Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30000699
Length (bp)1714
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30000699) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30000699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30000699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30000699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000699h1SMcG0006904 dd_Smed_v4_6345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000699h1SMcG0006904 dd_Smed_v4_6345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000699h1SMcG0006904 dd_Smed_v4_6345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000699h1SMcG0006904 dd_Smed_v4_6345_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000699h1SMcG0006904 dd_Smed_v4_6345_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermis progenitor cellSMED30000699h1SMcG0006904 dd_Smed_v4_6345_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 86.2705 bits (212), Expect = 5.730e-17
Identity = 87/315 (27.62%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  307 LKSIPEYL--PASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            ++SIP Y      + + L +G +     IS A F    + N+  L L  C++  I   T L   +L+ L+LS N++ LI+P +F GLT L  L L   +   + +N+F  LK                        +LE L L+ NNL  +          L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  + I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  170 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFE--GLVNLRYLNLGMCNLKDIPNLTAL--VRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLK------------------------SLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWL--KETVPSNTT---CCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ-----DTGQYTCMVTNSAGNTT 446          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 86.2705 bits (212), Expect = 5.730e-17
Identity = 87/315 (27.62%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  307 LKSIPEYL--PASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            ++SIP Y      + + L +G +     IS A F    + N+  L L  C++  I   T L   +L+ L+LS N++ LI+P +F GLT L  L L   +   + +N+F  LK                        +LE L L+ NNL  +          L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  + I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  170 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFE--GLVNLRYLNLGMCNLKDIPNLTAL--VRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLK------------------------SLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWL--KETVPSNTT---CCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ-----DTGQYTCMVTNSAGNTT 446          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 86.2705 bits (212), Expect = 5.730e-17
Identity = 87/315 (27.62%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  307 LKSIPEYL--PASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            ++SIP Y      + + L +G +     IS A F    + N+  L L  C++  I   T L   +L+ L+LS N++ LI+P +F GLT L  L L   +   + +N+F  LK                        +LE L L+ NNL  +          L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  + I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  170 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFE--GLVNLRYLNLGMCNLKDIPNLTAL--VRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLK------------------------SLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWL--KETVPSNTT---CCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ-----DTGQYTCMVTNSAGNTT 446          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 83.1889 bits (204), Expect = 6.716e-16
Identity = 74/246 (30.08%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C    C  GI+ C   GL +IP  LP + T++ L        +++G                    I SI P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L +  F GL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           + + ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQ-NLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETSGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 72.0182 bits (175), Expect = 1.875e-12
Identity = 73/271 (26.94%), Postives = 120/271 (44.28%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVELDLFILSNDSAKLSCVTA 1047
            CP++C    C    + C   GL++IP+ +P +T ++ L G+     +I   +F       +  L L+   I ++E   F  M +L+ L L++N++ ++    F +   LS L L EN    + + +F G   +K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI           +C+ P  L    +  +  S + C G      +    LS+ S    C  +
Sbjct:   34 CPALC---TCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNIT--RIHKNDFAGLKQLRV--LQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRG-LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL-------FTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCS 289          

HSP 3 Score: 68.1662 bits (165), Expect = 3.646e-11
Identity = 60/216 (27.78%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+  ++ C    L  IPE +P ST ++ L     +N +IS           I + T +           F ++T L+ ++LS NK+  I+   F G  ++S L L  N+   +R   F GL  ++ L L +  ++ ++ DSF  L  N+  L+L  N +  +     +  +SL  L L  NP +C+C + WL G LR R+ +  + +
Sbjct:  513 CPHKCR---CEANVVECSSLKLTKIPERIPQSTAELRL-----NNNEIS-----------ILEATGM-----------FKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLR-NVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR 697          

HSP 4 Score: 65.0846 bits (157), Expect = 2.629e-10
Identity = 62/249 (24.90%), Postives = 98/249 (39.36%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLV 990
            P   QE AC   ++ C +  L+++P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    L      +I   +                         FAD+                          SL  L +  NPL C C ++WLS  +       K   K+  +ARCA PQD+  KL+       + C G P+L 
Sbjct:  732 PQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQF---TLVPGQLSTFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGI----------------------FADVT-------------------------SLSHLAIGANPLYCDCHLRWLSSWV-------KTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA 921          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 83.1889 bits (204), Expect = 7.108e-16
Identity = 74/246 (30.08%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C    C  GI+ C   GL +IP  LP + T++ L        +++G                    I SI P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L +  F GL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           + + ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQ-NLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETSGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 72.0182 bits (175), Expect = 2.139e-12
Identity = 73/271 (26.94%), Postives = 120/271 (44.28%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVELDLFILSNDSAKLSCVTA 1047
            CP++C    C    + C   GL++IP+ +P +T ++ L G+     +I   +F       +  L L+   I ++E   F  M +L+ L L++N++ ++    F +   LS L L EN    + + +F G   +K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI           +C+ P  L    +  +  S + C G      +    LS+ S    C  +
Sbjct:   34 CPALC---TCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNIT--RIHKNDFAGLKQLRV--LQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRG-LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL-------FTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCS 289          

HSP 3 Score: 67.781 bits (164), Expect = 4.049e-11
Identity = 60/216 (27.78%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+  ++ C    L  IPE +P ST ++ L     +N +IS           I + T +           F ++T L+ ++LS NK+  I+   F G  ++S L L  N+   +R   F GL  ++ L L +  ++ ++ DSF  L  N+  L+L  N +  +     +  +SL  L L  NP +C+C + WL G LR R+ +  + +
Sbjct:  513 CPHKCR---CEANVVECSSLKLTKIPERIPQSTAELRL-----NNNEIS-----------ILEATGM-----------FKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLR-NVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPR 697          

HSP 4 Score: 65.0846 bits (157), Expect = 3.072e-10
Identity = 62/249 (24.90%), Postives = 98/249 (39.36%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLV 990
            P   QE AC   ++ C +  L+++P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    L      +I   +                         FAD+                          SL  L +  NPL C C ++WLS  +       K   K+  +ARCA PQD+  KL+       + C G P+L 
Sbjct:  732 PQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQF---TLVPGQLSTFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLQEGI----------------------FADVT-------------------------SLSHLAIGANPLYCDCHLRWLSSWV-------KTGYKEPGIARCAGPQDMEGKLLLTTPAKKFECQGPPTLA 921          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 62.3882 bits (150), Expect = 7.275e-10
Identity = 63/244 (25.82%), Postives = 109/244 (44.67%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP+ C    C    ++C    L  +P+ +P  T ++ L  +  +  +I   +F+  ++ N+  L L++  I +I   +F  +  LQ L LS+N+I+ +    F + L L+ L L EN    +      G +  ++   D +      ++      +LE LTL  N L   +      FR   +L+L NNP +C C ++W+   L        +K +  N   CATP +L    I +L D    C
Sbjct:   17 CPAEC---VCVDRTVSCVGQQLTEVPQNIPNDTIRLDLQDN--EITKIGPNDFS--SLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLENNVISSWVSLEVLTLNGNRLTTFEEPSNARFR---QLDLFNNPWNCDCRLRWMRKWL--------EKAEGQNKTVCATPLNLQGSSIEILQDKFMTC 242          

HSP 2 Score: 58.151 bits (139), Expect = 1.525e-8
Identity = 74/257 (28.79%), Postives = 110/257 (42.80%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCS---INSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIE-LRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVI-DAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVEL 996
            CP  C    C    + C D GL  +P  LP STT++ L     +  QIS  +   ++  N+  LT L+ S   I  I+P  FL +  L TL L  N I  ++  TF GL    L L     +  +R+ +F                        D +  L  L+L  N+++ I +  F N+  SL  L L  NPL C C+++WL+        I   K  + + ARC  P+ L  K    L  + + C G+ S V +
Sbjct:  260 CPLPC---TCTGTTVDCRDSGLTYVPTNLPPSTTEIRL-----EQNQIS--SIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGSLQLLLLNANQLTCIRRGTF------------------------DHVPKLSMLSLYDNDIKSISEVTFQNL-TSLSTLHLAKNPLICDCNLQWLA-------QINLQKNIETSGARCEQPKRLRKKKFATLPPNKFKCKGSESFVSM 474          

HSP 3 Score: 54.299 bits (129), Expect = 2.755e-7
Identity = 56/234 (23.93%), Postives = 97/234 (41.45%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLI 942
            CP  C   +C   ++ C +  L S P  +P  TT++ L  +  +  +I   +  +  ++++ KL L +  + S+E  TF  +T+L TL +S NK++ +QP  F+GL  L  L L  N    L +++FS L                                                 S+  + + +N L C C+M W S  +       K K  +  +ARC  P  ++N+L+
Sbjct:  677 CPPKC---SCLDRVVRCSNKNLTSFPSRIPFDTTELYLDANYIN--EIPAHDLNR--LYSLTKLDLSHNRLISLENNTFSNLTRLSTLIISYNKLRCLQPLAFNGLNALRILSLHGNDISFLPQSAFSNLT------------------------------------------------SITHIAVGSNSLYCDCNMAWFSKWI-------KSKFIEAGIARCEYPNTVSNQLL 848          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-12 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q9XW74])

HSP 1 Score: 54.6842 bits (130), Expect = 1.152e-7
Identity = 58/193 (30.05%), Postives = 95/193 (49.22%), Query Frame = 1
Query:  304 GLKSIPEYLPASTTKVLLVGHIFDNPQ------ISGANF--TKYAVFNIAKLTLLNCS-INSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGV 849
            GLK I E  P         GH F N Q      ISG     +++   NI +L  L  S +  IEP  F   T+   +    ++   I P TFS L+  S L ++ +K   +  ++FSGL  ++ + L+ C L  ++  +FA+ + NL  L + +N +  +D   + + R+L +  +  N L+CSC MKW++ V
Sbjct:  144 GLKIIFEKTPIHRID----GHTFRNAQNIRELTISGEELALSRHCFANINQLDFLTVSGVVLIEPEIFTNSTRFHVVHFKNSQFD-IPPSTFSTLSHTSHLLIEHSKVPSIAPDAFSGLTTIQVIELHACQLGTISARAFAN-VENLGELKILRNTIGDLDTSESIMSRAL-KTRIEENTLECSCGMKWMTSV 329          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 50.0618 bits (118), Expect = 5.186e-6
Identity = 60/264 (22.73%), Postives = 119/264 (45.08%), Query Frame = 1
Query:  421 NIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIEL-----RKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSR-IMWHFFDTEGYRILQNSMS--QMYNSTIKIKRKYQTDKYFCS 1185
            N+  L + N  I+ ++        QL+TL L+ NKIK+I+      L  L  L L  N+ + +          + L +K+  +   D   L Y  F DL     +L  + N ++ +  K  +   +L    L++NP  C C    +  +L   Q ++ +KK       C  P +L ++ +  ++DS+  C  P+         + +  KL+C  A+N +S+ ++W + + E   +  +S+   +++++ I + RK   +   C+
Sbjct:   53 NVRSLVIRNNRIHKLKRSDLEGFNQLETLVLTHNKIKIIEENVLDHLPELKRLSLAHNELVYIPPLCSDSRPLASLNLKRNHIQFIDEQVLRY--FPDLT----QLDFSHNRIQSLRTKLFDNLPALSHAHLHSNPWHCDCRASKVKALL---QKVKWEKK-----VYCTNPVELRHQALDEVDDSALTCARPAEES-----WTGEEIKLTC--AKNSSSKLVVWMYENVE---VDSSSLDGYEIHDTVITVPRKTNVNFMTCT 292          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-1 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q93377])

HSP 1 Score: 48.9062 bits (115), Expect = 7.898e-6
Identity = 48/181 (26.52%), Postives = 78/181 (43.09%), Query Frame = 1
Query:  421 NIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFA-DLIGNLERLTLTQNNLRVIDAKFTNIFRSLIE---------LELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTN 933
            ++ +L L +CSI+ IEP +  ++  +Q + LS+N+I  I   TFS        L E   ++L  NS + +                 D FA   +  L  L L+ N L  + +    I+ SL++         L + NNP  C  D+ WL   LR    +      +   A+C TP +L+ 
Sbjct:  319 SLIRLELFDCSISRIEPKSLQKVQHIQVILLSRNQITRISHDTFS-------NLPELSELDLSGNSINAV-----------------DDFAFSQLPMLTSLDLSSNRLESLPSNV--IYDSLMQKKTSPVQRKLSIQNNPWRCDKDLMWLRKWLRDNGDVTT-AASNSPPAKCWTPSNLSG 472          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 73.9442 bits (180), Expect = 2.781e-13
Identity = 69/246 (28.05%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNI--ELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP VC   +C    + C   GL S+P  + A   ++ L G+      I   +F +     + +LT  +  I++IE  +F  +  L+ L L+ N++K I P  F   + S LRLD + N+   + +  F G + ++ L L++  +  L+  +F  L+  LE LTL  NNL  +          L  L L++NP  C C + WLS  LR    +           RC +P  L  + +  L+D  + C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLT--VIYETDFQRLTKLRMLQLT--DNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV-ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP-------YTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 72.0182 bits (175), Expect = 9.757e-13
Identity = 66/247 (26.72%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTL---DLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP  C    C   ++ C    LK IP  +PA T+++ L                                 N IE   + R+  L++L   DLS N+I ++  YTF+ LT LS L +  NK   L++++ SGL                         NL  L+L  N + ++        +SL  + L +NPL C C +KW S  +       K    +  +ARCA P+ + +KLI     SS++C
Sbjct:  739 CPPSC---TCTGTVVRCSRNQLKEIPRGIPAETSELYL-------------------------------ESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLN------------------------NLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWI-------KLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 920          

HSP 3 Score: 62.7734 bits (151), Expect = 8.848e-10
Identity = 60/247 (24.29%), Postives = 93/247 (37.65%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGT 978
            +CP++C    C+   + C   GLK IP  +P  TT++LL             N  +    +   L              F R+  L  L+L +N++  I+P  F G + +  L+L ENK  E+    F GL                          L+ L L  N +  +         SL  L L +NP +C+C + W +  LR        K  +   ARC  P  + +  I  L  S + C +
Sbjct:  542 DCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLL-------------NDNELGRISSDGL--------------FGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLH------------------------QLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRK-------KSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSS 727          

HSP 4 Score: 55.8398 bits (133), Expect = 1.073e-7
Identity = 65/246 (26.42%), Postives = 102/246 (41.46%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXX-XXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP  C+   C  GI+ C +  L S+P  LP  TT++ L             NF                 I  + P +F    +L+ +DLS N I  I     SGL  L+ L L  NK  +L    F GL   +L L + +    +  D+F DL           N   + +  F +  +S+  + L  NP  C C+++WL+  L H+  I+         ARC +P+ +  + I  L +  + C
Sbjct:  318 SCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-----------QNF-----------------ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTF-DAMKSIKTVHLAKNPFICDCNLRWLADYL-HKNPIETSG------ARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 72.7886 bits (177), Expect = 6.300e-13
Identity = 69/246 (28.05%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNI--ELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP VC   +C    + C   GL S+P  + A   ++ L G+      I   +F +     + +LT  +  I++IE  +F  +  L+ L L+ N++K I P  F   + S LRLD + N+   + +  F G + ++ L L++  +  L+  +F  L+  LE LTL  NNL  +          L  L L++NP  C C + WLS  LR    +           RC +P  L  + +  L+D  + C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLT--VIYETDFQRLTKLRMLQLT--DNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV-ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP-------YTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 71.633 bits (174), Expect = 1.427e-12
Identity = 66/247 (26.72%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTL---DLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP  C    C   ++ C    LK IP  +PA T+++ L                                 N IE   + R+  L++L   DLS N+I ++  YTF+ LT LS L +  NK   L++++ SGL                         NL  L+L  N + ++        +SL  + L +NPL C C +KW S  +       K    +  +ARCA P+ + +KLI     SS++C
Sbjct:  739 CPPSC---TCTGTVVRCSRNQLKEIPRGIPAETSELYL-------------------------------ESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLN------------------------NLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWI-------KLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 920          

HSP 3 Score: 61.6178 bits (148), Expect = 1.564e-9
Identity = 59/247 (23.89%), Postives = 91/247 (36.84%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGT 978
            +CP++C    C+   + C   GLK IP  +P  TT++LL  +        G                            F R+  L  L+L +N++  I+P  F G + +  L+L ENK  E+    F GL                          L+ L L  N +  +         SL  L L +NP +C+C + W +  LR        K  +   ARC  P  + +  I  L  S + C +
Sbjct:  542 DCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDG---------------------------LFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLH------------------------QLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLR-------KKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSS 727          

HSP 4 Score: 54.6842 bits (130), Expect = 2.596e-7
Identity = 65/246 (26.42%), Postives = 101/246 (41.06%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP  C+   C  GI+ C +  L S+P  LP  TT++ L             NF                 I  + P +F    +L+ +DLS N I  I     SGL  L+ L L  NK  +L    F GL   +L L + +       D+F DL           N   + +  F +  +S+  + L  NP  C C+++WL+  L H+  I+         ARC +P+ +  + I  L +  + C
Sbjct:  318 SCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-----------QNF-----------------ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTF-DAMKSIKTVHLAKNPFICDCNLRWLADYL-HKNPIETSG------ARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330731)

HSP 1 Score: 72.7886 bits (177), Expect = 6.300e-13
Identity = 69/246 (28.05%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNI--ELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP VC   +C    + C   GL S+P  + A   ++ L G+      I   +F +     + +LT  +  I++IE  +F  +  L+ L L+ N++K I P  F   + S LRLD + N+   + +  F G + ++ L L++  +  L+  +F  L+  LE LTL  NNL  +          L  L L++NP  C C + WLS  LR    +           RC +P  L  + +  L+D  + C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLT--VIYETDFQRLTKLRMLQLT--DNQIHTIERNSFQDLVSLERLRLNNNRLKAI-PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV-ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP-------YTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 71.633 bits (174), Expect = 1.427e-12
Identity = 66/247 (26.72%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTL---DLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP  C    C   ++ C    LK IP  +PA T+++ L                                 N IE   + R+  L++L   DLS N+I ++  YTF+ LT LS L +  NK   L++++ SGL                         NL  L+L  N + ++        +SL  + L +NPL C C +KW S  +       K    +  +ARCA P+ + +KLI     SS++C
Sbjct:  739 CPPSC---TCTGTVVRCSRNQLKEIPRGIPAETSELYL-------------------------------ESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLN------------------------NLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWI-------KLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 920          

HSP 3 Score: 61.6178 bits (148), Expect = 1.564e-9
Identity = 59/247 (23.89%), Postives = 91/247 (36.84%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGT 978
            +CP++C    C+   + C   GLK IP  +P  TT++LL  +        G                            F R+  L  L+L +N++  I+P  F G + +  L+L ENK  E+    F GL                          L+ L L  N +  +         SL  L L +NP +C+C + W +  LR        K  +   ARC  P  + +  I  L  S + C +
Sbjct:  542 DCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDG---------------------------LFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLH------------------------QLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLR-------KKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSS 727          

HSP 4 Score: 54.6842 bits (130), Expect = 2.596e-7
Identity = 65/246 (26.42%), Postives = 101/246 (41.06%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP  C+   C  GI+ C +  L S+P  LP  TT++ L             NF                 I  + P +F    +L+ +DLS N I  I     SGL  L+ L L  NK  +L    F GL   +L L + +       D+F DL           N   + +  F +  +S+  + L  NP  C C+++WL+  L H+  I+         ARC +P+ +  + I  L +  + C
Sbjct:  318 SCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-----------QNF-----------------ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTF-DAMKSIKTVHLAKNPFICDCNLRWLADYL-HKNPIETSG------ARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330730)

HSP 1 Score: 71.633 bits (174), Expect = 1.302e-12
Identity = 66/247 (26.72%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTL---DLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP  C    C   ++ C    LK IP  +PA T+++ L                                 N IE   + R+  L++L   DLS N+I ++  YTF+ LT LS L +  NK   L++++ SGL                         NL  L+L  N + ++        +SL  + L +NPL C C +KW S  +       K    +  +ARCA P+ + +KLI     SS++C
Sbjct:  715 CPPSC---TCTGTVVRCSRNQLKEIPRGIPAETSELYL-------------------------------ESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLN------------------------NLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWI-------KLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 896          

HSP 2 Score: 69.3218 bits (168), Expect = 6.563e-12
Identity = 65/244 (26.64%), Postives = 100/244 (40.98%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP VC   +C    + C   GL S+P  + A   ++ L G+      I   +F +     + +LT  +  I++IE  +F  +  L+ LD+S N I  +    F G  +L  L+LD N+   L +++F GL                          LE LTL  NNL  +          L  L L++NP  C C + WLS  LR    +           RC +P  L  + +  L+D  + C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLT--VIYETDFQRLTKLRMLQLT--DNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV------------------------ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP-------YTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 3 Score: 61.6178 bits (148), Expect = 1.517e-9
Identity = 59/247 (23.89%), Postives = 91/247 (36.84%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGT 978
            +CP++C    C+   + C   GLK IP  +P  TT++LL  +        G                            F R+  L  L+L +N++  I+P  F G + +  L+L ENK  E+    F GL                          L+ L L  N +  +         SL  L L +NP +C+C + W +  LR        K  +   ARC  P  + +  I  L  S + C +
Sbjct:  518 DCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDG---------------------------LFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLH------------------------QLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLR-------KKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSS 703          

HSP 4 Score: 54.6842 bits (130), Expect = 2.565e-7
Identity = 65/246 (26.42%), Postives = 101/246 (41.06%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP  C+   C  GI+ C +  L S+P  LP  TT++ L             NF                 I  + P +F    +L+ +DLS N I  I     SGL  L+ L L  NK  +L    F GL   +L L + +       D+F DL           N   + +  F +  +S+  + L  NP  C C+++WL+  L H+  I+         ARC +P+ +  + I  L +  + C
Sbjct:  294 SCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-----------QNF-----------------ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTF-DAMKSIKTVHLAKNPFICDCNLRWLADYL-HKNPIETSG------ARCESPKRMHRRRIESLREEKFKC 500          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330729)

HSP 1 Score: 71.633 bits (174), Expect = 1.410e-12
Identity = 66/247 (26.72%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTL---DLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP  C    C   ++ C    LK IP  +PA T+++ L                                 N IE   + R+  L++L   DLS N+I ++  YTF+ LT LS L +  NK   L++++ SGL                         NL  L+L  N + ++        +SL  + L +NPL C C +KW S  +       K    +  +ARCA P+ + +KLI     SS++C
Sbjct:  715 CPPSC---TCTGTVVRCSRNQLKEIPRGIPAETSELYL-------------------------------ESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLN------------------------NLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWI-------KLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 896          

HSP 2 Score: 69.3218 bits (168), Expect = 7.103e-12
Identity = 65/244 (26.64%), Postives = 100/244 (40.98%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP VC   +C    + C   GL S+P  + A   ++ L G+      I   +F +     + +LT  +  I++IE  +F  +  L+ LD+S N I  +    F G  +L  L+LD N+   L +++F GL                          LE LTL  NNL  +          L  L L++NP  C C + WLS  LR    +           RC +P  L  + +  L+D  + C
Sbjct:   73 CPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLT--VIYETDFQRLTKLRMLQLT--DNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV------------------------ELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAP-------YTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 3 Score: 61.6178 bits (148), Expect = 1.586e-9
Identity = 59/247 (23.89%), Postives = 91/247 (36.84%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGT 978
            +CP++C    C+   + C   GLK IP  +P  TT++LL  +        G                            F R+  L  L+L +N++  I+P  F G + +  L+L ENK  E+    F GL                          L+ L L  N +  +         SL  L L +NP +C+C + W +  LR        K  +   ARC  P  + +  I  L  S + C +
Sbjct:  518 DCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDG---------------------------LFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLH------------------------QLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLR-------KKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSS 703          

HSP 4 Score: 54.6842 bits (130), Expect = 2.546e-7
Identity = 65/246 (26.42%), Postives = 101/246 (41.06%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP  C+   C  GI+ C +  L S+P  LP  TT++ L             NF                 I  + P +F    +L+ +DLS N I  I     SGL  L+ L L  NK  +L    F GL   +L L + +       D+F DL           N   + +  F +  +S+  + L  NP  C C+++WL+  L H+  I+         ARC +P+ +  + I  L +  + C
Sbjct:  294 SCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-----------QNF-----------------ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTF-DAMKSIKTVHLAKNPFICDCNLRWLADYL-HKNPIETSG------ARCESPKRMHRRRIESLREEKFKC 500          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: BX548062.1 (leucine rich repeat and fibronectin type III domain containing 2 [Source:NCBI gene;Acc:797812])

HSP 1 Score: 89.3521 bits (220), Expect = 3.732e-18
Identity = 100/381 (26.25%), Postives = 164/381 (43.04%), Query Frame = 1
Query:  244 CPS--VCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSG--------------------------LKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVI--DAKF----TNI-----FRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQN-SMSQMY-NSTIKIKRKYQTD--KYFCSAHNLNGNSTIEIRIKWPQLYH 1248
            CP   VCQ ++   G L CP  GL  +P  +   T ++ L G+     +I+  +FT      +  LTL   +I+ I+PF+F+ +  L++L L  N++  + P    GL  L  L L+ N+   + K +F                            L + +LSL+   +N +   +F DL   L RL LT N L+ +  D  F    +NI     F  ++ L    NPL C+C++ WL           +  +++D++  CA+P  L  +    + +  ++C  P + +    L +L   +A L C    +    I W   D    R++ N S + +Y N T+ I      D   + C A N  G ST  I +   QL H
Sbjct:   21 CPKYCVCQNLSESLGTL-CPSKGLLFVPPDIDRRTVELRLGGNYII--KITQQDFTNMT--GLVDLTLSRNTISFIQPFSFVDLETLRSLHLDSNRLTELGPDVLRGLVNLQHLILNNNQLTHISKETFDDLLLTLEDLDLSYNNLRGIPWDAIRKMLNLHQLSLDHNLINHIAEGTFTDL-EKLARLDLTSNRLQKLPPDPIFARSQSNIVLSTPFAPVLSLSFGGNPLHCNCEILWL-----------RRLEREDDMETCASPPSLKGRYFWYVREEEFVCEPPLITQHTHKLLVLEGQTASLRCKAVGDPMPFIHWIAPDD---RLISNSSRATVYENGTLDIAITTSKDYGTFTCIAANAAGESTASIELSIIQLPH 381          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrfn2b (leucine rich repeat and fibronectin type III domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-121214-111])

HSP 1 Score: 84.7297 bits (208), Expect = 1.242e-16
Identity = 100/382 (26.18%), Postives = 160/382 (41.88%), Query Frame = 1
Query:  244 CPS--VCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGH-IFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLK--------------------------VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNL----------RVIDAK-FTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNSMSQMY--NSTIKIKRKYQTDK--YFCSAHNLNGNSTIEIRIKWPQLYH 1248
            CP    CQ ++   G L CP  GL  +P  +  ST ++ L G+ I    Q   AN T     ++  LTL   +I+ I+PF+F  +  L++L +  N++  + P    GL +L  L L+ N+   + + +F  L                           + +LSL+   L+ +   +F DL   L RL LT N L          R  D++  T  F   + L +  NPL C+C++ W            +  ++DD+L  CA+P  L  +    + +  ++C  P + +    L  L   +A L C    +    I W    T   R+L NS   +   N T++I      D   + C A NL G ST  + +   QL H
Sbjct:   21 CPKYCACQNLSESLGTL-CPAKGLLFVPSDIDRSTVELRLGGNFILRITQQDFANMT-----DLVDLTLSRNTISYIQPFSFGDLETLRSLHMDNNRLTELGPDDLRGLISLQHLILNNNQLSRVSERAFEDLAATLEDLDLSYNNLQALPWHSVRQMINLHQLSLDHNLLDYIPEGTFVDL-ERLARLDLTSNRLQKLPPDPIFARAQDSEVMTTPFAPQLSLSIGGNPLHCNCELLWF-----------RRLERDDDLETCASPPGLKGRYFWNVREHEFLCEQPLITQHTHKLLALEGQTASLRCDAIGDPIPTIHWV---TPEDRLLGNSSRTVVYRNGTLEILITTSKDSGTFTCIAANLAGESTASVELSIIQLPH 381          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrfn2b (leucine rich repeat and fibronectin type III domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-121214-111])

HSP 1 Score: 84.7297 bits (208), Expect = 1.242e-16
Identity = 100/382 (26.18%), Postives = 160/382 (41.88%), Query Frame = 1
Query:  244 CPS--VCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGH-IFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLK--------------------------VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNL----------RVIDAK-FTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNSMSQMY--NSTIKIKRKYQTDK--YFCSAHNLNGNSTIEIRIKWPQLYH 1248
            CP    CQ ++   G L CP  GL  +P  +  ST ++ L G+ I    Q   AN T     ++  LTL   +I+ I+PF+F  +  L++L +  N++  + P    GL +L  L L+ N+   + + +F  L                           + +LSL+   L+ +   +F DL   L RL LT N L          R  D++  T  F   + L +  NPL C+C++ W            +  ++DD+L  CA+P  L  +    + +  ++C  P + +    L  L   +A L C    +    I W    T   R+L NS   +   N T++I      D   + C A NL G ST  + +   QL H
Sbjct:   21 CPKYCACQNLSESLGTL-CPAKGLLFVPSDIDRSTVELRLGGNFILRITQQDFANMT-----DLVDLTLSRNTISYIQPFSFGDLETLRSLHMDNNRLTELGPDDLRGLISLQHLILNNNQLSRVSERAFEDLAATLEDLDLSYNNLQALPWHSVRQMINLHQLSLDHNLLDYIPEGTFVDL-ERLARLDLTSNRLQKLPPDPIFARAQDSEVMTTPFAPQLSLSIGGNPLHCNCELLWF-----------RRLERDDDLETCASPPGLKGRYFWNVREHEFLCEQPLITQHTHKLLALEGQTASLRCDAIGDPIPTIHWV---TPEDRLLGNSSRTVVYRNGTLEILITTSKDSGTFTCIAANLAGESTASVELSIIQLPH 381          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 83.5741 bits (205), Expect = 2.209e-16
Identity = 80/287 (27.87%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  385 ISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            IS A F    + N+  L L  C +  I   T L   +L+ L+LS N++++I+P +F GL +L  L L  ++   + +N+F  LK                        NLE L L+ N+L  +        + L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  K I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  181 ISDAAFV--GLINLRYLNLGMCGLKDIPNLTPL--VRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLK------------------------NLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWL--KETVPSNTTC---CARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 83.5741 bits (205), Expect = 2.284e-16
Identity = 80/287 (27.87%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  385 ISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            IS A F    + N+  L L  C +  I   T L   +L+ L+LS N++++I+P +F GL +L  L L  ++   + +N+F  LK                        NLE L L+ N+L  +        + L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  K I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  181 ISDAAFV--GLINLRYLNLGMCGLKDIPNLTPL--VRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLK------------------------NLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWL--KETVPSNTTC---CARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 85.1149 bits (209), Expect = 1.438e-16
Identity = 75/246 (30.49%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXX-XYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C    C  GI+ C   GL +IP  LP + T++ L        +++G                    I S+ P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L K  FSGL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           + + ARCA+P+ L NK I  +    + C
Sbjct:  280 SCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSVPPGAFSPYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQDL-QNLSLLSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETSGARCASPRRLANKRIGQIKSKKFRC 486          

HSP 2 Score: 68.1662 bits (165), Expect = 2.698e-11
Identity = 63/212 (29.72%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTI 870
             CP++C    C    + C    LK +P+ +P ST ++ L G+     +I+  +F+      +  L L+   I+++E   F  M +L+ L L++N++  +    F +   LS L L EN    + + +F G  ++K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI
Sbjct:   32 GCPALC---TCSGTTVDCHGLALKGVPKNIPRSTERLELYGNNIT--RINKNDFSGLKQLRV--LQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI 235          

HSP 3 Score: 63.5438 bits (153), Expect = 8.733e-10
Identity = 57/216 (26.39%), Postives = 97/216 (44.91%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C++ ++ C +  L  IP+ +P ST ++ L             N  + A      L              F ++  L+ ++LS NKI  I+   F G  ++S L L  N    +R   F GL+ ++ L L +  ++ ++ DSF  L  N+  L+L  N +  I     +  +SL  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  512 CPPKCR---CESNVVDCSNLKLTKIPDRIPQSTAELRL-------------NNNEIATLEATGL--------------FRKLPHLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLR-NVRLLSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR 696          

HSP 4 Score: 59.6918 bits (143), Expect = 1.105e-8
Identity = 62/248 (25.00%), Postives = 100/248 (40.32%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSL 987
            P   QE  C   ++ C +  L S+P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    LRL     + +  N  S L                                        +  F+++  SL  L +  NPL C C+++WLS  +       K   K+  +ARC  P ++  KL+       + C G PSL
Sbjct:  731 PQCPQECTCLDTVVRCSNKHLLSLPKGIPKNVTELYLDGNQF---TMVPGQLSSFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNSLQCIPPLAFEGL--RSLRL-----LSVHGNDISSLP---------------------------------------EGIFSDV-TSLSHLAIGANPLYCDCNLRWLSNWV-------KTGYKEPGIARCTGPPEMDGKLLLTTPAKKFECNGPPSL 919          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 85.1149 bits (209), Expect = 1.786e-16
Identity = 75/246 (30.49%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXX-XYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C    C  GI+ C   GL +IP  LP + T++ L        +++G                    I S+ P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L K  FSGL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           + + ARCA+P+ L NK I  +    + C
Sbjct:  280 SCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSVPPGAFSPYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQDLQ-NLSLLSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETSGARCASPRRLANKRIGQIKSKKFRC 486          

HSP 2 Score: 68.1662 bits (165), Expect = 3.424e-11
Identity = 63/212 (29.72%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTI 870
             CP++C    C    + C    LK +P+ +P ST ++ L G+     +I+  +F+      +  L L+   I+++E   F  M +L+ L L++N++  +    F +   LS L L EN    + + +F G  ++K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI
Sbjct:   32 GCPALC---TCSGTTVDCHGLALKGVPKNIPRSTERLELYGNNIT--RINKNDFSGLKQLRV--LQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI 235          

HSP 3 Score: 63.1586 bits (152), Expect = 1.025e-9
Identity = 57/216 (26.39%), Postives = 97/216 (44.91%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C++ ++ C +  L  IP+ +P ST ++ L             N  + A      L              F ++  L+ ++LS NKI  I+   F G  ++S L L  N    +R   F GL+ ++ L L +  ++ ++ DSF  L  N+  L+L  N +  I     +  +SL  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  512 CPPKCR---CESNVVDCSNLKLTKIPDRIPQSTAELRL-------------NNNEIATLEATGL--------------FRKLPHLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLR-NVRLLSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR 696          

HSP 4 Score: 59.6918 bits (143), Expect = 1.318e-8
Identity = 58/248 (23.39%), Postives = 97/248 (39.11%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSL 987
            P   QE  C   ++ C +  L S+P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL                                                +L  L++  N++  +     +   SL  L +  NPL C C+++WLS  +       K   K+  +ARC  P ++  KL+       + C G PSL
Sbjct:  731 PQCPQECTCLDTVVRCSNKHLLSLPKGIPKNVTELYLDGNQF---TMVPGQLSSFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNSLQCIPPLAFEGLR-----------------------------------------------SLRLLSVHGNDISSLPEGIFSDVTSLSHLAIGANPLYCDCNLRWLSNWV-------KTGYKEPGIARCTGPPEMDGKLLLTTPAKKFECNGPPSL 919          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 85.1149 bits (209), Expect = 1.800e-16
Identity = 75/246 (30.49%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXX-XYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C    C  GI+ C   GL +IP  LP + T++ L        +++G                    I S+ P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L K  FSGL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           + + ARCA+P+ L NK I  +    + C
Sbjct:  275 SCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSVPPGAFSPYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQDLQ-NLSLLSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETSGARCASPRRLANKRIGQIKSKKFRC 481          

HSP 2 Score: 68.1662 bits (165), Expect = 3.257e-11
Identity = 63/212 (29.72%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTI 870
             CP++C    C    + C    LK +P+ +P ST ++ L G+     +I+  +F+      +  L L+   I+++E   F  M +L+ L L++N++  +    F +   LS L L EN    + + +F G  ++K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI
Sbjct:   32 GCPALC---TCSGTTVDCHGLALKGVPKNIPRSTERLELYGNNIT--RINKNDFSGLKQLRV--LQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI 235          

HSP 3 Score: 63.5438 bits (153), Expect = 9.269e-10
Identity = 57/216 (26.39%), Postives = 97/216 (44.91%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C++ ++ C +  L  IP+ +P ST ++ L             N  + A      L              F ++  L+ ++LS NKI  I+   F G  ++S L L  N    +R   F GL+ ++ L L +  ++ ++ DSF  L  N+  L+L  N +  I     +  +SL  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  503 CPPKCR---CESNVVDCSNLKLTKIPDRIPQSTAELRL-------------NNNEIATLEATGL--------------FRKLPHLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLR-NVRLLSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR 687          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 84.7297 bits (208), Expect = 1.823e-16
Identity = 75/246 (30.49%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXX-XYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C    C  GI+ C   GL +IP  LP + T++ L        +++G                    I S+ P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L K  FSGL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           + + ARCA+P+ L NK I  +    + C
Sbjct:  189 SCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSVPPGAFSPYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQDLQ-NLSLLSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETSGARCASPRRLANKRIGQIKSKKFRC 395          

HSP 2 Score: 63.5438 bits (153), Expect = 8.500e-10
Identity = 57/216 (26.39%), Postives = 97/216 (44.91%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C++ ++ C +  L  IP+ +P ST ++ L             N  + A      L              F ++  L+ ++LS NKI  I+   F G  ++S L L  N    +R   F GL+ ++ L L +  ++ ++ DSF  L  N+  L+L  N +  I     +  +SL  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  417 CPPKCR---CESNVVDCSNLKLTKIPDRIPQSTAELRL-------------NNNEIATLEATGL--------------FRKLPHLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLR-NVRLLSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR 601          

HSP 3 Score: 53.1434 bits (126), Expect = 1.381e-6
Identity = 46/141 (32.62%), Postives = 71/141 (50.35%), Query Frame = 1
Query:  454 INSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTI 870
            I+++E   F  M +L+ L L++N++  +    F +   LS L L EN    + + +F G  ++K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI
Sbjct:    5 ISNVERGAFDDMKELERLRLNRNQLHTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI 144          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 84.7297 bits (208), Expect = 1.993e-16
Identity = 75/246 (30.49%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXX-XYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C    C  GI+ C   GL +IP  LP + T++ L        +++G                    I S+ P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L K  FSGL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           + + ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---TCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSVPPGAFSPYKKLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQDLQ-NLSLLSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETSGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 68.1662 bits (165), Expect = 3.387e-11
Identity = 63/212 (29.72%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTI 870
             CP++C    C    + C    LK +P+ +P ST ++ L G+     +I+  +F+      +  L L+   I+++E   F  M +L+ L L++N++  +    F +   LS L L EN    + + +F G  ++K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI
Sbjct:   33 GCPALC---TCSGTTVDCHGLALKGVPKNIPRSTERLELYGNNIT--RINKNDFSGLKQLRV--LQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI 236          

HSP 3 Score: 63.1586 bits (152), Expect = 1.006e-9
Identity = 57/216 (26.39%), Postives = 97/216 (44.91%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C++ ++ C +  L  IP+ +P ST ++ L             N  + A      L              F ++  L+ ++LS NKI  I+   F G  ++S L L  N    +R   F GL+ ++ L L +  ++ ++ DSF  L  N+  L+L  N +  I     +  +SL  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  509 CPPKCR---CESNVVDCSNLKLTKIPDRIPQSTAELRL-------------NNNEIATLEATGL--------------FRKLPHLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLR-NVRLLSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR 693          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrrc4b (leucine rich repeat containing 4B [Source:MGI Symbol;Acc:MGI:3027390])

HSP 1 Score: 86.6557 bits (213), Expect = 3.010e-17
Identity = 87/315 (27.62%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  307 LKSIPEYL--PASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            ++SIP Y      + + L +G +     IS A F    + N+  L L  C++  I   T L   +L+ L+LS N++ LI+P +F GLT L  L L   +   + +N+F  LK                        +LE L L+ NNL  +          L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  + I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  172 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFE--GLVNLRYLNLGMCNLKDIPNLTAL--VRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLK------------------------SLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWL--KETVPSNTT---CCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ-----DTGQYTCMVTNSAGNTT 448          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 84.3445 bits (207), Expect = 2.206e-16
Identity = 74/246 (30.08%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C   +C +GI+ C   GL +IP  LP + T++ L        +++G                    I SI P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L +  F GL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           +   ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---SCSSGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQ-NLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETTGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 69.3218 bits (168), Expect = 1.077e-11
Identity = 72/268 (26.87%), Postives = 118/268 (44.03%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVELDLFILSNDSAKLSC 1038
            CP++C    C    + C   GL++IP+ +P +T ++ L G+     +I   +F       +  L L+   I ++E   F  M +L+ L L++N+++++    F +   LS L L EN    + + +F G   +K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI           +C+ P  L    +  +    + C G           LS+ S    C
Sbjct:   34 CPALC---TCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNIT--RIHKNDFAGLKQLRV--LQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRALRG-LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL-------FTQCSGPASLRGLNVAEVQKGEFSCSGQGEAAGAPACTLSSGSCPAMC 286          

HSP 3 Score: 67.3958 bits (163), Expect = 3.683e-11
Identity = 61/216 (28.24%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+  ++ C    L  IPE +P STT++ L     +N +IS           I + T L           F +++ L+ ++LS NK+  I+  TF G  ++S L L  N+   +R   F GL  ++ L L +  ++ ++ DSF  L  N+  L+L  N++  I     +  ++L  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  513 CPHKCR---CEASVVECSSLKLSKIPERIPQSTTELRL-----NNNEIS-----------ILEATGL-----------FKKLSHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLR-NVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCHLSWLGDWLRKRKIVTGNPR 697          

HSP 4 Score: 60.8474 bits (146), Expect = 4.617e-9
Identity = 60/249 (24.10%), Postives = 97/249 (38.96%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLV 990
            P   QE AC   ++ C +  L+++P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    L      ++   +                         FAD+                          SL  L +  NPL C C ++WLS  +       K   K+  +ARCA P ++  KL+       + C G PSL 
Sbjct:  732 PQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQF---TLVPGQLSTFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGI----------------------FADVT-------------------------SLSHLAIGANPLYCDCRLRWLSSWV-------KTGYKEPGIARCAGPPEMEGKLLLTTPAKKFECQGPPSLA 921          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 84.3445 bits (207), Expect = 2.276e-16
Identity = 74/246 (30.08%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C   +C +GI+ C   GL +IP  LP + T++ L        +++G                    I SI P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L +  F GL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           +   ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---SCSSGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQ-NLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETTGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 68.9366 bits (167), Expect = 1.316e-11
Identity = 72/268 (26.87%), Postives = 118/268 (44.03%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVELDLFILSNDSAKLSC 1038
            CP++C    C    + C   GL++IP+ +P +T ++ L G+     +I   +F       +  L L+   I ++E   F  M +L+ L L++N+++++    F +   LS L L EN    + + +F G   +K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI           +C+ P  L    +  +    + C G           LS+ S    C
Sbjct:   34 CPALC---TCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNIT--RIHKNDFAGLKQLRV--LQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRALRG-LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL-------FTQCSGPASLRGLNVAEVQKGEFSCSGQGEAAGAPACTLSSGSCPAMC 286          

HSP 3 Score: 67.3958 bits (163), Expect = 4.197e-11
Identity = 61/216 (28.24%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+  ++ C    L  IPE +P STT++ L     +N +IS           I + T L           F +++ L+ ++LS NK+  I+  TF G  ++S L L  N+   +R   F GL  ++ L L +  ++ ++ DSF  L  N+  L+L  N++  I     +  ++L  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  513 CPHKCR---CEASVVECSSLKLSKIPERIPQSTTELRL-----NNNEIS-----------ILEATGL-----------FKKLSHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLR-NVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCHLSWLGDWLRKRKIVTGNPR 697          

HSP 4 Score: 60.8474 bits (146), Expect = 4.619e-9
Identity = 60/249 (24.10%), Postives = 97/249 (38.96%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLV 990
            P   QE AC   ++ C +  L+++P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    L      ++   +                         FAD+                          SL  L +  NPL C C ++WLS  +       K   K+  +ARCA P ++  KL+       + C G PSL 
Sbjct:  732 PQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQF---TLVPGQLSTFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGI----------------------FADVT-------------------------SLSHLAIGANPLYCDCRLRWLSSWV-------KTGYKEPGIARCAGPPEMEGKLLLTTPAKKFECQGPPSLA 921          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 84.3445 bits (207), Expect = 2.385e-16
Identity = 74/246 (30.08%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C   +C +GI+ C   GL +IP  LP + T++ L        +++G                    I SI P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L +  F GL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           +   ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---SCSSGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQ-NLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETTGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 68.9366 bits (167), Expect = 1.336e-11
Identity = 72/268 (26.87%), Postives = 118/268 (44.03%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVELDLFILSNDSAKLSC 1038
            CP++C    C    + C   GL++IP+ +P +T ++ L G+     +I   +F       +  L L+   I ++E   F  M +L+ L L++N+++++    F +   LS L L EN    + + +F G   +K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI           +C+ P  L    +  +    + C G           LS+ S    C
Sbjct:   34 CPALC---TCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNIT--RIHKNDFAGLKQLRV--LQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRALRG-LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL-------FTQCSGPASLRGLNVAEVQKGEFSCSGQGEAAGAPACTLSSGSCPAMC 286          

HSP 3 Score: 67.3958 bits (163), Expect = 3.945e-11
Identity = 61/216 (28.24%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+  ++ C    L  IPE +P STT++ L     +N +IS           I + T L           F +++ L+ ++LS NK+  I+  TF G  ++S L L  N+   +R   F GL  ++ L L +  ++ ++ DSF  L  N+  L+L  N++  I     +  ++L  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  513 CPHKCR---CEASVVECSSLKLSKIPERIPQSTTELRL-----NNNEIS-----------ILEATGL-----------FKKLSHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLR-NVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCHLSWLGDWLRKRKIVTGNPR 697          

HSP 4 Score: 60.4622 bits (145), Expect = 4.861e-9
Identity = 60/249 (24.10%), Postives = 97/249 (38.96%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLV 990
            P   QE AC   ++ C +  L+++P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    L      ++   +                         FAD+                          SL  L +  NPL C C ++WLS  +       K   K+  +ARCA P ++  KL+       + C G PSL 
Sbjct:  732 PQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQF---TLVPGQLSTFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGI----------------------FADVT-------------------------SLSHLAIGANPLYCDCRLRWLSSWV-------KTGYKEPGIARCAGPPEMEGKLLLTTPAKKFECQGPPSLA 921          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 78.9518 bits (193), Expect = 7.696e-15
Identity = 75/245 (30.61%), Postives = 107/245 (43.67%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXX-XXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP+ C    C   I+ C   GL  IP  LP + T++ L  +                            SI  I P  F    +L+ LDLS N+I  + P  F GL +L+ L L  NK  EL K+ F GL   +L L + +  + L  D+F DL  NL  L+L  N L+ +     +  R++  + L  NP  C C +KWL+  L H   I+         ARC +P+ L NK I  +    + C
Sbjct:  273 CPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLEQN----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL-HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYL-HTNPIETSG------ARCTSPRRLANKRIGQIKSKKFRC 478          

HSP 2 Score: 64.6994 bits (156), Expect = 2.005e-10
Identity = 64/246 (26.02%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLD--ENKNIELRKNSFSG-LKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP+ C   +C    + C    L+S+P  +P +T ++ L G+     +I+  +F    + ++  L L+   I++IE   F  + +L+ L L++N ++L     F G T    RLD  EN+   + + +F G + +K L L+   ++ +   +F  L  +LE LTL  NN+  +     N    L    L++N L C C + WLS  LR R  +           +C  P  L    +  +    ++C
Sbjct:   28 CPAQC---SCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNIT--RITKIDFA--GLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLG-TAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRAL-RDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGL-------YTQCMGPSHLRGHNVAEVQKREFVC 257          

HSP 3 Score: 56.6102 bits (135), Expect = 8.544e-8
Identity = 52/214 (24.30%), Postives = 91/214 (42.52%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+   + C +  L  IP+++P  T ++ L  + F   + +G  F K     + K+   N  I  IE   F   + +  + L+ N+++ +Q   F GL       +  K + LR N  S +                 DSF  L G++  L+L  N +  +     +   SL  L L  NP +C+C + WL   LR ++ +  + +
Sbjct:  498 CPEKCR---CEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTVLEATGI-FKKLP--QLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGL-------ESLKTLMLRSNRISCVG---------------NDSFIGL-GSVRLLSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPR 682          

HSP 4 Score: 55.8398 bits (133), Expect = 1.313e-7
Identity = 44/135 (32.59%), Postives = 65/135 (48.15%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFT---FLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKV 636
            CPS C    C   ++ C + GLK +P+ +P   T++ L G+ F              + N   LTL++ S N I   +   F  MTQL TL LS N+++ I P TF GL +L  L L  N    + + +F+ L  
Sbjct:  719 CPSEC---TCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQF--------TLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSA 842          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C192|LRC4B_MOUSE (Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.106e-16
Identity = 87/315 (27.62%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  307 LKSIPEYL--PASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            ++SIP Y      + + L +G +     IS A F    + N+  L L  C++  I   T L   +L+ L+LS N++ LI+P +F GLT L  L L   +   + +N+F  LK                        +LE L L+ NNL  +          L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  + I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  172 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFE--GLVNLRYLNLGMCNLKDIPNLTAL--VRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLK------------------------SLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWL--KETVPSNTT---CCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ-----DTGQYTCMVTNSAGNTT 448          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CC10|LRC4B_RAT (Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.339e-16
Identity = 87/315 (27.62%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  307 LKSIPEYL--PASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            ++SIP Y      + + L +G +     IS A F    + N+  L L  C++  I   T L   +L+ L+LS N++ LI+P +F GLT L  L L   +   + +N+F  LK                        +LE L L+ NNL  +          L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  + I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  172 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFE--GLVNLRYLNLGMCNLKDIPNLTAL--VRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLK------------------------SLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWL--KETVPSNTT---CCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ-----DTGQYTCMVTNSAGNTT 448          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NT99|LRC4B_HUMAN (Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 2.752e-16
Identity = 87/315 (27.62%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  307 LKSIPEYL--PASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            ++SIP Y      + + L +G +     IS A F    + N+  L L  C++  I   T L   +L+ L+LS N++ LI+P +F GLT L  L L   +   + +N+F  LK                        +LE L L+ NNL  +          L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  + I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  170 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFE--GLVNLRYLNLGMCNLKDIPNLTAL--VRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLK------------------------SLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWL--KETVPSNTT---CCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ-----DTGQYTCMVTNSAGNTT 446          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TR4|SLIT1_MOUSE (Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.592e-15
Identity = 74/246 (30.08%), Postives = 114/246 (46.34%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C   +C +GI+ C   GL +IP  LP + T++ L        +++G                    I SI P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L +  F GL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           +   ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---SCSSGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQ-NLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETTGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 68.9366 bits (167), Expect = 9.203e-11
Identity = 72/268 (26.87%), Postives = 118/268 (44.03%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVELDLFILSNDSAKLSC 1038
            CP++C    C    + C   GL++IP+ +P +T ++ L G+     +I   +F       +  L L+   I ++E   F  M +L+ L L++N+++++    F +   LS L L EN    + + +F G   +K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI           +C+ P  L    +  +    + C G           LS+ S    C
Sbjct:   34 CPALC---TCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNIT--RIHKNDFAGLKQLRV--LQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRALRG-LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL-------FTQCSGPASLRGLNVAEVQKGEFSCSGQGEAAGAPACTLSSGSCPAMC 286          

HSP 3 Score: 67.3958 bits (163), Expect = 2.936e-10
Identity = 61/216 (28.24%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+  ++ C    L  IPE +P STT++ L     +N +IS           I + T L           F +++ L+ ++LS NK+  I+  TF G  ++S L L  N+   +R   F GL  ++ L L +  ++ ++ DSF  L  N+  L+L  N++  I     +  ++L  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  513 CPHKCR---CEASVVECSSLKLSKIPERIPQSTTELRL-----NNNEIS-----------ILEATGL-----------FKKLSHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLR-NVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCHLSWLGDWLRKRKIVTGNPR 697          

HSP 4 Score: 60.8474 bits (146), Expect = 3.231e-8
Identity = 60/249 (24.10%), Postives = 97/249 (38.96%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLV 990
            P   QE AC   ++ C +  L+++P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    L      ++   +                         FAD+                          SL  L +  NPL C C ++WLS  +       K   K+  +ARCA P ++  KL+       + C G PSL 
Sbjct:  732 PQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQF---TLVPGQLSTFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGI----------------------FADVT-------------------------SLSHLAIGANPLYCDCRLRWLSSWV-------KTGYKEPGIARCAGPPEMEGKLLLTTPAKKFECQGPPSLA 921          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O88279|SLIT1_RAT (Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.795e-15
Identity = 74/246 (30.08%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXY-DSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            +CP++C   +C  GI+ C   GL +IP  LP + T++ L        +++G                    I SI P  F    +L+ +DLS N+I  I P  F GL +L+ L L  NK  +L +  F GL   +L L + +  +    D+F DL  NL  L+L  N ++ +        R++  L L  NP  C C++KWL+  LR           +   ARCA+P+ L NK I  +    + C
Sbjct:  281 SCPAMC---SCSNGIVDCRGKGLTAIPANLPETMTEIRL--------ELNG--------------------IKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQ-NLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------ETTGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 2 Score: 73.559 bits (179), Expect = 3.184e-12
Identity = 73/268 (27.24%), Postives = 121/268 (45.15%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLVELDLFILSNDSAKLSC 1038
            CP++C    C    + C   GL++IP+ +P +T ++ L G+     +I   +F       +  L L+   I ++E   F  M +L+ L L++N+++++    F +   LS L L EN    + + +F G   +K L L+   ++ +   +F  L G LE LTL  NN+  I     N    L    L++N L C C + WLS  LR R TI           +C+ P  L    +  +  S + C G     ++    LS+ S    C
Sbjct:   34 CPALC---TCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNIT--RIHKNDFAGLKQLRV--LQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENSLQAVPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRG-LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGL-------FTQCSGPASLRGLNVAEVQKSEFSCSGQGEAAQVPACTLSSGSCPAMC 286          

HSP 3 Score: 68.5514 bits (166), Expect = 1.191e-10
Identity = 62/216 (28.70%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKK 885
            CP  C+   C+  ++ C    L  IPE +P STT++ L     +N +IS           I + T L           F +++ L+ ++LS NK+  I+  TF G T +S L L  N+   +R   F GL  ++ L L +  ++ ++ DSF  L  N+  L+L  N++  I     +  ++L  L L  NP +C+C + WL   LR R+ +  + +
Sbjct:  513 CPHKCR---CEASVVECSGLKLSKIPERIPQSTTELRL-----NNNEIS-----------ILEATGL-----------FKKLSHLKKINLSNNKVSEIEDGTFEGATSVSELHLTANQLESVRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLR-NVRLLSLYDNHITTISPGAFDTLQALSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPR 697          

HSP 4 Score: 61.2326 bits (147), Expect = 2.353e-8
Identity = 60/249 (24.10%), Postives = 97/249 (38.96%), Query Frame = 1
Query:  247 PSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC-GTPSLV 990
            P   QE AC   ++ C +  L+++P+ +P + T++ L G+ F    +     + +    +  L+  N  I+S+   +F  M+QL TL LS N ++ I P  F GL    L      ++   +                         FAD+                          SL  L +  NPL C C ++WLS  +       K   K+  +ARCA P ++  KL+       + C G PSL 
Sbjct:  732 PQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQF---TLVPGQLSTFKYLQLVDLS--NNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDVSTLQEGI----------------------FADVT-------------------------SLSHLAIGANPLYCDCHLRWLSSWV-------KTGYKEPGIARCAGPPEMEGKLLLTTPAKKFECQGPPSLA 921          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.302e-73
Identity = 177/462 (38.31%), Postives = 261/462 (56.49%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAV--FNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVL--RHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSR--IMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWP--------QLYHKTTYYPTGVNKKLPHPS---YDKDFFFQRQFTLLEMIXXXXXXXXXXXXXXXXIYRCFIQKHRKESRKRKL--YETVIYSDSQTYDIPHQP---YYPIHAYQT--SPAHYLDF 1557
            CPSVC EMAC+TG+L C DGGL  IP  L   T K+++    F +P ++ +NF+ Y    + I K+ L  C + SI    F  +T L+ LDLS N +  I P TF  L L FLRLD+NK I+  + SF GL V +LSL DC+L +L+++ F+++   L++L LT N L VID +F  +F +L +L++N NP +C+C+++WL+ VL  R +       K+  N A+C  P  +  K I  L+   + C +P L  +D+F+ S  SAKL+C++    +S   ++W    TE        +  +  +++ + RK + DKY C   N N   T+ I I WP        Q  +     P  +   LP+ +   + +  F+++QFTLLEMIGGVVGTFT T++LFL IYR      ++  +K+    YET I SDSQTYDIP+     Y+P        SPA YLD+
Sbjct:   26 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWM---TEHKNTYVPEIQSIEKASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGVVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDY 484          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: I1ZIL5 (Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 2.014e-56
Identity = 164/473 (34.67%), Postives = 246/473 (52.01%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNI--AKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLAR-----CATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWHF---FDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYYPTG-----VNK----------KLPHPSYDK---DFFFQRQFTLLEMIXXXXXXXXXXXXXXXXIYRCFIQKHRKESRKR---KLYETVIYSDSQTYDIPHQPYYPIHAYQTSPAHYLDFKNPQ 1569
            CP +C + ACK  +L C   GL  IP   P    KV+L    F  P+++  N ++Y    I   KLT+ NCS+ SIE   F  +  LQ LDLS N++  I P TF  L+L  L LD N+N++L K+SF GL V+ LS+ DC L  L ++S   + G L  L L  N L  +   F  +FR L  L L NN  +CSC +KWL+  L+ R T ++D     +L R     C  P++L    I  L+  S+ C  P L  +D+ + S  +A++SC++    NS++ W +        YR   +  S +  ++I + +K + D Y C   N NGN+T++I+IKWP L  +    P       VN+           +    +DK   ++ + +Q+T +EM+  + GTF  TL+ F+L+Y   I   RK SR +   K YE  +YS+SQTYD+P    Y    ++++    LDFK  Q
Sbjct:   35 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNLFNCSCQLKWLALTLQTR-TKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYR-YPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLY-VVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPY----HESNTGRLLDFKTQQ 500          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A2H1CUL7 (Leucine Rich repeat-containing domain protein OS=Fasciola hepatica OX=6192 GN=D915_01256 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 9.469e-38
Identity = 113/405 (27.90%), Postives = 183/405 (45.19%), Query Frame = 1
Query:  268 ACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYA--VFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGN--LERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQK------------DKKKDDNLAR--CATPQDLTNKLIHLLNDSSYICGTPSLVELDLFI-----------LSNDSAKLSCVTARNQNS-----RIMWH--------------FF-----------------DTEGYRILQ--NSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYYPTGVNK 1281
             C  G L+C +GGL  +P+ L      ++L+GH F+   ++  NFT Y      + ++TL NC I  I+P +F  +  L+ LDLS+N+I  I+  TF+GL L +LRLDEN  + L   +F+   +  LS+N C +  + Y+  A L+ +  L  L L+ N L  ++ +   +F  L  L L+ NP  C C + WL+ VL+ RQ  +K            D   D +L R  C  P  L  + +  L    + CG P L  L++FI           L N  ++   VT R Q S     ++ W+              F+                 D    R++Q   S+S  ++      +    ++  C A + +GN + E+R++WP L  +      G+ K
Sbjct:    4 GCMAGSLSCQEGGLTGLPDELAKDIQSMILIGHRFEGSALARHNFTSYPHQTKVLQRITLRNCGIERIQPGSFEPIQSLKQLDLSQNQINFIEAGTFAGLRLDYLRLDENHRLHLAPGAFNDASIVSLSMNQCGIESITYEDLAPLLRHHVLTTLHLSGNRLVTLENRMEPVFLELQSLSLDQNPFYCDCRLSWLAEVLQRRQIRRKSRALKQDSIMGPDAPLDSDLPRPTCRAPDRLAGRPLETLTTEDFFCGLPQLKNLEVFIEEYKEAGENQKLVNSVSQPLAVTLRCQVSGSPEMKLAWYRRSIFSPTVTSQLEFYNELDHLSKLLSSRAVSSDVAEIRLIQPSPSISSKHDPISSKSQSSALEQLVCMATDTSGNISAEVRLQWPPLSFRGQKSLGGMPK 408          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4E0RLI5 (Immunoglobulin superfamily member 10 OS=Fasciola hepatica OX=6192 GN=D915_000869 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.516e-36
Identity = 113/405 (27.90%), Postives = 183/405 (45.19%), Query Frame = 1
Query:  268 ACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYA--VFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGN--LERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQK------------DKKKDDNLAR--CATPQDLTNKLIHLLNDSSYICGTPSLVELDLFI-----------LSNDSAKLSCVTARNQNS-----RIMWH--------------FF-----------------DTEGYRILQ--NSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYYPTGVNK 1281
             C  G L+C +GGL  +P+ L      ++L+GH F+   ++  NFT Y      + ++TL NC I  I+P +F  +  L+ LDLS+N+I  I+  TF+GL L +LRLDEN  + L   +F+   +  LS+N C +  + Y+  A L+ +  L  L L+ N L  ++ +   +F  L  L L+ NP  C C + WL+ VL+ RQ  +K            D   D +L R  C  P  L  + +  L    + CG P L  L++FI           L N  ++   VT R Q S     ++ W+              F+                 D    R++Q   S+S  ++      +    ++  C A + +GN + E+R++WP L  +      G+ K
Sbjct:   43 GCMAGSLSCQEGGLTGLPDELAKDIQSMILIGHRFEGSALARHNFTSYPHQTKVLQRITLRNCGIERIQPGSFEPIQSLKQLDLSQNQINFIEAGTFAGLRLDYLRLDENHRLHLAPGAFNDASIVSLSMNQCGIESITYEDLAPLLRHHVLTTLHLSGNRLVTLENRMEPVFLELQSLSLDQNPFYCDCRLSWLAEVLQRRQIRRKSRALKQDSIMGPDAPLDSDLPRPTCRAPDRLAGRPLETLTTEDFFCGLPQLKNLEVFIEEYKEAGENQKLVNSVSQPLAVTLRCQVSGSPEMKLAWYRRSIFSPTVTSQLEFYNELDHLSKLLSSRAVSSDVAEIRLIQPSPSISSKHDPISSKSQSSALEQLVCMATDTSGNISAEVRLQWPPLSFRGQKSLGGMPK 447          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A504YFT2 (Immunoglobulin superfamily member 10 OS=Fasciola gigantica OX=46835 GN=FGIG_05500 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 8.899e-36
Identity = 115/407 (28.26%), Postives = 185/407 (45.45%), Query Frame = 1
Query:  268 ACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYA--VFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGN--LERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQK------------DKKKDDNLAR--CATPQDLTNKLIHLLNDSSYICGTPSLVELDLFI-----------LSNDSAKLSCVTARNQNS-----RIMWH--------------FF-----------------DTEGYRILQNSMSQMYNSTIKIKRKYQT---DKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYYPTGVNKK 1284
             C  G L+C +GGL  +P+ L      ++L+GH F+   ++  NFT Y      + ++TL NC I  I+P +F  +  L+ LDLS+N+I  I+  TF+G  L +LRLDEN  + L   +F+   +  LS+N C +  + Y+  A L+ +  L  L L+ N L  ++ +   +F  L  L L+ NP  C C + WL+ VL+ RQ  +K            D   D +L R  C  P  L  + +  L    + CG P L  L++FI           L N  ++   VT R Q S     ++ W+              F+                 D    R++Q S S + +    I  K Q+   ++  C A + +GN + E+R++WP L  +      G+ K+
Sbjct:   43 GCMAGSLSCQEGGLTGLPDELAKDIQSMILIGHRFEGSALARHNFTSYPHQTKVLQRITLRNCGIERIQPGSFEPIQSLKQLDLSQNQISFIEAGTFAGSRLDYLRLDENHRLHLAPGAFNDASIVSLSMNQCGIESITYEDLAPLLRHHVLTTLHLSGNRLVTLENRMEPVFLELQSLSLDQNPFYCDCRLSWLAEVLQRRQIRRKSRALKQDSMMGPDAPLDSDLPRPTCRAPDRLAGRPLETLTTEDFFCGLPQLKNLEVFIEEYKEAGETQELVNSVSQPLAVTLRCQVSGSPEMKLAWYRRSIFNPTVTSQLEFYNELNHLSKLLSSRAVSSDVAEIRLIQPSPS-ISSKHDPISSKSQSSVLEQLVCMATDTSGNISAEVRLQWPPLSFRGQKSLGGMPKR 448          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: LRFN2 (leucine-rich repeat and fibronectin type-III domain-containing protein 2-like [Source:NCBI gene;Acc:103041514])

HSP 1 Score: 89.7373 bits (221), Expect = 2.432e-18
Identity = 96/381 (25.20%), Postives = 163/381 (42.78%), Query Frame = 1
Query:  244 CPS--VCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSG--------------------------LKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVI-----------DAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQN-SMSQMY-NSTIKIKRKYQTD--KYFCSAHNLNGNSTIEIRIKWPQLYH 1248
            CP   VCQ ++   G L CP  GL  +P  +   T ++ L G+     +IS  +F      ++  LTL   +I+SI+PF+F+ +  L++L L  N++  + P    GL  L  L L+ N+   + + +F                            L + +LSL+   ++ +   +F DL   L RL LT N L+ +           +A  +  +  ++ L    NPL C+C++ WL           +  +++D++  CA+P  L  +    + +  +IC  P + +    L +L   +A L C    +    I W   D    R++ N S + +Y N T+ I      D   + C A N  G ST  I +   QL H
Sbjct:   21 CPKYCVCQNLSESLGTL-CPSKGLLFVPLDIDRRTVELRLGGNYII--RISQQDFVNMT--SLVDLTLSRNTISSIQPFSFVDLETLRSLHLDSNRLTELGPDALRGLVNLQHLILNNNQLNRISEEAFDDLLLTLEDLDLSYNNLRGVPWDAIRKMLSLHQLSLDHNLISYIAEGTFTDL-DKLARLDLTSNRLQKLPPDPIFARSQTNAVLSTPYAPVLSLSFGGNPLHCNCEVLWL-----------RRLEREDDMETCASPPSLKGRYFWYVREEEFICEPPLITQHTHKLLVLEGQTASLRCKAVGDPMPYIHWVAPDD---RLISNSSRATVYENGTLDIMVTTAKDYGTFTCIAANAAGESTASIELSIIQLPH 381          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrfn4b (leucine rich repeat and fibronectin type III domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-070705-473])

HSP 1 Score: 83.5741 bits (205), Expect = 2.037e-16
Identity = 95/382 (24.87%), Postives = 158/382 (41.36%), Query Frame = 1
Query:  244 CP--SVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSG-LTLSFLRLDENKNIELRKNSFSG--LKVKKLSXXXXXXXXXXYD------------------------SFADLIGNLERLTLTQNNLRVI--DAKFT---------NIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNS--MSQMYNSTIKIKRKYQTD--KYFCSAHNLNGNSTIEIRIKWPQLYHK 1251
            CP   VC+ ++     L C D GL  +P  +   T ++ L  +     ++ GA+F    +  +  LTL   +IN I+P  F  +  L++L L  N++  + P    G L L  L L+ N+ I +  ++F    L ++ L L+  +L    +D                        SF++L   L RL +T N L+ +  D  F            + S++ L    NPL C+C++ WL  ++R            D++  CATP  L  +    + +  +IC  P +      L++L    A L C    +    + W   D    RI+ NS   +   N T+++      D   Y C A N  G +T  I +K   L H+
Sbjct:  116 CPFHCVCRNLSESLSTL-CADKGLLFVPPNIDRRTVELRLADNFIR--EVGGADFAN--MTGLVDLTLSRNTINFIKPMAFGDLESLRSLHLDGNRLMSLGPRDLMGMLNLQHLILNNNQLINISSDAFDDFLLTLEDLDLSYNNLRKAPWDAIQNMASLHTLNLDHNLIDQIAEGSFSELY-KLARLDMTSNRLQTLPPDPLFARSQTGVISPTPYNSVVSLNFGGNPLHCNCELLWLRRLIR-----------SDDMETCATPIHLAGRYFWSIPEEEFICEPPLITRHTHKLWVLEGQRATLKCRAIGDPEPVVHWVSPDD---RIIANSSRTTSFRNGTLELLVTVARDDGAYTCIAINAAGEATAVIDLKVIPLPHR 477          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 81.6481 bits (200), Expect = 7.923e-16
Identity = 79/287 (27.53%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  385 ISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            IS A F    + N+  L L  C +  I   T L   +L+ L+LS N++++I+P +F GL +L  L L  ++   + +N+F  LK                        +LE L L+ N+L  +        + L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  K I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  168 ISDAAFV--GLINLRYLNLGMCGLKDIPNLTPL--VRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIERNAFDDLK------------------------SLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWL--KETVPSNTTC---CARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR-----DTGQYTCMVTNSAGNTT 416          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 81.6481 bits (200), Expect = 8.353e-16
Identity = 79/287 (27.53%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  385 ISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            IS A F    + N+  L L  C +  I   T L   +L+ L+LS N++++I+P +F GL +L  L L  ++   + +N+F  LK                        +LE L L+ N+L  +        + L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  K I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  181 ISDAAFV--GLINLRYLNLGMCGLKDIPNLTPL--VRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIERNAFDDLK------------------------SLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWL--KETVPSNTTC---CARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 81.6481 bits (200), Expect = 8.353e-16
Identity = 79/287 (27.53%), Postives = 124/287 (43.21%), Query Frame = 1
Query:  385 ISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQ--------NSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNST 1212
            IS A F    + N+  L L  C +  I   T L   +L+ L+LS N++++I+P +F GL +L  L L  ++   + +N+F  LK                        +LE L L+ N+L  +        + L  + LN+NP  C+CD+ WLS  L  ++T+  +       ARC  P  L  K I  L+ S + C  P +VE   DL +    +A+L C T  +         N  +M H        +L +      N T++      T +Y C   N  GN+T
Sbjct:  181 ISDAAFV--GLINLRYLNLGMCGLKDIPNLTPL--VRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIERNAFDDLK------------------------SLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWL--KETVPSNTTC---CARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 70.8626 bits (172), Expect = 3.353e-13
Identity = 84/295 (28.47%), Postives = 125/295 (42.37%), Query Frame = 1
Query:  433 LTLLNCSINSIEPFTFLRMTQLQTLDLSK-NKIKLIQPYTFSGLT-----------------------LSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLN-DSSYICGTPSLVEL---DLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNS----MSQMYNSTIKIKRKYQTDK--YFCSAHNLNGNST 1212
            L L N  I  I  +TF R+  LQ LDL +  K++ I    F GL+                       L  L L  N+   LR  SF GL  ++KL +   ++  +  ++F D + +L+ L L  N+L  +     +  + L  + L++NP  C CD+ WLS  LR     +         ARCA P D   K I+L   DSS     P L+E+   D+ I    +A+L C  A +  S + W      G  +   S    +S +++ T+        D   Y C   N  GNST
Sbjct:  108 LWLRNNPIEDISAYTFTRIPSLQRLDLGELTKLQFISNEAFEGLSNLRYLNLGMCNLREVPKLSPLVRLEELELSGNRIEILRPGSFQGLANLRKLWIMHSEVRLVERNAF-DELQSLKELNLAHNSLMSLPHDLFSPLQKLERVHLHHNPWTCDCDILWLSWWLR-----ENVPNNATCCARCALPAD--RKAINLWELDSSRFTCYPPLIEVPPSDVNISEGMAAELRC-RAPSSASSVTW--ITPNGTSMTHGSYKIRISVLHDGTLNFTNVTVQDTGIYTCLVANSVGNST 391          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrfn5a (leucine rich repeat and fibronectin type III domain containing 5a [Source:ZFIN;Acc:ZDB-GENE-080327-17])

HSP 1 Score: 64.3142 bits (155), Expect = 3.846e-11
Identity = 78/332 (23.49%), Postives = 128/332 (38.55%), Query Frame = 1
Query:  454 INSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLE------------------------------------------------RLTLTQNNLRVI--DAKFTNI---------FRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELD--LFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNSMSQMY--NSTIKIKRKYQTDK--YFCSAHNLNGNSTIEIRIKWPQLYH 1248
            I S+    F  MT +  L LS+N I  I PY F+ L+ L+FL  D N+   +   SF GL  ++ L +++  L+D++  +F D + +LE                                                RL +T N L+ +  D  FT +             + L    NPL C+C++ WL  + R           +D+L  CA+PQ L  K    + +  ++C  P +      L +L    A L C    + +  + W   D    +++ N+   +   N T++I      D   + C A N  G ST  + +    L H
Sbjct:   63 ITSVRRQDFGNMTLMVDLTLSRNTISQIAPYAFADLSSLTFLHFDYNRLTHIGNKSFKGLSNLRHLIISNNQLSDISVGAFDDFLMSLEDLDLAYNNLEKVPWEAIQKMTSLHTLSLDHNMIDYIEAGTFSHLHKLARLDMTSNKLQKLPPDPLFTRLQLFANKGIHHTPPLVLNFGGNPLHCNCELLWLRRLTR-----------EDDLETCASPQALVGKYFWSIPEEEFVCEPPLITRHTHRLLVLEGQRATLKCKAIGDPDPWVHWISPDE---KVISNTTRTVVHDNGTLEILVTTTKDDGTFTCIASNPAGESTTFVELSIIHLPH 380          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000079.1 (pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-1 gene:ENSPMAG00000000071.1 transcript:ENSPMAT00000000079.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 6.268e-11
Identity = 71/252 (28.17%), Postives = 106/252 (42.06%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLL---------------------VGHIFDNP-----------------QISGANFTKYAVFN----IAKLTLLNCSINS--IEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLK-VKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHR 861
            +CP+VC+   C +G + C D GL ++P  LP   T + L                     V +++DN                  Q +       AV      + KL L + S++S  IEP TF    +L+ L LS+N +  +      GL    LRLD+N+   +    F  L  + +L+L+D  ++ L    F  L   L+R+ L+ N LR +     N   SL  L   NNP  C C + WL   LR R
Sbjct:   10 SCPAVCR---CNSGFIYCNDRGLTAVPSGLPRDATTIYLQNNRITNAGLPAMLQALSSVEVLYLYDNQLEEFPAHLPPNLRELHLQENNIEVVPGAVLERTPFLEKLHLNDNSVSSAGIEPATFHGTPRLKLLFLSRNHLSSVPRGLPRGL--EELRLDDNRISRIPDRIFGQLTYLSRLALDDNQISRLPPGVFYGL-KQLQRIDLSGNGLRSLSQGSFNGLESLSHLSACNNPWHCDCGLTWLRNWLRSR 255          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003392.1 (pep scaffold:Pmarinus_7.0:GL476560:299294:319002:1 gene:ENSPMAG00000003104.1 transcript:ENSPMAT00000003392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.354e-10
Identity = 51/169 (30.18%), Postives = 73/169 (43.20%), Query Frame = 1
Query:  493 QLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVEL 996
             L  +DLS N I  I  +TFS +T LS L L  N+   L   +F+GLK  +L                        L+L  N++ +I     +   SL  L L +NPL C C M+WLS  +       K   K+  +ARC+ P D+  KL+       + C  P  V +
Sbjct:   19 HLSFIDLSNNHISTIANFTFSNITQLSTLILSYNRLRCLPLRAFAGLKTLRL------------------------LSLHGNDVSMIPHGVFSDLTSLSHLALGSNPLHCDCAMRWLSDWV-------KVDYKEPGIARCSGPGDMAEKLLLTTPSKKFECVGPPDVSI 156          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 62.003 bits (149), Expect = 1.862e-10
Identity = 53/189 (28.04%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  421 NIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENK---NIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            N+ +L L +  +  +    F+ +  LQ+L L+ N I  I    F GL+ L  L L  N+    +E  + +F+GL  + KLSL+   +  +   +F  L   L +L L  N +  I A   N  + L +++LN + L C C +KWL G L  R   Q           CA P  L  + +  +   +++C
Sbjct:  140 NLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLGGNQISWTVEDMQGAFTGLSALSKLSLHGNQIKSIAKKAFVGL-ERLGQLDLMGNAIVSIQANAFNTLKLLHQMKLNTSELLCDCQLKWLPGWLTERGFAQSVA------VACAHPAWLKGRSVLSVRQENFVC 321          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 60.4622 bits (145), Expect = 1.079e-9
Identity = 54/190 (28.42%), Postives = 88/190 (46.32%), Query Frame = 1
Query:  427 AKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFS--GLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLV 990
            + LT L    N +      R   +  LDL  N +++ +   F GL+L  LRLD NK  E+   +F+  G  +++L ++   L+++  D   DL   +ERL L +NN+  I        + L ++ L+ NPL C C + WL  VL  RQ   +          CA+P  +  +    L+  S++C     V
Sbjct:  193 STLTELRLRSNILRRVAIKRRFNITLLDLGDNLLEVFEVDAFDGLSLRKLRLDGNKLDEI-PEAFAKVGHFLQELDMSGNYLHEITSDQLLDLHA-IERLDLNENNISKIRIGALRGMKKLRQISLSGNPLSCDCRLVWLKHVLDSRQ--DQLHLSSPQSTTCASPASVKGQTFLGLDARSFLCTCAQCV 378          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 56.9954 bits (136), Expect = 1.550e-8
Identity = 63/239 (26.36%), Postives = 97/239 (40.59%), Query Frame = 1
Query:  433 LTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYT---FSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLV-ELDLF-----ILSNDSAKLSC---VTARNQNS-RIMWHFFDTEGYRIL 1107
            L L N  I  I   +F  +  L+ LDLS N I          F GLT L+ LRLD N+   +   +F GL+                        N++ L L+ N +  I          L +L LN + L C C +KW    LR R + +   +     ARC  PQ L  K +  +   +++C T + + ++ +       +  D+  L C   V  RN +S R+ W      GY ++
Sbjct:  375 LNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLE------------------------NIKYLNLSANIITSIQENSFQGMDKLQKLWLNTSQLMCDCKIKWFGSWLRSRPSTRHTVR-----ARCLHPQTLYMKSVFNITPDAFVCDTSNPIPQISVHPPSQKAMRGDNVTLRCRVQVVQRNSSSVRLQWRL----GYEVI 580          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: LRFN2 (leucine-rich repeat and fibronectin type-III domain-containing protein 2 [Source:NCBI gene;Acc:101169650])

HSP 1 Score: 85.8853 bits (211), Expect = 3.760e-17
Identity = 95/381 (24.93%), Postives = 162/381 (42.52%), Query Frame = 1
Query:  244 CPS--VCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSG--------------------------LKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVI--DAKFTNIFRSLI---------ELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQN-SMSQMY-NSTIKIKRKYQTD--KYFCSAHNLNGNSTIEIRIKWPQLYH 1248
            CP   VCQ ++   G L CP  GL  +P  +   T ++ L G+     +I+  +F       +  LTL   +I++I+PF+F+ +  L++L L  N++  + P    GL  L  L L+ N+   + K +F                            + + ++SL+   ++ +   +F DL   L RL LT N L+ +  D  F     S+I          L L  NPL C+C++ WL           +   ++D++  CA+P +L  +    + +  ++C  P + +    L +L   +A L C    +    + W   D    R++ N S + +Y N T+ I      D   + C A N  G ST  I +   QL H
Sbjct:   21 CPKYCVCQNLSESLGTL-CPAKGLLFVPPDIDRRTVELRLGGNFIL--KITTQDFANMT--GLVDLTLSRNTISTIQPFSFIDLETLRSLHLDSNRLTELGPDDLRGLINLQHLILNNNQLGRISKTAFDDLLLTLEDLDLSYNNLRSVPWEAVRKMVNLHQMSLDHNLISFIAEGTFTDL-EKLARLDLTSNRLQKLPPDPIFARSQSSMIMSTPYAPPLSLSLGGNPLHCNCEVLWL-----------RRLDREDDMETCASPTNLKGRYFWSVREEEFVCEPPLITQHTHKLLVLEGQTASLRCKAIGDPMPTVHWVAPDD---RLISNSSRATVYDNGTLDITVTTSKDYGTFTCIAANAAGESTASIELSIIQLPH 381          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrfn4b (leucine-rich repeat and fibronectin type-III domain-containing protein 4 [Source:NCBI gene;Acc:105356388])

HSP 1 Score: 83.1889 bits (204), Expect = 1.490e-16
Identity = 92/377 (24.40%), Postives = 157/377 (41.64%), Query Frame = 1
Query:  244 CP--SVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSG--LKVKKLSXXXXXXXXXXYDSFAD------------LIGN-----------LERLTLTQNNLRVI--DAKFTNI-----FRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE--LDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNS--MSQMYNSTIKIKRKYQTD--KYFCSAHNLNGNSTIEIRIKWPQLYHK 1251
            CP   VC+ ++     L C D GL  +P ++   T ++ L  +     ++ G +F   +   +  LTL   +I+ I P  F  +  L++L L  N++  I P   +GL  L  L ++ N+ +++   +F    L ++ L L+  +L  + ++S  +            LI N           L RL +T N LR +  D  FT       + ++I L    NPL C+C++ WL           +   + D++  CATP  L  +    + +  + C  P +      L++L    A L C    +    + W   D    RI+ NS   S   N T+ +      D   Y C A N  G +T  + +K   L H+
Sbjct:   14 CPFHCVCRNLSESLSTL-CADKGLLFVPPHVDRRTVELRLADNFIT--EVGGNDFVNMS--GLVDLTLSRNTIHLIRPMAFADLESLRSLHLDGNRLTTIGPRDLAGLVNLQHLIINNNQLVKVSTQAFDDFLLTLEDLDLSYNNLRKVPWESIQNMASLHTLNLDHNLIDNIAEGVFGELYKLARLDMTSNRLRTLPPDPLFTGAISPTPYNAVISLNFGGNPLHCNCELLWL-----------RRLARGDDMETCATPAHLAARYFWTIPEEEFTCEPPLITRHTHKLWVLEGQRATLKCRAIGDPEPVVHWVSPDD---RIVANSSRTSSFSNGTLDMLVTVARDDGAYTCIAINAAGEATATVDLKIIPLPHR 371          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrfn2b (leucine-rich repeat and fibronectin type-III domain-containing protein 2 [Source:NCBI gene;Acc:101157661])

HSP 1 Score: 81.6481 bits (200), Expect = 7.519e-16
Identity = 94/379 (24.80%), Postives = 163/379 (43.01%), Query Frame = 1
Query:  244 CPS--VCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVG-HIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENK-----------------NIELRKNSFSGL---------KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVI--DAKFTNI---------FRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVEL--DLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNSMSQMY-NSTIKIKRKYQTDK--YFCSAHNLNGNSTIEIRIKWPQL 1242
            CP   VCQ ++   G L CP  GL  +P  +  ST ++ L G +I    Q   AN +     ++  LTL   +I+ I+PF+F  +  L++L L  N++  I    F GL  L  L L+ N+                 +++L  N+   L          + +LS +   L  +   +FADL   LER+ L  N L+ +  D  F              + + L L  NPL C+C+M WL           +   ++++L  CA+P  L  +    + +  ++C  P  ++    + +L   +A L C    + +  I  H+   +   +  +S +Q+Y N T++I      D   + C A N+ G +T  + +   Q+
Sbjct:   21 CPKYCVCQNLSESLGTL-CPSKGLLFVPSDIDRSTVELRLGGNYILHITQQDFANMS-----DLVDLTLSRNTISYIQPFSFSDLETLRSLHLDNNRLTKIGSDDFRGLVNLQHLVLNNNQLGRIHDKAFEDPMGALEDLDLSYNNLVSLPWNSVRQMVNLHQLSADHNLLEFIPEGTFADL-EMLERVDLASNRLQKLPPDPIFARAQDLPTLSTPETAQLSLSLGGNPLHCNCEMLWL-----------RRLDRENDLETCASPPPLKGRHFWDVKEEEFVCQPPLFIQQTHKVVVLEGQTATLRCEATGDPSPAI--HWISPDDLLLGNSSRTQVYRNGTMRIPITSSKDHGIFTCIAANVAGETTASVEVSIRQI 379          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit3 (slit homolog 3 protein [Source:NCBI gene;Acc:101170687])

HSP 1 Score: 82.0333 bits (201), Expect = 8.092e-16
Identity = 67/252 (26.59%), Postives = 106/252 (42.06%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVEL 996
             CP VC    C   ++ C + GL+S+P+ +P  TT++ L G++  +     A   + ++ +++     N SI+++ P+TF  MTQL TL LS N+I     + F GL                                                +L  LTL  N+L  I     N   SL  L L  NPL C+CD++WLS  +       K   K+  +ARC  P D+ ++L+     + + C  P  + L
Sbjct:  723 GCPDVC---TCSDAVVRCSNRGLRSLPKGIPKDTTELYLEGNMLTSVPKELAALKQLSLVDLS-----NNSISTLAPYTFSNMTQLATLILSYNQIHCFPVHAFDGLK-----------------------------------------------SLRLLTLHGNDLSTIPEGAFNHLTSLSHLALGANPLYCNCDLRWLSQWV-------KAGFKEPGIARCTGPADMADRLLLTTPLNRFQCKGPVDINL 912          

HSP 2 Score: 69.3218 bits (168), Expect = 8.881e-12
Identity = 73/245 (29.80%), Postives = 103/245 (42.04%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGL-TLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXX-XYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYIC 972
            CP  C   +C   I+ C   GL  IP  LP    ++ L  ++                            I SI    F    +L+ +DLSKN+I  I    F+GL +L+ L L  NK  EL K  F GL   +L L + +  +    ++F DL  NL  L+L  N L+ I        RS+  L L  NP  C C +KWL+  L        D   + + ARC+ P+ L NK I  +    + C
Sbjct:  279 CPPSC---SCNNNIVDCRRKGLLEIPANLPEGIVEIRLEQNL----------------------------IKSIPAGAFSPYKKLKRIDLSKNQISDIAADAFNGLRSLTSLVLYGNKITELPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQ-NLSLLSLYDNKLQTISKGLFTPLRSIKTLHLAQNPFMCDCHLKWLADYLF-------DNPIETSGARCSHPRRLANKRISQVKGKKFRC 484          

HSP 3 Score: 53.5286 bits (127), Expect = 6.132e-7
Identity = 67/254 (26.38%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVF-NIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTF-SGLTLSFLRLDENKNIELRKNSFSGL-KVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVE 993
             CP  C   +C    + C   GLK++P+ +P +  ++ L     +   I+      +A F N+  L L +  I+ IE   F  +  L+ L L++NK++ +    F S   L  + L EN+   + + +F G+  VK L L+   ++ +   +F  L  +LE LTL  NN+ +I     N    L  L L++N L C C + WLS  LR R+ +           +C +P  +    +  +    ++C  P   E
Sbjct:   31 GCPHKC---SCSGSHVDCQGLGLKTVPKGVPRNAERLDL-----NRNNITRITKVDFAGFKNLRILHLEDNQISVIERGAFQDLRLLERLRLNRNKLQFLPELLFQSNPKLGRVDLSENQIQAVPRKAFRGITGVKNLQLDSNHISCIEDGAFRALR-DLEILTLNNNNITLIPLSSFNHMPKLRTLRLHSNNLHCDCHLAWLSDWLRARRGLAP-------FTQCMSPAHMRGLNVPDVQKKDFVCSGPPQTE 268          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc24 (leucine-rich repeat-containing protein 24 [Source:NCBI gene;Acc:101166166])

HSP 1 Score: 80.1073 bits (196), Expect = 2.017e-15
Identity = 78/289 (26.99%), Postives = 134/289 (46.37%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNP--QISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLT-LSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKK-----DDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELD---LFILSNDSAKLSCVTARNQNSRIMW 1074
            +CPS C+   C +  + C   G+K +P  +P+ T  + L     DN   QI   + T   + ++  L L N SI+++EP  FL   QL  L L+ N I L+ P  F GL  L  L L  N+   ++ ++F GL+  +      +  +L  +     + +L  L L++N+LR + A F     SL  L +  NP  C C + WL      R  I +D ++     +     C+ P  L++  +  +  +S +C  P +V+L+   L +   +S ++SC  +      + W
Sbjct:   23 SCPSGCR---CYSLTVECGSLGIKEVPHGIPSITETIFLQ----DNTIVQIRLQDLT--GLESLHYLYLQNNSISALEPGAFLNQGQLLELALNGNLIHLVTPDMFQGLEHLRILYLAGNQITRIQDHTFRGLQRLQELHLQENSIELLAEHALSGLSSLALLDLSKNHLRTLGASFLKPLVSLQVLRVTENPWRCDCALAWL------RTWISEDGQRLLSSAEQRRLMCSEPPRLSHLSLAEVAPNSLVC-IPPVVQLEPSHLTVRLGESLRVSCQASGYPQPLVTW 295          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000035909.1 (SMESG000035909.1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 484/485 (99.79%), Postives = 485/485 (100.00%), Query Frame = 1
Query:  139 DRLITQSLQYHRPMSIQQILYXXXXXXXXXXXXXNCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYYPTGVNKKLPHPSYDKDFFFQRQFTLLEMIXXXXXXXXXXXXXXXXIYRCFIQKHRKESRKRKLYETVIYSDSQTYDIPHQPYYPIHAYQTSPAHYLDFKNPQLVNNPHIL 1593
            DRLITQSLQYHRPMSIQQILYIISIFSIDFIFSDNCPSVCQEMACKTGILTCPDGGLKSIPE+LPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSLNDCDLNDLNYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYYPTGVNKKLPHPSYDKDFFFQRQFTLLEMIGGVVGTFTGTLLLFLLIYRCFIQKHRKESRKRKLYETVIYSDSQTYDIPHQPYYPIHAYQTSPAHYLDFKNPQLVNNPHIL
Sbjct:   25 DRLITQSLQYHRPMSIQQILYIISIFSIDFIFSDNCPSVCQEMACKTGILTCPDGGLKSIPEFLPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSLNDCDLNDLNYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYYPTGVNKKLPHPSYDKDFFFQRQFTLLEMIGGVVGTFTGTLLLFLLIYRCFIQKHRKESRKRKLYETVIYSDSQTYDIPHQPYYPIHAYQTSPAHYLDFKNPQLVNNPHIL 509          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026559.1 (SMESG000026559.1)

HSP 1 Score: 253.062 bits (645), Expect = 3.817e-77
Identity = 176/462 (38.10%), Postives = 260/462 (56.28%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAV--FNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVL--RHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSR--IMWHFFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWP--------QLYHKTTYYPTGVNKKLPHPS---YDKDFFFQRQFTLLEMIXXXXXXXXXXXXXXXXIYRCFIQKHRKESRKRKL--YETVIYSDSQTYDIPHQP---YYPIHAYQT--SPAHYLDF 1557
            CPSVC EMAC+TG+L C DGGL  IP  L   T K+++    F +P ++ +NF+ Y    + I K+ L  C + SI    F  +T L+ LDLS N +  I P TF  L L FLRLD+NK I+  + SF GL V +LSL DC+L +L+++ F+++   L++L LT N L VID +F  +F +L +L++N NP +C+C+++WL+ VL  R +       K+  N A+C  P  +  K I  L+   + C +P L  +D+F+ S  SAKL+C++    +S   ++W     E        +    N+++ + RK + DKY C   N N   T+ I I WP        Q  +     P  +   LP+ +   + +  F+++QFTLLEMIGG+VGTFT T++LFL IYR      ++  +K+    YET I SDSQTYDIP+     Y+P        SPA YLD+
Sbjct:   26 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWM---AEHRNTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDY 484          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026986.1 (SMESG000026986.1)

HSP 1 Score: 235.343 bits (599), Expect = 1.219e-70
Identity = 154/465 (33.12%), Postives = 254/465 (54.62%), Query Frame = 1
Query:  241 NCPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNI--AKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWHFFDTEGYRI--LQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKT------------TYYPTGVNKKLPHPSYDKDFFFQRQFTLLEMIXXXXXXXXXXXXXXXXIYRCFIQKHR----KESRKRKLYETVIYSDSQTYDIPHQPYYPIHAYQTSPAHYLDFKNPQLV 1575
            NCP +C + +C  G L C D GL+ IPE  P  TT+V++   IF NP +   N ++Y    I    LT+ NC +  IE  +F  +  L  +DLS N++++I P TF  L L  L+L+ N+ ++L  NSF GL V  LSL +C L+ L +DS  ++ G+L R  L+QN+L+ ++ +F  +F+ L E++L  N L C C +KWL+ +L+ +    + K   ++L +C+ P ++  K I  L +S ++C  P+L  + + I S  SA L C ++ N ++++ WH  +   Y +  L++ +   +N++IK+ +  Q+D + C   N NGN ++++ IKWP+   +T            T         +P  +   ++ + +QFT LEMI  +  TF  T + F LIY C  ++      K+S  +  Y+  IYSD+Q YD P     P   +Q S A  +DFK  +L+
Sbjct:   20 NCPVLCNQNSCTYGFLFCVDIGLEMIPENPPPKTTQVIVKNQIFKNPILGYKNLSRYGTEEILLKVLTIQNCGLTEIESESFSHLVHLMEMDLSFNQLQMIYPRTFKALNLKSLKLNGNRLLKLTGNSFQGLVVSSLSLANCGLDSLEFDSIKEIAGHLIRFDLSQNDLKSLNFRFYLLFKRLEEIQLGGNQLKCDCRIKWLNRILKSK---NQSKASIESLIKCSQPYEIRGKAISQLEESQFLCSKPNLKAISVDI-STRSAILYCSSSPNSDTQVSWHLRNAVNYSLHKLEDLIETPFNASIKVNKNSQSDMFSCIVKNENGNVSVDLNIKWPENTSETLTDKGHPILLFSTPSNNSSTSIIPQTT---NYLYIKQFTFLEMIISIGSTFVVTTITFSLIYLCLSRRLNISIGKQSPCKIGYQGGIYSDTQIYDSPRYS-TPNKTFQQS-AQLIDFKTQRLI 475          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000001734.1 (SMESG000001734.1)

HSP 1 Score: 230.72 bits (587), Expect = 1.892e-68
Identity = 166/488 (34.02%), Postives = 261/488 (53.48%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNP-QISGANFTKYAV--FNIAKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCS-CDMKWLSGVLRHRQTIQKDKKKDDNL---ARCATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWHFFD---------TEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGN-STIEIRIKWPQLYHKTTYYPTGVNKK---------LPHPSYDKDFFFQRQFTLLEMIXXXXXXXXXXXXXXXXIYRCFIQKHR-------------------KESRKRKL-YETVIYSDSQTYDIPHQPYYPIHAYQTSPAHYLDFKNPQ 1569
            CP VC +MAC  GILTC + GL  IP+ +P  T K+LL+   F     ++  N + Y+     I K+T+ NCS+ +IE   F ++  L+TLDLS NK+  ++P+TF+ L L FLRLD N N++L  NSF  L+V  LSL  C L+ L +     +   L +L LT N    +++++  +F+ L    L++N  DCS C + W++  +  +    K++ KD       +C  P  L +K IH L+ S + C  PS+ ++ +FIL N++A+L C  +  Q+S I    F+          +  +IL NS    +++ + I +    D + C+  +L GN S+  ++I WP+  +KT +     + +         +P   Y K++FFQ QF+L+EMI GVVGTF  TL++F+ + RC   + R                   K+ RK+ + YE  +YSDSQTYDIP  P       Q++  H++DFK  Q
Sbjct:   39 CPPVCNQMACNMGILTCSETGLSEIPKLIPPKTNKILLINQDFSEAGTLTRLNLSDYSSKKHKITKITIQNCSLQAIESRAFSQIIYLETLDLSFNKLTELEPFTFADLNLKFLRLDGNLNLKLTANSFKELRVDSLSLLGCHLSHLPFTVLEPISTGLIQLILTSNRFTTLESRYETLFQRLSRFGLDDNRFDCSQCSLIWMANTM--KSIYYKNQNKDQQTIIYPKCHQPYKLKDKFIHSLSSSDFQCPKPSIEKISIFILPNNTAQLICTASDVQSSVIWSQVFEPNDKDFLLIEQRKQILSNS---AHSNKLVINKNQDIDVFLCTVTSLIGNASSTRLQISWPK--YKTQFRLLNNSHRNVWNDPLTPMPGEKYPKNYFFQPQFSLIEMISGVVGTFIATLIVFITMLRCIFYRIRLFSKNSQLRDHQLSLTSSKKDKRKQYMTYEPPVYSDSQTYDIPTLP-----VNQSTLGHFIDFKTQQ 514          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000033458.1 (SMESG000033458.1)

HSP 1 Score: 222.631 bits (566), Expect = 1.194e-65
Identity = 165/473 (34.88%), Postives = 247/473 (52.22%), Query Frame = 1
Query:  244 CPSVCQEMACKTGILTCPDGGLKSIPEYLPASTTKVLLVGHIFDNPQISGANFTKYAVFNI--AKLTLLNCSINSIEPFTFLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSGLKVKKLSXXXXXXXXXXYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFRSLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLAR-----CATPQDLTNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWHF---FDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRIKWPQLYHKTTYY-----PTGVNK----------KLPHPSYDK---DFFFQRQFTLLEMIXXXXXXXXXXXXXXXXIYRCFIQKHRKESRKR---KLYETVIYSDSQTYDIPHQPYYPIHAYQTSPAHYLDFKNPQ 1569
            CP +C + ACK  +L C   GL  IP   P    KV+L    F  P+++  N ++Y    I   KLT+ NCS+ SIE   F  +  LQ LDLS N++  I P TF  L+L  L LD N+N++L K+SF GL V+ LS+ DC L  L ++S   + G L  L L  N L  +   F  +FR L  L L NNP +CSC +KWL+  L+ R T ++D     +L R     C  P++L    I  L+  S+ C  P L  +D+ + S  +A++SC++    NS++ W +        YR   +  S +  ++I + +K + D Y C   N NGN+T++I+IKWP L  +         P  VN+           +    +DK   ++ + +Q+T +EM+  + GTF  TL+ F+L+Y   I   RK SR +   K YE  +YS+SQTYD+P    Y    ++++    LDFK  Q
Sbjct:   35 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTR-TKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYR-YPDQNSGLNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPIKSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLY-VVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPY----HESNTGRLLDFKTQQ 500          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC4B5.730e-1727.62leucine rich repeat containing 4B [Source:HGNC Sym... [more]
LRRC4B5.730e-1727.62leucine rich repeat containing 4B [Source:HGNC Sym... [more]
LRRC4B5.730e-1727.62leucine rich repeat containing 4B [Source:HGNC Sym... [more]
SLIT16.716e-1630.08slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT17.108e-1630.08slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slt-17.275e-1025.82Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
lron-121.152e-730.05ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
pxn-15.186e-622.73Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
lron-17.898e-626.52ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sli2.781e-1328.05gene:FBgn0264089 transcript:FBtr0330734[more]
sli6.300e-1328.05gene:FBgn0264089 transcript:FBtr0330733[more]
sli6.300e-1328.05gene:FBgn0264089 transcript:FBtr0330731[more]
sli1.302e-1226.72gene:FBgn0264089 transcript:FBtr0330730[more]
sli1.410e-1226.72gene:FBgn0264089 transcript:FBtr0330729[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX548062.13.732e-1826.25leucine rich repeat and fibronectin type III domai... [more]
lrfn2b1.242e-1626.18leucine rich repeat and fibronectin type III domai... [more]
lrfn2b1.242e-1626.18leucine rich repeat and fibronectin type III domai... [more]
lrrc4ba2.209e-1627.87leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba2.284e-1627.87leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slit11.438e-1630.49slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.786e-1630.49slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.800e-1630.49slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.823e-1630.49slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.993e-1630.49slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc4b3.010e-1727.62leucine rich repeat containing 4B [Source:MGI Symb... [more]
Slit12.206e-1630.08slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Slit12.276e-1630.08slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Slit12.385e-1630.08slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Slit27.696e-1530.61slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C192|LRC4B_MOUSE2.106e-1627.62Leucine-rich repeat-containing protein 4B OS=Mus m... [more]
sp|P0CC10|LRC4B_RAT2.339e-1627.62Leucine-rich repeat-containing protein 4B OS=Rattu... [more]
sp|Q9NT99|LRC4B_HUMAN2.752e-1627.62Leucine-rich repeat-containing protein 4B OS=Homo ... [more]
sp|Q80TR4|SLIT1_MOUSE1.592e-1530.08Slit homolog 1 protein OS=Mus musculus OX=10090 GN... [more]
sp|O88279|SLIT1_RAT2.795e-1530.08Slit homolog 1 protein OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4L01.302e-7338.31PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
I1ZIL52.014e-5634.67Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A2H1CUL79.469e-3827.90Leucine Rich repeat-containing domain protein OS=F... [more]
A0A4E0RLI52.516e-3627.90Immunoglobulin superfamily member 10 OS=Fasciola h... [more]
A0A504YFT28.899e-3628.26Immunoglobulin superfamily member 10 OS=Fasciola g... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRFN22.432e-1825.20leucine-rich repeat and fibronectin type-III domai... [more]
lrfn4b2.037e-1624.87leucine rich repeat and fibronectin type III domai... [more]
lrrc4ba7.923e-1627.53leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba8.353e-1627.53leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba8.353e-1627.53leucine-rich repeat-containing protein 4B-like [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ba3.353e-1328.47leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrfn5a3.846e-1123.49leucine rich repeat and fibronectin type III domai... [more]
ENSPMAT00000000079.16.268e-1128.17pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-... [more]
ENSPMAT00000003392.11.354e-1030.18pep scaffold:Pmarinus_7.0:GL476560:299294:319002:1... [more]
lrig31.862e-1028.04leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO471091.079e-928.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481791.550e-826.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRFN23.760e-1724.93leucine-rich repeat and fibronectin type-III domai... [more]
lrfn4b1.490e-1624.40leucine-rich repeat and fibronectin type-III domai... [more]
lrfn2b7.519e-1624.80leucine-rich repeat and fibronectin type-III domai... [more]
slit38.092e-1626.59slit homolog 3 protein [Source:NCBI gene;Acc:10117... [more]
lrrc242.017e-1526.99leucine-rich repeat-containing protein 24 [Source:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035909.10.000e+099.79SMESG000035909.1[more]
SMESG000026559.13.817e-7738.10SMESG000026559.1[more]
SMESG000026986.11.219e-7033.12SMESG000026986.1[more]
SMESG000001734.11.892e-6834.02SMESG000001734.1[more]
SMESG000033458.11.194e-6534.88SMESG000033458.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000699 ID=SMED30000699|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1714bp
ACGAATTTTAATTTAACTAGTTATTTATAACTCTCAAAAGGAAACTGTTG
AATGATTCAAATTTCCTTGCGATACAAAATTATCGATTGGATTCTTAATT
ACTCATTTTGTGGTTCTGGTTTATTTATACATTATTAGGATAGATTAATT
ACCCAATCCCTGCAATATCATCGACCAATGTCAATTCAACAGATACTGTA
CATTATTTCCATATTTTCAATTGACTTTATCTTTTCGGATAATTGTCCGA
GTGTTTGCCAGGAAATGGCATGCAAAACTGGAATTTTAACTTGCCCAGAC
GGAGGACTGAAAAGTATTCCAGAATACCTGCCAGCTTCTACTACCAAAGT
GTTATTAGTTGGTCACATATTTGACAATCCGCAAATAAGTGGTGCCAATT
TCACGAAATACGCCGTATTTAACATTGCTAAGCTTACTCTACTTAATTGT
TCTATCAATTCAATTGAGCCCTTCACCTTTTTGCGCATGACCCAGCTGCA
AACTCTCGATTTGTCAAAAAACAAAATCAAACTTATCCAGCCGTATACTT
TCAGTGGTTTAACTCTCAGCTTTCTCAGATTAGATGAAAATAAAAATATT
GAGCTGAGAAAAAATTCTTTTTCCGGTTTAAAAGTGAAAAAGCTAAGCCT
CAATGACTGTGATTTGAATGATTTGAACTACGACAGTTTTGCGGACTTGA
TTGGCAATTTAGAGAGACTGACTCTAACGCAAAACAATTTACGCGTAATC
GACGCAAAATTCACAAATATATTCCGTTCCCTGATTGAATTAGAATTGAA
TAACAATCCGTTAGATTGTTCTTGTGACATGAAGTGGCTCTCAGGGGTTT
TGAGGCACCGGCAAACTATTCAGAAAGACAAAAAGAAGGATGACAATCTC
GCTAGATGCGCTACGCCGCAGGATTTGACGAATAAATTAATTCATTTATT
AAATGATTCGAGTTATATTTGTGGGACGCCTAGTTTGGTGGAGCTTGATT
TGTTTATTCTCTCAAACGACAGTGCGAAATTGAGTTGTGTCACGGCTAGA
AATCAGAACTCACGAATCATGTGGCATTTCTTTGACACTGAAGGCTATCG
GATTCTCCAGAACTCTATGTCTCAAATGTATAATTCTACGATTAAAATTA
AACGAAAATACCAGACCGATAAATATTTCTGTTCAGCCCACAACCTGAAC
GGCAATTCAACGATTGAAATCCGTATCAAATGGCCGCAATTATATCACAA
AACCACTTACTATCCAACAGGTGTAAATAAGAAACTCCCACATCCTTCTT
ATGACAAAGATTTTTTCTTCCAACGCCAGTTCACACTGTTGGAAATGATC
GGCGGAGTCGTTGGAACCTTCACTGGAACTTTGCTGTTGTTTCTGTTGAT
ATACAGGTGCTTCATTCAAAAGCACCGGAAAGAAAGCCGGAAAAGGAAAT
TATATGAAACAGTAATTTATTCCGACTCTCAAACCTATGACATTCCACAC
CAGCCTTATTATCCGATTCATGCCTACCAAACCAGTCCAGCACATTATTT
AGACTTCAAAAACCCTCAATTGGTGAACAATCCTCATATTCTCTAGATCC
ACTGAAGGGGCGATCATTATTATTATTAATTTTAATCGTTCTTTTTCTTA
ATGTTTTTCTATTTTGTAAATATCGATAAAATTTATTAATACATCAGATT
AACCTAGAAAAAAA
back to top

protein sequence of SMED30000699-orf-1

>SMED30000699-orf-1 ID=SMED30000699-orf-1|Name=SMED30000699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MSIQQILYIISIFSIDFIFSDNCPSVCQEMACKTGILTCPDGGLKSIPEY
LPASTTKVLLVGHIFDNPQISGANFTKYAVFNIAKLTLLNCSINSIEPFT
FLRMTQLQTLDLSKNKIKLIQPYTFSGLTLSFLRLDENKNIELRKNSFSG
LKVKKLSLNDCDLNDLNYDSFADLIGNLERLTLTQNNLRVIDAKFTNIFR
SLIELELNNNPLDCSCDMKWLSGVLRHRQTIQKDKKKDDNLARCATPQDL
TNKLIHLLNDSSYICGTPSLVELDLFILSNDSAKLSCVTARNQNSRIMWH
FFDTEGYRILQNSMSQMYNSTIKIKRKYQTDKYFCSAHNLNGNSTIEIRI
KWPQLYHKTTYYPTGVNKKLPHPSYDKDFFFQRQFTLLEMIGGVVGTFTG
TLLLFLLIYRCFIQKHRKESRKRKLYETVIYSDSQTYDIPHQPYYPIHAY
QTSPAHYLDFKNPQLVNNPHIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR000483Cys-rich_flank_reg_C
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 210..266
e-value: 1.1E-6
score: 38.3
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 104..127
e-value: 0.0097
score: 25.1
coord: 175..197
e-value: 42.0
score: 8.1
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 142..267
e-value: 9.2E-18
score: 66.1
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 19..141
e-value: 3.2E-15
score: 57.7
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 82..139
e-value: 1.7E-10
score: 40.5
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 201..222
score: 5.248
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 106..127
score: 7.635
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 82..103
score: 5.918
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 177..198
score: 5.687
NoneNo IPR availablePANTHERPTHR45842:SF11coord: 22..350
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 22..350
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 23..268
NoneNo IPR availableTMHMMTMhelixcoord: 391..413
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 268..351
score: 7.268
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 268..350