IPRKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVTYYTSFVVKDELWLVMKLLSGGSMLDVIKHIISRGEHKSGVLDEASIATVLKDVLDGLEYLHKNGQIHRDLKAGNILLGDDGSVQIADFGVSAFLAA----GGDMTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGITDKEMVKKYGKSFRKMISSCLQKDPEKRPTSLELLKHKFFQ-KAKNHEFLHDRLLQ----KAPTITERSKRVRRVPGSSGRLHKTEDGEWEW 338          

HSP 2 Score: 56.9954 bits (136), Expect = 3.368e-8
Identity = 42/109 (38.53%), Postives = 62/109 (56.88%), Query Frame = 3
Query: 1113 PVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERV-FALNSPPASG---VISEADLNGYAKV 1427
            P Q S  S        + LR RN K+  EL DI F ++ G+D+ D +++ELV A L+DG D+++VA NL ++V EP   + V F L    ASG   V  +  L G+A++
Sbjct:  412 PTQISSSSGNVQSPISLVLRLRNLKK--ELNDIRFEFMPGRDTADGVSQELVSAGLVDGRDVVIVAANLQKIVDEPQSNKSVTFKL----ASGTEEVPDDIKLMGFAQL 514          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Medaka
Match: oxsr1b (serine/threonine-protein kinase OSR1 [Source:NCBI gene;Acc:101156367])

HSP 1 Score: 322.398 bits (825), Expect = 1.086e-103
Identity = 169/341 (49.56%), Postives = 216/341 (63.34%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF 1067
            W  N+ DY +   IG GAT+ V  A C I    K A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LD+IK   ++ +  SGVLDE +IAT++KDVL GL Y+H+NG +HRDLK GN+L+ DD  +QIADFGV+ FLAA       M+ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK    CL KDP +RP++ ELL+  F + K+++ E L   LL      AP    R ++  + P       K   GEW +
Sbjct:   10 WSINRDDYELHEVIGSGATAVVQAAYC-IPRKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVTYYTSFVVKDELWLVMKLLSGGSMLDVIKHIISRGEHKSGVLDEASIATVLKDVLDGLEYLHKNGQIHRDLKAGNILLGDDGSVQIADFGVSAFLAA----GGDMTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGITDKEMVKKYGKSFRKMISSCLQKDPEKRPTSLELLKHKFFQ-KAKNHEFLHDRLLQ----KAPTITERSKRVRRVPGSSGRLHKTEDGEWEW 338          

HSP 2 Score: 56.9954 bits (136), Expect = 3.382e-8
Identity = 39/108 (36.11%), Postives = 59/108 (54.63%), Query Frame = 3
Query: 1113 PVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERV-FALNSPPASGVISEADLNGYAKVLL 1433
            P Q S  S        + LR RN K+  EL DI F ++ G+D+ D +++ELV A L+DG D+++VA NL ++V EP   + V F L        +S+  L  Y  +L+
Sbjct:  412 PTQISSSSGNVQSPISLVLRLRNLKK--ELNDIRFEFMPGRDTADGVSQELVSAGLVDGRDVVIVAANLQKIVDEPQSNKSVTFKL--------VSQTHLQDYPFILI 509          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Medaka
Match: oxsr1a (serine/threonine-protein kinase OSR1 [Source:NCBI gene;Acc:101161509])

HSP 1 Score: 314.694 bits (805), Expect = 1.044e-100
Identity = 159/305 (52.13%), Postives = 207/305 (67.87%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLN 980
            W  +K DY +K  IG GAT+ V  A C      K A+K INLEKC +S  +DE+ KEI+ M    + NIV+YY S V   EL ++M L   GS+LDIIK   ++ +  +GVLDE +IATI+K+VL+GL Y+H+NG +HRDLK GN+L+ +D  +QIADFGV+ FLA        M+ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY KY PMKVLMLTLQNDPP ++T          YG  +RK   +CL KDP +RP+A ELL+  F  +K+++ E L ++LL 
Sbjct:   10 WSIDKDDYELKEVIGSGATAVVQAAYCKP-RKEKVAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIISRGEHKNGVLDEASIATILKEVLEGLEYLHKNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLAT----GGDMTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPCLETGITDKEMVKKYGKSFRKMLALCLQKDPEKRPTAAELLKHKFF-TKAKNNEYLHEILLQ 306          

HSP 2 Score: 59.6918 bits (143), Expect = 5.045e-9
Identity = 37/88 (42.05%), Postives = 55/88 (62.50%), Query Frame = 3
Query: 1131 ISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEP-TMRERVFALNSPPASGV 1391
            ++ +  V   + LR RN K+  EL DI F ++ G+DS D +++ELV A L+DG DL++VA NL ++V +P + R   F L    ASGV
Sbjct:  422 LAFSSGVPISLVLRLRNSKK--ELNDIRFEFMPGRDSADGVSQELVSAGLVDGRDLVIVAANLQKIVDDPQSNRSVTFKL----ASGV 503          
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Medaka
Match: stk39 (serine/threonine kinase 39 [Source:NCBI gene;Acc:101156210])

HSP 1 Score: 305.449 bits (781), Expect = 7.058e-97
Identity = 162/341 (47.51%), Postives = 218/341 (63.93%), Query Frame = 3
Query:   66 WPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNP-------KDFSGEWNF 1067
            WP  +  Y ++  IG GAT+ V  A C     R  A+K INLEKC +S  +DE+ KEI+ M    + NIVTYY S V   EL ++M L   GS+LDI+K  ++K D  +  L+E  IATI+K+VL+GL Y+H NG +HRD+K GN+L+ +D  +QIADFGV+ FLA        M+ +  R TFVGTPCWMAPEVM+QV+GY+ KADIWS GIT IE+ATG APY +Y PMKVLMLTLQNDPP ++T          YG  +RK   +CL K+P++RP+A ELL+  FI+ K++++E L + LL+     AP+   R  K  + P       K   G+W +
Sbjct:   22 WPITREAYELQEVIGSGATAVVQAALCTPRQER-VAIKRINLEKCQTS--MDELLKEIQAMSQCHHPNIVTYYTSFVVKDELWLVMTLLSGGSMLDILKH-RSKEDEKNRALEEPIIATILKEVLEGLDYLHRNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLAT----GGDMTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSAPYHRYPPMKVLMLTLQNDPPSLETGVEDKEMLKKYGKSFRKLISMCLQKEPAKRPTAAELLKCKFIQ-KAKNKEYLVEKLLSG----APKISQRARKVRRVPGSSGHLHKTEDGDWEW 349          

HSP 2 Score: 52.7582 bits (125), Expect = 6.227e-7
Identity = 36/95 (37.89%), Postives = 55/95 (57.89%), Query Frame = 3
Query: 1161 ITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTM-RERVFALNSPPASG-----VISEADLNGYAKV 1427
            + LR RN K+  EL DI F +  G+D+ D +++EL  A L++G D+++VA NL ++V  PT  R   F L    ASG     +  E  L G+A++
Sbjct:  453 MVLRLRNSKK--ELNDIRFEFTPGRDTADGVSQELYSAGLVNGLDVVIVAANLQKIVDNPTTYRVLTFKL----ASGCDDTEIPDEVKLIGFAQL 541          
BLAST of Serine/threonine-protein kinase OSR1 vs. Planmine SMEST
Match: SMESG000066296.1 (SMESG000066296.1)

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 484/484 (100.00%), Postives = 484/484 (100.00%), Query Frame = 3
Query:   21 MIDGTAPDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNPKDFSGEWNFDIXXXXXXXXXXXXQPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVISEADLNGYAKVLLRFAHEDLPVLPKT 1472
            MIDGTAPDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNPKDFSGEWNFDIKGKDDDSSSGDDQPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVISEADLNGYAKVLLRFAHEDLPVLPKT
Sbjct:    1 MIDGTAPDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNPKDFSGEWNFDIKGKDDDSSSGDDQPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVISEADLNGYAKVLLRFAHEDLPVLPKT 484          
BLAST of Serine/threonine-protein kinase OSR1 vs. Planmine SMEST
Match: SMESG000052774.1 (SMESG000052774.1)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 345/489 (70.55%), Postives = 402/489 (82.21%), Query Frame = 3
Query:   12 LYVMIDGTAPDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEK--QEKNP-KDFSGEWNFDIX-XXXXXXXXXXXQPVQKSKISVTEN---VFYRITLRKRNPKQNNELQDISFNYVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALNSPPASGVISEADLNGYAKVLLRFAHEDLP 1457
            L  + D  A D S+  + W N + DY I  SIGQGATS VYEA C  LNNR CAMKIINLEKC+SS+LL+EIK+EI+ M+N+KNENIVTYYAS V G EL I+MD+CQRGSLLDIIK TQ+KRDI+ GV DE+TIATI+KDVL+GL+YIHENGLVHRDLKCGNLLVKDD +IQIADFGVA FLAA+PM  TG SLD+KRFTFVGTPCWMAPEVMQQVKG+NQKADIWS+GIT IE+A GQAPYAKY PMKVLMLTLQN+ PDIDTAA+S NQY+NYG KYRKF+K CL KDP+ RPSAKELLQSPFIKSK++DR+ L K+LL+ D  P  ER+  DE    EK P K FSGEWNFD++   D  +   + + V K++    EN   + YRITLRKRNPK+NNEL+DISF+YV+GKDSV++L RELVEADLLDGCDLLLVAHN+SELVA P++RERVFALNSPP++GV +E +L GYAKVLLRF  E  P
Sbjct:   16 LGTISDSNAVDGSNQTIVWSNKREDYKINRSIGQGATSNVYEAECLPLNNRLCAMKIINLEKCNSSSLLEEIKREIKSMKNMKNENIVTYYASFVNGIELFIIMDVCQRGSLLDIIKRTQSKRDITYGVFDESTIATILKDVLRGLTYIHENGLVHRDLKCGNLLVKDDGIIQIADFGVAAFLAAQPMHTTGASLDNKRFTFVGTPCWMAPEVMQQVKGHNQKADIWSLGITAIELAAGQAPYAKYAPMKVLMLTLQNESPDIDTAASSCNQYSNYGQKYRKFSKACLNKDPAMRPSAKELLQSPFIKSKAKDRDSLIKVLLSEDTLPF-ERQRSDENLCPEKTPTKAFSGEWNFDLQPLGDHLNDIDNKESVDKTENETFENSEPISYRITLRKRNPKKNNELEDISFDYVIGKDSVELLVRELVEADLLDGCDLLLVAHNMSELVANPSVRERVFALNSPPSTGVANEQELYGYAKVLLRFFGEPKP 503          
BLAST of Serine/threonine-protein kinase OSR1 vs. Planmine SMEST
Match: SMESG000018196.1 (SMESG000018196.1)

HSP 1 Score: 183.726 bits (465), Expect = 1.399e-51
Identity = 106/277 (38.27%), Postives = 156/277 (56.32%), Query Frame = 3
Query:   87 YIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELL 917
            + I+  +G+G+  +VY+A     N    A K++ ++     + L +I KEI  M+  K++ IV YY S     +L I+M+ C  GS+ DI++       + +   +E  IA I++  LKGL YIH+   +HRD+K GN+L+ +D   ++ADFGVAG L+             KR T +GTP WMAPEV+Q++ GY+  ADIWS+GIT IEMA G+ PYA   PM+ L +     PP +   +  S  + N       F   CL K+P QRPSA +LL
Sbjct:   17 FQIESKLGKGSYGSVYKAKHK-KNGFTVAAKLVPVD-----SELSDIVKEISIMQQCKSDYIVQYYGSFYDSHDLWIVMEYCGAGSVSDIMR-------LRNKTCNEEEIAIILQGSLKGLEYIHQLKKIHRDIKAGNILLTEDGNAKLADFGVAGQLSDTLA---------KRNTVIGTPYWMAPEVIQEI-GYHYSADIWSLGITAIEMADGKPPYADIHPMRALFMIPSQPPPTLLNPSIWSPSFVN-------FITQCLVKNPDQRPSASQLL 263          
BLAST of Serine/threonine-protein kinase OSR1 vs. Planmine SMEST
Match: SMESG000010489.1 (SMESG000010489.1)

HSP 1 Score: 180.259 bits (456), Expect = 6.994e-50
Identity = 106/296 (35.81%), Postives = 166/296 (56.08%), Query Frame = 3
Query:   87 YIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLMLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKML 974
            Y +   IG+G+   V++    I +    A+KII+LE+        +  +EI  +    +  +  Y+ S +  T+L I+M+    GS +D++K          G L+E  IA I++++LKGL Y+H    +HRD+K  N+L+ ++  +++ADFGVAG L          +  +KR TFVGTP WMAPEV++Q   Y+ KADIWS+GIT IE+A G+ P++   PM+VL L  +N  P +D +         +   +R F   CL K+P  RPSA+ELL   FIK K++    L +++
Sbjct:   18 YDVLERIGKGSFGEVHKGVNKI-DKTIVAIKIIDLEEAEDEIEDIQ--QEINVLSQCDSPYVTKYFGSYLKVTKLWIIMEYLGGGSAMDLMKP---------GPLNETYIAIILREILKGLDYLHSQKKLHRDIKAANVLLSENGDVKLADFGVAGQLT---------NTTNKRVTFVGTPFWMAPEVIKQ-SAYDFKADIWSLGITAIELAKGEPPHSNLHPMRVLFLIPKNPSPQLDGS---------FSKLFRDFVDCCLNKEPDNRPSARELLHHGFIK-KAKKTAYLQELI 281          
BLAST of Serine/threonine-protein kinase OSR1 vs. Planmine SMEST
Match: SMESG000029685.1 (SMESG000029685.1)

HSP 1 Score: 174.866 bits (442), Expect = 2.630e-46
Identity = 111/305 (36.39%), Postives = 165/305 (54.10%), Query Frame = 3
Query:   78 KSDYIIKGSIGQGATSTVYEASCPILNNRKCAMKIINLEKCSSSTLLDEIK---KEIRGMRNLKNENIVTYYASLVAGTELCILMDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENGLVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFVGTPCWMAPEV--MQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVL-MLTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQSPFIKSKSRDRELLSKML 974
            K DY +  +IG G    VY+A     NN   A+KI+ ++      + D+IK   +EI  +R+  ++NIV Y+ S +   +L I M+ C   S+ DI   T  +R      L+EN IA + +D L GL+Y+H+ G +HRD+K  N+L+ +D  ++IADFGVA         A       KR +F+GTP WMAPEV  +++  GY++K DIW++GIT IE A  Q P     PMK L +L+++N        A      T +  K+  F K+CL K+  +RP A  LLQ  F+  K+    L   +L
Sbjct:   22 KEDYKLIKNIGSGTYGEVYKA-IHRRNNTVSAVKIVKVD------IKDDIKAIAQEIHTLRDCNHKNIVKYFGSYLRKNKLWICMEFCGGFSIQDIY--TNIRRP-----LEENCIAYVTRDTLDGLAYMHKQGKIHRDIKGANILLTEDGQVKIADFGVA---------AQITQTIQKRCSFIGTPYWMAPEVAAVERKGGYDEKCDIWAVGITAIEYAELQPPMFDLHPMKALHLLSMRN------YKAPVLQNKTKWSQKFHSFLKICLNKNEKRRPDAMTLLQHDFVTQKNLTISLTKHLL 297          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK396.282e-11242.17serine/threonine kinase 39 [Source:HGNC Symbol;Acc... [more]
OXSR17.203e-10251.10oxidative stress responsive kinase 1 [Source:HGNC ... [more]
OXSR13.461e-10151.10oxidative stress responsive kinase 1 [Source:HGNC ... [more]
STK45.977e-5639.57serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK41.067e-5539.21serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-36.516e-10548.55Germinal center kinase 3 [Source:UniProtKB/Swiss-... [more]
gck-31.320e-10448.55Germinal center kinase 3 [Source:UniProtKB/Swiss-... [more]
gck-35.176e-8748.93Germinal center kinase 3 [Source:UniProtKB/Swiss-... [more]
gck-19.021e-5738.57Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-19.966e-5738.57Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fray1.184e-11050.99gene:FBgn0023083 transcript:FBtr0083638[more]
fray1.184e-11050.99gene:FBgn0023083 transcript:FBtr0347418[more]
fray1.184e-11050.99gene:FBgn0023083 transcript:FBtr0290210[more]
fray1.184e-11050.99gene:FBgn0023083 transcript:FBtr0290107[more]
fray1.184e-11050.99gene:FBgn0023083 transcript:FBtr0347417[more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk392.215e-11141.08serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GE... [more]
oxsr1b1.114e-10048.68oxidative stress responsive kinase 1b [Source:ZFIN... [more]
oxsr1a4.808e-9947.80oxidative stress responsive kinase 1a [Source:ZFIN... [more]
oxsr1a2.850e-7653.77oxidative stress responsive kinase 1a [Source:ZFIN... [more]
stk25a8.404e-5637.17serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipk39.599e-11443.82homeodomain interacting protein kinase 3 [Source:X... [more]
sap1302.945e-11242.42Sin3A associated protein 130kDa [Source:Xenbase;Ac... [more]
hipk34.130e-11141.18homeodomain interacting protein kinase 3 [Source:X... [more]
hipk31.898e-10941.55homeodomain interacting protein kinase 3 [Source:X... [more]
hipk31.070e-10841.55homeodomain interacting protein kinase 3 [Source:X... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk391.078e-11042.25serine/threonine kinase 39 [Source:MGI Symbol;Acc:... [more]
Oxsr13.726e-10151.48oxidative-stress responsive 1 [Source:MGI Symbol;A... [more]
Stk261.175e-5537.54serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk41.519e-5539.21serine/threonine kinase 4 [Source:MGI Symbol;Acc:M... [more]
Stk262.026e-5537.54serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UEW8|STK39_HUMAN3.017e-11142.17STE20/SPS1-related proline-alanine-rich protein ki... [more]
sp|Q9Z1W9|STK39_MOUSE7.540e-11042.25STE20/SPS1-related proline-alanine-rich protein ki... [more]
sp|O88506|STK39_RAT1.778e-10942.08STE20/SPS1-related proline-alanine-rich protein ki... [more]
sp|G5EEN4|GCK3_CAEEL1.679e-10348.55Germinal center kinase 3 OS=Caenorhabditis elegans... [more]
sp|Q5R495|OXSR1_PONAB5.636e-10151.48Serine/threonine-protein kinase OSR1 OS=Pongo abel... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LUR67.439e-17670.86Protein kinase domain-containing protein OS=Opisth... [more]
A0A4S2LV509.759e-17670.86Protein kinase domain-containing protein OS=Opisth... [more]
A0A4E0RBM91.785e-17470.35Serine/threonine-protein kinase OSR1 OS=Fasciola h... [more]
A0A504YNK31.804e-17470.35Serine/threonine-protein kinase OSR1 OS=Fasciola g... [more]
A0A4Z2CQZ51.952e-17371.76Serine/threonine-protein kinase OSR1 isoform 2 OS=... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxsr1b1.585e-11443.51oxidative stress responsive kinase 1 [Source:NCBI ... [more]
stk391.226e-11041.53serine/threonine kinase 39 [Source:NCBI gene;Acc:1... [more]
stk394.252e-10941.84serine/threonine kinase 39 [Source:NCBI gene;Acc:1... [more]
oxsr1b9.040e-10048.09oxidative stress responsive kinase 1 [Source:NCBI ... [more]
stk393.315e-9950.78serine/threonine kinase 39 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk398.717e-7254.87serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GE... [more]
stk25a1.225e-5437.29serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000010511.17.379e-4636.03pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1... [more]
MAP4K34.951e-4533.77mitogen-activated protein kinase kinase kinase kin... [more]
pak48.294e-4134.25p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SPS11.084e-4635.44Putative protein serine/threonine kinase; localize... [more]
KIC19.016e-4633.67Protein kinase of the PAK/Ste20 family, required f... [more]
STE201.530e-4335.76Cdc42p-activated signal transducing kinase; involv... [more]
SKM11.939e-3831.74Member of the PAK family of serine/threonine prote... [more]
CLA44.120e-3833.44Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO331291.651e-9750.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319343.942e-5538.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428452.904e-5135.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336678.202e-4635.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409611.427e-4436.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk396.959e-10940.60serine/threonine kinase 39 [Source:NCBI gene;Acc:1... [more]
oxsr1b6.773e-10449.56serine/threonine-protein kinase OSR1 [Source:NCBI ... [more]
oxsr1b1.086e-10349.56serine/threonine-protein kinase OSR1 [Source:NCBI ... [more]
oxsr1a1.044e-10052.13serine/threonine-protein kinase OSR1 [Source:NCBI ... [more]
stk397.058e-9747.51serine/threonine kinase 39 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Serine/threonine-protein kinase OSR1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066296.10.000e+0100.00SMESG000066296.1[more]
SMESG000052774.10.000e+070.55SMESG000052774.1[more]
SMESG000018196.11.399e-5138.27SMESG000018196.1[more]
SMESG000010489.16.994e-5035.81SMESG000010489.1[more]
SMESG000029685.12.630e-4636.39SMESG000029685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000705 ID=SMED30000705|Name=Serine/threonine-protein kinase OSR1|organism=Schmidtea mediterranea sexual|type=transcript|length=1651bp
CTATATAAATCTTATATGTAATGATAGATGGTACTGCCCCAGATGCTTCT
CATCCCATCGTGCAATGGCCAAATAACAAGAGTGATTATATTATTAAAGG
ATCTATAGGTCAAGGCGCAACATCAACTGTTTATGAAGCTTCTTGTCCCA
TTTTGAATAATAGAAAATGTGCAATGAAAATAATAAATTTGGAAAAATGC
AGTAGTTCAACGTTATTAGACGAAATTAAAAAAGAAATTAGAGGGATGAG
AAATTTGAAAAACGAAAATATAGTAACTTATTATGCATCTCTTGTAGCTG
GTACAGAGCTTTGTATACTCATGGATTTATGCCAACGAGGATCGTTATTA
GATATTATAAAAGCTACTCAAAATAAACGTGATATCAGTTCTGGGGTTCT
TGATGAAAACACTATAGCTACAATTATGAAAGATGTTCTTAAAGGACTGA
GTTATATTCATGAAAATGGCCTTGTACATAGAGATTTAAAATGTGGCAAT
TTACTTGTCAAAGATGACGCTGTTATTCAAATAGCTGATTTTGGTGTAGC
GGGGTTTCTTGCCGCTAGACCAATGGAAGCAACTGGTATGAGCCTTGATG
ATAAAAGATTTACATTTGTTGGTACTCCTTGCTGGATGGCCCCAGAAGTT
ATGCAACAAGTGAAAGGTTACAATCAAAAAGCGGATATATGGTCAATAGG
AATCACTGTTATTGAAATGGCAACAGGGCAAGCTCCTTATGCTAAATATA
CACCAATGAAAGTTTTGATGCTAACTTTACAAAATGACCCACCAGATATT
GATACAGCTGCTGCTTCTAGTAATCAATATACAAATTATGGCCATAAATA
TAGAAAATTTACCAAAGTATGTCTTTGTAAAGATCCTTCTCAAAGACCTT
CTGCAAAAGAATTACTTCAATCTCCTTTTATAAAATCAAAATCAAGAGAC
AGGGAGTTATTGTCTAAAATGTTGCTCAATTGTGACATTCCACCTGCTCC
AGAAAGAAAAGTTCGTGATGAAAAGCAAGAAAAAAATCCCAAGGATTTCA
GTGGTGAATGGAATTTTGATATCAAGGGAAAAGACGATGACAGTAGCAGT
GGTGACGATCAGCCTGTTCAAAAATCCAAAATATCTGTTACGGAAAACGT
TTTCTATCGAATCACTCTCCGTAAAAGAAATCCTAAACAAAACAACGAAC
TTCAAGATATAAGTTTCAATTATGTACTAGGAAAAGATTCTGTTGATGTT
TTGGCTAGAGAATTAGTTGAAGCTGATTTATTGGATGGATGTGACTTACT
TTTGGTTGCGCACAATTTGAGTGAATTAGTTGCGGAGCCAACGATGAGGG
AGCGTGTTTTTGCTTTGAACTCTCCTCCAGCAAGTGGTGTAATCAGTGAA
GCAGATTTAAATGGTTACGCTAAAGTATTGTTGAGGTTTGCTCATGAAGA
CTTACCAGTCTTGCCGAAAACTTAATTTACTGATAAAATTGTTTATCCAG
CTGTCTAGCTTTTGAAATATCTTATCTAATGAAATATTTCTCTTCTTTGT
TTTGTTTTTATATTATTTTCTTGACAGATATCGTTTCTTTAATAATTGAT
TTTTATTTGGCTTTAACAAATTATTATCTTGATCAATAAACGAAGAGTTA
T
back to top

protein sequence of SMED30000705-orf-1

>SMED30000705-orf-1 ID=SMED30000705-orf-1|Name=SMED30000705-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=485bp
MIDGTAPDASHPIVQWPNNKSDYIIKGSIGQGATSTVYEASCPILNNRKC
AMKIINLEKCSSSTLLDEIKKEIRGMRNLKNENIVTYYASLVAGTELCIL
MDLCQRGSLLDIIKATQNKRDISSGVLDENTIATIMKDVLKGLSYIHENG
LVHRDLKCGNLLVKDDAVIQIADFGVAGFLAARPMEATGMSLDDKRFTFV
GTPCWMAPEVMQQVKGYNQKADIWSIGITVIEMATGQAPYAKYTPMKVLM
LTLQNDPPDIDTAAASSNQYTNYGHKYRKFTKVCLCKDPSQRPSAKELLQ
SPFIKSKSRDRELLSKMLLNCDIPPAPERKVRDEKQEKNPKDFSGEWNFD
IKGKDDDSSSGDDQPVQKSKISVTENVFYRITLRKRNPKQNNELQDISFN
YVLGKDSVDVLARELVEADLLDGCDLLLVAHNLSELVAEPTMRERVFALN
SPPASGVISEADLNGYAKVLLRFAHEDLPVLPKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR024678Kinase_OSR1/WNK_CCT
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 23..304
e-value: 1.8E-72
score: 256.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 25..304
e-value: 3.5E-59
score: 200.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 23..304
score: 45.064
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 12..103
e-value: 2.4E-22
score: 80.8
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 379..472
e-value: 1.4E-20
score: 75.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 104..340
e-value: 1.8E-58
score: 199.2
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 21..303
e-value: 5.5E-27
score: 92.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 326..363
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 325..369
NoneNo IPR availablePANTHERPTHR24361MITOGEN-ACTIVATED KINASE KINASE KINASEcoord: 13..333
NoneNo IPR availablePANTHERPTHR24361:SF807FRAYED, ISOFORM Acoord: 13..333
IPR024678Serine/threonine-protein kinase OSR1/WNK, CCT domainPFAMPF12202OSR1_Ccoord: 383..437
e-value: 1.9E-11
score: 44.0
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 29..53
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 151..163
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 13..320