Protein king tubby

Overview
NameProtein king tubby
Smed IDSMED30000692
Length (bp)1988
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein king tubby (SMED30000692) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein king tubby (SMED30000692) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein king tubby (SMED30000692) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein king tubby (SMED30000692) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000692

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000692h1SMcG0012587 dd_Smed_v4_11228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30000692h1SMcG0012587 Contig42550uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000692h1SMcG0012587 Contig42550newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000692h1SMcG0012587 Contig17665uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000692h1SMcG0012587 Contig17665newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein king tubby vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 381.333 bits (978), Expect = 8.163e-125
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  256 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 512          
BLAST of Protein king tubby vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 380.948 bits (977), Expect = 8.668e-125
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  250 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 506          
BLAST of Protein king tubby vs. Ensembl Human
Match: TUB (TUB bipartite transcription factor [Source:HGNC Symbol;Acc:HGNC:12406])

HSP 1 Score: 380.563 bits (976), Expect = 5.879e-124
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  305 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 561          
BLAST of Protein king tubby vs. Ensembl Human
Match: TULP3 (TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12425])

HSP 1 Score: 354.755 bits (909), Expect = 1.411e-115
Identity = 174/288 (60.42%), Postives = 221/288 (76.74%), Query Frame = 2
Query:  899 PKIESDENPGSVDTANSLTVSFPDSRL-----DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            P   S +N     T+ S T + P   L     DLE+FV  PA Q VT++CRI RDKRG+D+G++PTYY++L++++ +++FLLAAR+RKKS T+NYLIS D  DL R+G+SY+GKLRSN +GT F VYD G+ P   +        R+EL+AI+Y+TNVLGFKGPRKM+VIIPGM  +H++I +Q + + D L+  W+ + M NL+ELHNK PVWN DTQSYVLNF GRVTQASVKNFQIVH ND DYIVMQFGRV++D FT+DY+YPLCA+QAFGI LSSFDSKLACE
Sbjct:  155 PNSASSQNSTDTGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE 442          
BLAST of Protein king tubby vs. Ensembl Human
Match: TULP3 (TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12425])

HSP 1 Score: 342.043 bits (876), Expect = 8.412e-110
Identity = 168/282 (59.57%), Postives = 215/282 (76.24%), Query Frame = 2
Query:  899 PKIESDENPGSVDTANSLTVSFPDSRL-----DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFD 1726
            P   S +N     T+ S T + P   L     DLE+FV  PA Q VT++CRI RDKRG+D+G++PTYY++L++++ +++FLLAAR+RKKS T+NYLIS D  DL R+G+SY+GKLRSN +GT F VYD G+ P   +        R+EL+AI+Y+TNVLGFKGPRKM+VIIPGM  +H++I +Q + + D L+  W+ + M NL+ELHNK PVWN DTQSYVLNF GRVTQASVKNFQIVH ND DYIVMQFGRV++D FT+DY+YPLCA+QAFGI LSSFD
Sbjct:  155 PNSASSQNSTDTGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFD 436          
BLAST of Protein king tubby vs. Ensembl Celegans
Match: tub-1 (Tubby protein homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09306])

HSP 1 Score: 291.582 bits (745), Expect = 7.606e-92
Identity = 148/263 (56.27%), Postives = 197/263 (74.90%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHL---DRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGM-----NQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            +L +FV  PA+++   KC I+R K GVDKG++PTY+LHL   D D  +++FLLAAR+RKKSTT+NYL+S D T+L R+G+ Y  K+RSN LGT F VYD+G NP   T  A   +R+EL+A+ Y+TNVLGFKGPRKMT+++PG+     N+   R   +  +D+  L+E ++   + +L  L NK+P WND+TQSYVLNFHGRVTQASVKNFQI+H +  +YIVMQFGR+S+D FTMD+ YPL A+QAFGIA++SF  KLACE
Sbjct:  166 NLAKFVEDPAVEHCLYKCSITRQKSGVDKGMFPTYFLHLEEFDTDKRQKIFLLAARKRKKSTTANYLLSTDPTNLSREGEGYCAKVRSNALGTQFTVYDSGQNPKKTTNHA--AIRQELAAVIYETNVLGFKGPRKMTIVMPGIEPPTENRPAVRCPVRPIQDKHTLLERYRLNDLDSLKILSNKSPQWNDETQSYVLNFHGRVTQASVKNFQIIHQSSPEYIVMQFGRISDDEFTMDFRYPLSAVQAFGIAMTSFHGKLACE 426          
BLAST of Protein king tubby vs. Ensembl Celegans
Match: tub-2 (TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53])

HSP 1 Score: 68.9366 bits (167), Expect = 2.439e-12
Identity = 31/62 (50.00%), Postives = 41/62 (66.13%), Query Frame = 2
Query: 1499 LHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPL 1684
            + NKTP WN+  Q Y L+F GRVTQ S KNFQI  D+     V+QFGR+   ++T+D+ YP 
Sbjct:  253 MTNKTPFWNEQNQVYQLDFGGRVTQESAKNFQIELDSKQ---VLQFGRIEGGSYTLDFRYPF 311          
BLAST of Protein king tubby vs. Ensembl Celegans
Match: tub-2 (TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53])

HSP 1 Score: 67.0106 bits (162), Expect = 2.888e-11
Identity = 31/62 (50.00%), Postives = 41/62 (66.13%), Query Frame = 2
Query: 1499 LHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPL 1684
            + NKTP WN+  Q Y L+F GRVTQ S KNFQI  D+     V+QFGR+   ++T+D+ YP 
Sbjct:  793 MTNKTPFWNEQNQVYQLDFGGRVTQESAKNFQIELDSKQ---VLQFGRIEGGSYTLDFRYPF 851          
BLAST of Protein king tubby vs. Ensembl Fly
Match: ktub (gene:FBgn0015721 transcript:FBtr0089600)

HSP 1 Score: 343.199 bits (879), Expect = 4.074e-111
Identity = 161/256 (62.89%), Postives = 205/256 (80.08%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRK-KDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            ++++FV+QPA Q V  KCRI+RD++G+D+G++P YYLHL+RD GK++FLL  R+RKKS TSNY++SCD TDL R+ D + GKLRSN  GT+F V+DNG       +E+ +  R +L+ I YDTN+LGFKGPR MTVI+PGM +D QR++       + G+++ WK K M N++ELHNKTPVWND+TQSYVLNFHGRVTQASVKNFQ+VHD+D +YIVMQFGR SED FTMDY YPLCA+QAF IALSSFD K+ACE
Sbjct:  211 NIDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKIFLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVFDNG------NKESTESPRLDLAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPKQQGILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLVHDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIACE 460          
BLAST of Protein king tubby vs. Ensembl Fly
Match: ktub (gene:FBgn0015721 transcript:FBtr0342842)

HSP 1 Score: 342.428 bits (877), Expect = 9.001e-111
Identity = 161/256 (62.89%), Postives = 205/256 (80.08%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRK-KDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            ++++FV+QPA Q V  KCRI+RD++G+D+G++P YYLHL+RD GK++FLL  R+RKKS TSNY++SCD TDL R+ D + GKLRSN  GT+F V+DNG       +E+ +  R +L+ I YDTN+LGFKGPR MTVI+PGM +D QR++       + G+++ WK K M N++ELHNKTPVWND+TQSYVLNFHGRVTQASVKNFQ+VHD+D +YIVMQFGR SED FTMDY YPLCA+QAF IALSSFD K+ACE
Sbjct:  220 NIDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKIFLLGGRKRKKSKTSNYIVSCDPTDLSRNADGFCGKLRSNVFGTSFTVFDNG------NKESTESPRLDLAVIIYDTNILGFKGPRNMTVILPGMTEDDQRVKISSADPKQQGILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLVHDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIACE 469          
BLAST of Protein king tubby vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0335245)

HSP 1 Score: 86.2705 bits (212), Expect = 4.818e-17
Identity = 39/79 (49.37%), Postives = 53/79 (67.09%), Query Frame = 2
Query: 1499 LHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKL 1735
            +HNK P+WN+ +Q Y L+F GRVTQ S KNFQI         VMQFGR+  + +T+D+ YP  ALQAF +AL++   +L
Sbjct: 1357 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1432          
BLAST of Protein king tubby vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0302589)

HSP 1 Score: 86.2705 bits (212), Expect = 4.858e-17
Identity = 39/79 (49.37%), Postives = 53/79 (67.09%), Query Frame = 2
Query: 1499 LHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKL 1735
            +HNK P+WN+ +Q Y L+F GRVTQ S KNFQI         VMQFGR+  + +T+D+ YP  ALQAF +AL++   +L
Sbjct: 1356 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1431          
BLAST of Protein king tubby vs. Ensembl Fly
Match: Tusp (gene:FBgn0039530 transcript:FBtr0302590)

HSP 1 Score: 86.2705 bits (212), Expect = 4.858e-17
Identity = 39/79 (49.37%), Postives = 53/79 (67.09%), Query Frame = 2
Query: 1499 LHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKL 1735
            +HNK P+WN+ +Q Y L+F GRVTQ S KNFQI         VMQFGR+  + +T+D+ YP  ALQAF +AL++   +L
Sbjct: 1356 MHNKAPMWNEMSQVYQLDFGGRVTQESAKNFQIEFRGKQ---VMQFGRIDGNAYTLDFQYPFSALQAFAVALANVTQRL 1431          
BLAST of Protein king tubby vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 386.726 bits (992), Expect = 2.639e-129
Identity = 187/284 (65.85%), Postives = 226/284 (79.58%), Query Frame = 2
Query:  953 TVSFPDSRL-------------------DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG-MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            T++ PDSR+                   DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYD+GMNP   T     G +R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:   75 TITTPDSRVTFTLEASTPLANEPSIDVDDLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 358          
BLAST of Protein king tubby vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 386.726 bits (992), Expect = 5.714e-129
Identity = 187/284 (65.85%), Postives = 226/284 (79.58%), Query Frame = 2
Query:  953 TVSFPDSRL-------------------DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG-MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            T++ PDSR+                   DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYD+GMNP   T     G +R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:  100 TITTPDSRVTFTLEASTPLANEPSIDVDDLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 383          
BLAST of Protein king tubby vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 390.193 bits (1001), Expect = 6.156e-129
Identity = 182/256 (71.09%), Postives = 218/256 (85.16%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG-MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYD+GMNP   T     G +R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:  222 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 477          
BLAST of Protein king tubby vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 388.267 bits (996), Expect = 7.422e-129
Identity = 182/256 (71.09%), Postives = 218/256 (85.16%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG-MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYD+GMNP   T     G +R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:  177 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 432          
BLAST of Protein king tubby vs. Ensembl Zebrafish
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 390.193 bits (1001), Expect = 1.077e-128
Identity = 182/256 (71.09%), Postives = 218/256 (85.16%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG-MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYD+GMNP   T     G +R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:  248 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDSGMNPVKTTSSLEAGNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 503          
BLAST of Protein king tubby vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 365.54 bits (937), Expect = 5.280e-120
Identity = 172/256 (67.19%), Postives = 213/256 (83.20%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDS-KTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DL+EF L+PA + V +K RISRDK+G+D+G+YPTYY+HL+RD+ +++FLLA R+RK+S TSNYLIS D TDL R+G ++IGKLRSN +GT F +YDNG +P   + + +N   R+E++A+ Y+TNVLGFKGPRKMTV+IPGMN +H+RI FQ + D + L+  W  K   N++ELHNK PVWNDDTQSYVLNFHGRVT ASVKNFQIVHDND DYIVMQFGRV+ED FT+DYSYPLCALQAF +ALSSFDSKLACE
Sbjct:  168 DLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 423          
BLAST of Protein king tubby vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 365.925 bits (938), Expect = 5.324e-119
Identity = 172/256 (67.19%), Postives = 213/256 (83.20%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDS-KTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DL+EF L+PA + V +K RISRDK+G+D+G+YPTYY+HL+RD+ +++FLLA R+RK+S TSNYLIS D TDL R+G ++IGKLRSN +GT F +YDNG +P   + + +N   R+E++A+ Y+TNVLGFKGPRKMTV+IPGMN +H+RI FQ + D + L+  W  K   N++ELHNK PVWNDDTQSYVLNFHGRVT ASVKNFQIVHDND DYIVMQFGRV+ED FT+DYSYPLCALQAF +ALSSFDSKLACE
Sbjct:  254 DLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 509          
BLAST of Protein king tubby vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 365.54 bits (937), Expect = 5.921e-119
Identity = 172/256 (67.19%), Postives = 213/256 (83.20%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDS-KTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DL+EF L+PA + V +K RISRDK+G+D+G+YPTYY+HL+RD+ +++FLLA R+RK+S TSNYLIS D TDL R+G ++IGKLRSN +GT F +YDNG +P   + + +N   R+E++A+ Y+TNVLGFKGPRKMTV+IPGMN +H+RI FQ + D + L+  W  K   N++ELHNK PVWNDDTQSYVLNFHGRVT ASVKNFQIVHDND DYIVMQFGRV+ED FT+DYSYPLCALQAF +ALSSFDSKLACE
Sbjct:  247 DLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 502          
BLAST of Protein king tubby vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 362.844 bits (930), Expect = 7.865e-119
Identity = 172/256 (67.19%), Postives = 213/256 (83.20%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDS-KTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DL+EF L+PA + V +K RISRDK+G+D+G+YPTYY+HL+RD+ +++FLLA R+RK+S TSNYLIS D TDL R+G ++IGKLRSN +GT F +YDNG +P   + + +N   R+E++A+ Y+TNVLGFKGPRKMTV+IPGMN +H+RI FQ + D + L+  W  K   N++ELHNK PVWNDDTQSYVLNFHGRVT ASVKNFQIVHDND DYIVMQFGRV+ED FT+DYSYPLCALQAF +ALSSFDSKLACE
Sbjct:  182 DLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 437          
BLAST of Protein king tubby vs. Ensembl Xenopus
Match: tulp3 (TUB like protein 3 [Source:NCBI gene;Acc:100144732])

HSP 1 Score: 365.155 bits (936), Expect = 1.381e-118
Identity = 172/256 (67.19%), Postives = 213/256 (83.20%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDS-KTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DL+EF L+PA + V +K RISRDK+G+D+G+YPTYY+HL+RD+ +++FLLA R+RK+S TSNYLIS D TDL R+G ++IGKLRSN +GT F +YDNG +P   + + +N   R+E++A+ Y+TNVLGFKGPRKMTV+IPGMN +H+RI FQ + D + L+  W  K   N++ELHNK PVWNDDTQSYVLNFHGRVT ASVKNFQIVHDND DYIVMQFGRV+ED FT+DYSYPLCALQAF +ALSSFDSKLACE
Sbjct:  262 DLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKVFLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGQMSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNKCQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDFFTLDYSYPLCALQAFSVALSSFDSKLACE 517          
BLAST of Protein king tubby vs. Ensembl Mouse
Match: Tub (tubby bipartite transcription factor [Source:MGI Symbol;Acc:MGI:2651573])

HSP 1 Score: 378.252 bits (970), Expect = 1.386e-124
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  203 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 459          
BLAST of Protein king tubby vs. Ensembl Mouse
Match: Tub (tubby bipartite transcription factor [Source:MGI Symbol;Acc:MGI:2651573])

HSP 1 Score: 377.867 bits (969), Expect = 7.296e-124
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  249 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Protein king tubby vs. Ensembl Mouse
Match: Tulp3 (tubby-like protein 3 [Source:MGI Symbol;Acc:MGI:1329045])

HSP 1 Score: 366.696 bits (940), Expect = 4.382e-120
Identity = 174/273 (63.74%), Postives = 221/273 (80.95%), Query Frame = 2
Query:  941 ANSLTVSFPDSRL----DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG-MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            A+ +T    D++L    +LE+F   PA + VT+KC+++RDK+G+D+G++PTYY+HL+R++ +++FLLA R+RKKS TSNYL+S D TDL R+G+SYIGKLRSN +GT F VYD+G+NP        K   R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN +H+RI F+ + + + L+  W+ K M NL+ELHNK PVWNDDTQSYVLNFHGRVTQASVKNFQIVH ND DYIVMQFGRV++D FT+DY+YPLCALQAF I LSSFDSKLACE
Sbjct:  188 ASGVTAQQGDAQLGEVENLEDFAYSPAPRGVTVKCKVTRDKKGMDRGLFPTYYMHLEREENRKIFLLAGRKRKKSKTSNYLVSTDPTDLSREGESYIGKLRSNLMGTKFTVYDHGVNPVKAQGLVEKAHTRQELAAICYETNVLGFKGPRKMSVIIPGMNMNHERIPFRPRNEHESLLSKWQNKSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHGNDPDYIVMQFGRVADDVFTLDYNYPLCALQAFAIGLSSFDSKLACE 460          
BLAST of Protein king tubby vs. Ensembl Mouse
Match: Tulp1 (tubby like protein 1 [Source:MGI Symbol;Acc:MGI:109571])

HSP 1 Score: 337.421 bits (864), Expect = 2.485e-108
Identity = 156/252 (61.90%), Postives = 201/252 (79.76%), Query Frame = 2
Query:  989 EFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            EFVLQPA Q   ++CR++RDK+G+D+G+YP+Y+LHLD +  K++FLLA R+RK+S T+NYLIS D T+L R G+++IGKLRSN LG  F V+DNG NP          +R+EL+A+ Y+TNVLGF+GPR+MTVIIPGMN D++R+  + +   DGL+  W+ K + +L+ELHNK P+WN+D+ SY LNF GRVTQASVKNFQIVH +D DYIV+QFGRV+ED FT+DY YPLCALQAF IALSSFD KLACE
Sbjct:  243 EFVLQPAPQGRAVRCRLTRDKKGMDRGMYPSYFLHLDTE--KKVFLLAGRKRKRSKTANYLISSDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGGGGDVGSLRQELAAVVYETNVLGFRGPRRMTVIIPGMNSDNERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPIWNEDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE 492          
BLAST of Protein king tubby vs. Ensembl Mouse
Match: Tulp1 (tubby like protein 1 [Source:MGI Symbol;Acc:MGI:109571])

HSP 1 Score: 337.806 bits (865), Expect = 7.077e-108
Identity = 156/252 (61.90%), Postives = 201/252 (79.76%), Query Frame = 2
Query:  989 EFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            EFVLQPA Q   ++CR++RDK+G+D+G+YP+Y+LHLD +  K++FLLA R+RK+S T+NYLIS D T+L R G+++IGKLRSN LG  F V+DNG NP          +R+EL+A+ Y+TNVLGF+GPR+MTVIIPGMN D++R+  + +   DGL+  W+ K + +L+ELHNK P+WN+D+ SY LNF GRVTQASVKNFQIVH +D DYIV+QFGRV+ED FT+DY YPLCALQAF IALSSFD KLACE
Sbjct:  294 EFVLQPAPQGRAVRCRLTRDKKGMDRGMYPSYFLHLDTE--KKVFLLAGRKRKRSKTANYLISSDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGGGGDVGSLRQELAAVVYETNVLGFRGPRRMTVIIPGMNSDNERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPIWNEDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE 543          
BLAST of Protein king tubby vs. UniProt/SwissProt
Match: sp|P50607|TUB_HUMAN (Tubby protein homolog OS=Homo sapiens OX=9606 GN=TUB PE=1 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 4.163e-124
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  250 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 506          
BLAST of Protein king tubby vs. UniProt/SwissProt
Match: sp|O88808|TUB_RAT (Tubby protein homolog OS=Rattus norvegicus OX=10116 GN=Tub PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.593e-123
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  249 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Protein king tubby vs. UniProt/SwissProt
Match: sp|P50586|TUB_MOUSE (Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 5.104e-123
Identity = 180/258 (69.77%), Postives = 217/258 (84.11%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD---SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q +T+KCRI+RDK+G+D+G+YPTY+LHLDR+DGK++FLLA R+RKKS TSNYLIS D TDL R GDSYIGKLRSN +GT F VYDNG+NP    S T E+   +R+EL+A+ Y+TNVLGFKGPRKM+VI+PGMN  H+R+  + + + + L+  W+ K   +++EL NKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+H ND DYIVMQFGRV+ED FTMDY+YPLCALQAF IALSSFDSKLACE
Sbjct:  249 DLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGT-LRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE 505          
BLAST of Protein king tubby vs. UniProt/SwissProt
Match: sp|O88413|TULP3_MOUSE (Tubby-related protein 3 OS=Mus musculus OX=10090 GN=Tulp3 PE=1 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 3.065e-119
Identity = 174/273 (63.74%), Postives = 221/273 (80.95%), Query Frame = 2
Query:  941 ANSLTVSFPDSRL----DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG-MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            A+ +T    D++L    +LE+F   PA + VT+KC+++RDK+G+D+G++PTYY+HL+R++ +++FLLA R+RKKS TSNYL+S D TDL R+G+SYIGKLRSN +GT F VYD+G+NP        K   R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN +H+RI F+ + + + L+  W+ K M NL+ELHNK PVWNDDTQSYVLNFHGRVTQASVKNFQIVH ND DYIVMQFGRV++D FT+DY+YPLCALQAF I LSSFDSKLACE
Sbjct:  188 ASGVTAQQGDAQLGEVENLEDFAYSPAPRGVTVKCKVTRDKKGMDRGLFPTYYMHLEREENRKIFLLAGRKRKKSKTSNYLVSTDPTDLSREGESYIGKLRSNLMGTKFTVYDHGVNPVKAQGLVEKAHTRQELAAICYETNVLGFKGPRKMSVIIPGMNMNHERIPFRPRNEHESLLSKWQNKSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHGNDPDYIVMQFGRVADDVFTLDYNYPLCALQAFAIGLSSFDSKLACE 460          
BLAST of Protein king tubby vs. UniProt/SwissProt
Match: sp|O75386|TULP3_HUMAN (Tubby-related protein 3 OS=Homo sapiens OX=9606 GN=TULP3 PE=1 SV=2)

HSP 1 Score: 354.755 bits (909), Expect = 6.776e-115
Identity = 174/288 (60.42%), Postives = 221/288 (76.74%), Query Frame = 2
Query:  899 PKIESDENPGSVDTANSLTVSFPDSRL-----DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            P   S +N     T+ S T + P   L     DLE+FV  PA Q VT++CRI RDKRG+D+G++PTYY++L++++ +++FLLAAR+RKKS T+NYLIS D  DL R+G+SY+GKLRSN +GT F VYD G+ P   +        R+EL+AI+Y+TNVLGFKGPRKM+VIIPGM  +H++I +Q + + D L+  W+ + M NL+ELHNK PVWN DTQSYVLNF GRVTQASVKNFQIVH ND DYIVMQFGRV++D FT+DY+YPLCA+QAFGI LSSFDSKLACE
Sbjct:  155 PNSASSQNSTDTGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE 442          
BLAST of Protein king tubby vs. TrEMBL
Match: V4BW79 (Tubby-like protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_206517 PE=3 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 8.312e-135
Identity = 194/260 (74.62%), Postives = 227/260 (87.31%), Query Frame = 2
Query:  965 PDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            PD   +LEEFVL+PA Q VTMKCRI+RDK+GVD+GI+PTY+LHL+RDDGK+ FLLA R+RK+STTSNYL+S D TDL R+G+++IGKLRSN LGT+F ++DNG NP  +   +    R+EL AIAY+TNVLGFKGPRKMTV+IPGMN DH+R+E + + D DGLIE WK+K M NLLELHNKTPVWND+TQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRV+ED FTMD++YPLCALQAFGIALSSFD KLACE
Sbjct:    4 PDPGENLEEFVLKPAPQGVTMKCRITRDKKGVDRGIFPTYFLHLERDDGKKTFLLAGRKRKRSTTSNYLLSTDPTDLTRNGEAFIGKLRSNLLGTHFTLFDNGTNPKKRPVAS----RQELVAIAYETNVLGFKGPRKMTVVIPGMNLDHERVEIKPRGDHDGLIEKWKRKNMENLLELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVAEDVFTMDFNYPLCALQAFGIALSSFDGKLACE 259          
BLAST of Protein king tubby vs. TrEMBL
Match: A0A2C9JMB3 (Tubby-like protein OS=Biomphalaria glabrata OX=6526 GN=106059923 PE=3 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 3.854e-128
Identity = 190/272 (69.85%), Postives = 228/272 (83.82%), Query Frame = 2
Query:  929 SVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            +VD+  +     PD+  +L +FVL+PA Q VTMKCRI+RDK+GVD+ IYPTY+LHL++D+G+++F+LA R+RK+S TSNYLIS D TDL R GD+Y GKLRSN+LGT F ++D+G NP    +EA    R+EL AIAY+TNVLGFKGPRKMT+IIPGM  +HQR+  + +  +DGLIE WKKK M NLLELHNKTPVWN+DTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRV+ED FTMDY+YP+CALQAFGIALSSFD KLACE
Sbjct:  249 AVDSPPAPRPYTPDA-TELNDFVLRPAPQGVTMKCRITRDKKGVDRNIYPTYFLHLEQDNGRKIFILAGRKRKRSKTSNYLISTDPTDLARTGDAYCGKLRSNYLGTQFTLFDHGNNPKKGLQEA----RQELVAIAYETNVLGFKGPRKMTIIIPGMTNEHQRVNIKPQGQQDGLIERWKKKNMENLLELHNKTPVWNEDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVAEDVFTMDYNYPMCALQAFGIALSSFDGKLACE 515          
BLAST of Protein king tubby vs. TrEMBL
Match: R7TT91 (Tub domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_19568 PE=3 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.347e-127
Identity = 191/279 (68.46%), Postives = 229/279 (82.08%), Query Frame = 2
Query:  941 ANSLTVSFPDSRL----------DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPD-SKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            A+  T SF  +RL          DLE+FV +PA Q +T+KCRI+RDK+GVD+G++PTY+LH++RDDGK++FLLA R+RKKS TSNYLIS D TDL R G+S++GKLR N LGT F ++D G +P   KT   +  +RRELSA+ Y+TNVLGFKGPRKMTVIIPGMN DH+R+E + + + DGL+E WK K M NLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRV+ED FTMD++YP+CA+QAF IALSSFDSKLACE
Sbjct:  171 ASGPTRSFSGNRLNIPPEESKQNDLEDFVYRPAPQGITIKCRITRDKKGVDRGMFPTYFLHMERDDGKKVFLLAGRKRKKSATSNYLISVDPTDLSRGGESFVGKLRGNLLGTQFTIFDGGESPKRGKTLVNSDTLRRELSAVVYETNVLGFKGPRKMTVIIPGMNLDHERVEIRPRSEHDGLVERWKHKNMENLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVAEDVFTMDFNYPMCAVQAFSIALSSFDSKLACE 449          
BLAST of Protein king tubby vs. TrEMBL
Match: A0A1I8HU81 (Tub domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.442e-127
Identity = 188/279 (67.38%), Postives = 230/279 (82.44%), Query Frame = 2
Query:  908 ESDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            ES  +   + TA+ L    PD   DLEEFVL+PA Q   +K RI+RD RG+++  YPTYYLH++RDDGK++FLLAAR+R+ S+T+NYLISCD TDLKR G+S++GKLR NF GT F V+DNG  P    E A    RREL+AIAY+TNVLGF+GPRKMTV++PGMN D +RIE + K D+DGL+  +K+K+M+NLLELHNKTPVWN+DTQSYVLNFHGRVTQASVKNFQ+VHDNDVDYIVMQFGR+S+D FTMD++YP+CALQAFG+ALSSFD KLACE
Sbjct:  205 ESRRSQQKLGTASRLANLIPDPTEDLEEFVLRPAPQGCVIKGRITRDTRGIERTRYPTYYLHMERDDGKKIFLLAARKRRHSSTANYLISCDPTDLKRAGESFVGKLRGNFFGTGFTVFDNGEAPKKSGELA----RRELAAIAYETNVLGFRGPRKMTVLLPGMNADSERIELRPKSDDDGLLARYKRKEMNNLLELHNKTPVWNEDTQSYVLNFHGRVTQASVKNFQVVHDNDVDYIVMQFGRISDDIFTMDFAYPMCALQAFGVALSSFDGKLACE 479          
BLAST of Protein king tubby vs. TrEMBL
Match: A0A1I8H558 (Tub domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 1.972e-127
Identity = 188/279 (67.38%), Postives = 230/279 (82.44%), Query Frame = 2
Query:  908 ESDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            ES  +   + TA+ L    PD   DLEEFVL+PA Q   +K RI+RD RG+++  YPTYYLH++RDDGK++FLLAAR+R+ S+T+NYLISCD TDLKR G+S++GKLR NF GT F V+DNG  P    E A    RREL+AIAY+TNVLGF+GPRKMTV++PGMN D +RIE + K D+DGL+  +K+K+M+NLLELHNKTPVWN+DTQSYVLNFHGRVTQASVKNFQ+VHDNDVDYIVMQFGR+S+D FTMD++YP+CALQAFG+ALSSFD KLACE
Sbjct:  202 ESRRSQQKLGTASRLANLIPDPTEDLEEFVLRPAPQGCVIKGRITRDTRGIERTRYPTYYLHMERDDGKKIFLLAARKRRHSSTANYLISCDPTDLKRAGESFVGKLRGNFFGTGFTVFDNGEAPKKSGELA----RRELAAIAYETNVLGFRGPRKMTVLLPGMNADSERIELRPKSDDDGLLARYKRKEMNNLLELHNKTPVWNEDTQSYVLNFHGRVTQASVKNFQVVHDNDVDYIVMQFGRISDDIFTMDFAYPMCALQAFGVALSSFDGKLACE 476          
BLAST of Protein king tubby vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 386.341 bits (991), Expect = 2.518e-127
Identity = 182/257 (70.82%), Postives = 221/257 (85.99%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP--DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYDNGMNP   + T EA+  +R+EL+A+ Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMD++YP+CALQAF IALSSFDSKLACE
Sbjct:  245 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGMNPVKTTSTLEASN-LRQELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 500          
BLAST of Protein king tubby vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 384.415 bits (986), Expect = 3.420e-127
Identity = 182/257 (70.82%), Postives = 221/257 (85.99%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP--DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYDNGMNP   + T EA+  +R+EL+A+ Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMD++YP+CALQAF IALSSFDSKLACE
Sbjct:  200 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGMNPVKTTSTLEASN-LRQELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 455          
BLAST of Protein king tubby vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 386.341 bits (991), Expect = 4.156e-127
Identity = 182/257 (70.82%), Postives = 221/257 (85.99%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP--DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYDNGMNP   + T EA+  +R+EL+A+ Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMD++YP+CALQAF IALSSFDSKLACE
Sbjct:  251 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGMNPVKTTSTLEASN-LRQELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 506          
BLAST of Protein king tubby vs. Ensembl Cavefish
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:107197122])

HSP 1 Score: 383.259 bits (983), Expect = 2.061e-126
Identity = 182/257 (70.82%), Postives = 221/257 (85.99%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP--DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q VT+KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYDNGMNP   + T EA+  +R+EL+A+ Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + + + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMD++YP+CALQAF IALSSFDSKLACE
Sbjct:  219 DLEEFTLRPAPQGVTVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGMNPVKTTSTLEAS-NLRQELAAVCYETNVLGFKGPRKMSVIIPGMNMDHERVCIRPRNEHESLLARWQNKSTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDFNYPMCALQAFAIALSSFDSKLACE 474          
BLAST of Protein king tubby vs. Ensembl Cavefish
Match: zmp:0000000711 (tubby-related protein 3-like [Source:NCBI gene;Acc:103026270])

HSP 1 Score: 375.555 bits (963), Expect = 7.900e-124
Identity = 178/259 (68.73%), Postives = 219/259 (84.56%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP----DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            +LEEFV++PA +  T+KCRI+RDK+G+D+G+YPTY++HL+R+DGK+LFLLA R+RKKS TSNYLIS DATDL R+G+S++GKLRSN +GT F VYDNG NP     +  EE+N   R+EL+AI Y+TNVLGFKGPRKMTVIIPGMN + +R+  +   D++ L+  W+ + + NL+ELHNK PVWNDDTQSYVLNFHGRVTQASVKNFQIVHDND DYIVMQFGRV+ED FT+DY+YP+CALQAF I LSSFDSKLACE
Sbjct:  187 NLEEFVVRPAPRGATIKCRITRDKKGMDRGLYPTYFMHLEREDGKKLFLLAGRKRKKSKTSNYLISVDATDLSREGESFVGKLRSNMMGTKFTVYDNGTNPTKNPGTLLEESNT--RQELAAICYETNVLGFKGPRKMTVIIPGMNMNFERVPVRPTNDQESLLSKWQNRALDNLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVAEDVFTLDYNYPMCALQAFAIGLSSFDSKLACE 443          
BLAST of Protein king tubby vs. Ensembl Sea Lamprey
Match: tub (TUB bipartite transcription factor [Source:ZFIN;Acc:ZDB-GENE-121009-1])

HSP 1 Score: 286.96 bits (733), Expect = 2.046e-93
Identity = 152/259 (58.69%), Postives = 184/259 (71.04%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKG--MRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDND--VDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLE F L+PA Q   +KCRI+RDK+G+D+G++PTY+LH+DRDDGK++FLLA R+RKKS TSNYL+S D T+L R+G+SYIGKLRSN +GT F VYDNG+ PD +T     G  +R+EL+A+ Y                                 + + L+  W  K   + +ELHNK PVWNDDTQSYVLNFHGRVTQASVKNFQIVH ND   +YI+MQFGRV+ED FTMDYSYPLCALQAF IALSSFD KLACE
Sbjct:    3 DLEAFALRPAPQGGPVKCRITRDKKGMDRGMFPTYFLHMDRDDGKKVFLLAGRKRKKSKTSNYLLSTDPTNLSREGESYIGKLRSNVMGTRFTVYDNGIKPD-RTGILGDGSNLRQELAAVCY---------------------------------EHETLVSRWHNKNTEHTVELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHYNDRAAEYIIMQFGRVAEDIFTMDYSYPLCALQAFSIALSSFDGKLACE 227          
BLAST of Protein king tubby vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003777.1 (pep scaffold:Pmarinus_7.0:GL496087:2648:3421:1 gene:ENSPMAG00000003451.1 transcript:ENSPMAT00000003777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 2.725e-34
Identity = 87/258 (33.72%), Postives = 142/258 (55.04%), Query Frame = 2
Query:  995 VLQPAIQNVTM-KCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGM------NQDHQRIEFQRKKDEDGLIESWK-KKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            ++QP    V M +  I R K G    ++P+++L+L++   +++ +L A++R  + T+N+LIS + T  KR GD  +GKLRSN     + ++++G NP +  + A  G+R E  AI Y          RK  VIIPG+      N++H+ +     K ED +I+  +  +   N     +  P WN  T  Y  +F GR+++ASVKNF+ V+   ++   +QFGR +++ F +D  YP    QAFG+AL+ FD    CE
Sbjct:    4 MMQPIPFEVGMLQFEIQRKKSGFSV-LHPSFHLYLEKGGDEKVSILYAKKRAFNKTANFLISTEKTKNKRGGDECLGKLRSNETKERYFLFNDGDNPKNMHKTAISGIRNEHMAIQYKYVPCSIGKLRKAKVIIPGVDPNTMKNREHKPL-----KKEDTMIKKIEDPQAAENFYVFVDNPPQWNPKTHGYHYDFRGRISEASVKNFKGVNIRGMN---VQFGRTNDNVFKLDAQYPFSIFQAFGLALTVFD----CE 248          
BLAST of Protein king tubby vs. Ensembl Nematostella
Match: EDO38412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD12])

HSP 1 Score: 351.288 bits (900), Expect = 1.182e-117
Identity = 165/249 (66.27%), Postives = 208/249 (83.53%), Query Frame = 2
Query: 1001 QPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            +PA Q + +KCRI+RDK+G+D+G+YPTY+LH++RDDGK++FLLA R+RKKSTTSNYLIS DATDL R G+S++GKLR+N +GT F ++DNG+NP           +R EL  I YDTNVLGFKGPRKMTV++PGM  D QR+  + + + + ++E  + +++ NL+ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHD+DVDYI+MQFGRV+ED FTMDY+YP+CA+QAF IALSSFD KLACE
Sbjct:    1 RPAPQGIPVKCRITRDKKGMDRGMYPTYFLHMERDDGKKVFLLAGRKRKKSTTSNYLISTDATDLSRGGESFVGKLRANLVGTKFSIFDNGVNPRKGGVMSDGSNIREELGGIIYDTNVLGFKGPRKMTVVLPGMGLDQQRVPVRPRLESETILERHRNRQLENLVELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDSDVDYIIMQFGRVAEDVFTMDYNYPMCAVQAFAIALSSFDGKLACE 249          
BLAST of Protein king tubby vs. Ensembl Nematostella
Match: EDO28462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD12])

HSP 1 Score: 351.288 bits (900), Expect = 1.182e-117
Identity = 165/249 (66.27%), Postives = 208/249 (83.53%), Query Frame = 2
Query: 1001 QPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            +PA Q + +KCRI+RDK+G+D+G+YPTY+LH++RDDGK++FLLA R+RKKSTTSNYLIS DATDL R G+S++GKLR+N +GT F ++DNG+NP           +R EL  I YDTNVLGFKGPRKMTV++PGM  D QR+  + + + + ++E  + +++ NL+ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHD+DVDYI+MQFGRV+ED FTMDY+YP+CA+QAF IALSSFD KLACE
Sbjct:    1 RPAPQGIPVKCRITRDKKGMDRGMYPTYFLHMERDDGKKVFLLAGRKRKKSTTSNYLISTDATDLSRGGESFVGKLRANLVGTKFSIFDNGVNPRKGGVMSDGSNIREELGGIIYDTNVLGFKGPRKMTVVLPGMGLDQQRVPVRPRLESETILERHRNRQLENLVELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDSDVDYIIMQFGRVAEDVFTMDYNYPMCAVQAFAIALSSFDGKLACE 249          
BLAST of Protein king tubby vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 387.111 bits (993), Expect = 1.144e-127
Identity = 182/256 (71.09%), Postives = 217/256 (84.77%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q V +KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYDNG+NP  S T      +R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + D + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:  241 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGLNPMKSTTSLEASNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 496          
BLAST of Protein king tubby vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 386.726 bits (992), Expect = 1.951e-127
Identity = 182/256 (71.09%), Postives = 217/256 (84.77%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            DLEEF L+PA Q V +KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYDNG+NP  S T      +R+EL+AI Y+TNVLGFKGPRKM+VIIPGMN DH+R+  + + D + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:  247 DLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGLNPMKSTTSLEASNLRQELAAICYETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 502          
BLAST of Protein king tubby vs. Ensembl Medaka
Match: zmp:0000000711 (TUB like protein 3 [Source:NCBI gene;Acc:101160279])

HSP 1 Score: 373.244 bits (957), Expect = 2.635e-122
Identity = 177/258 (68.60%), Postives = 218/258 (84.50%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEA---NKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            +LEEFVL PA + VT+KCRISRDK+G+D+G+YPTY++H++++DGK++FLLA R+RKKS TSNYLIS DATDL R+GDS+IGKLRSN +GT F VYD+G NP  KT  A   +   R+E++A+ Y+TNVLGFKGPRKMTVIIPGMN + +R+  + + +++ L+  W+   M NL+ELHNK PVWNDDTQSYVLNFHGRVTQASVKNFQIVHDND DYIVMQFGRV+ED FT+DY+YP+CALQAF I LSSFDSKLACE
Sbjct:  230 NLEEFVLSPAPRGVTIKCRISRDKKGMDRGLYPTYFMHMEKEDGKKVFLLAGRKRKKSKTSNYLISVDATDLSREGDSFIGKLRSNLMGTKFTVYDSGSNP-GKTVGALMEDSPARQEMAAVCYETNVLGFKGPRKMTVIIPGMNMNFERLPVRPQNEQESLLSRWQNHSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVAEDIFTLDYNYPMCALQAFAIGLSSFDSKLACE 486          
BLAST of Protein king tubby vs. Ensembl Medaka
Match: zmp:0000000711 (TUB like protein 3 [Source:NCBI gene;Acc:101160279])

HSP 1 Score: 372.859 bits (956), Expect = 8.768e-122
Identity = 177/258 (68.60%), Postives = 218/258 (84.50%), Query Frame = 2
Query:  980 DLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEA---NKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            +LEEFVL PA + VT+KCRISRDK+G+D+G+YPTY++H++++DGK++FLLA R+RKKS TSNYLIS DATDL R+GDS+IGKLRSN +GT F VYD+G NP  KT  A   +   R+E++A+ Y+TNVLGFKGPRKMTVIIPGMN + +R+  + + +++ L+  W+   M NL+ELHNK PVWNDDTQSYVLNFHGRVTQASVKNFQIVHDND DYIVMQFGRV+ED FT+DY+YP+CALQAF I LSSFDSKLACE
Sbjct:  260 NLEEFVLSPAPRGVTIKCRISRDKKGMDRGLYPTYFMHMEKEDGKKVFLLAGRKRKKSKTSNYLISVDATDLSREGDSFIGKLRSNLMGTKFTVYDSGSNP-GKTVGALMEDSPARQEMAAVCYETNVLGFKGPRKMTVIIPGMNMNFERLPVRPQNEQESLLSRWQNHSMENLIELHNKAPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDPDYIVMQFGRVAEDIFTLDYNYPMCALQAFAIGLSSFDSKLACE 516          
BLAST of Protein king tubby vs. Ensembl Medaka
Match: tub (TUB bipartite transcription factor [Source:NCBI gene;Acc:101162435])

HSP 1 Score: 372.089 bits (954), Expect = 1.840e-121
Identity = 190/319 (59.56%), Postives = 232/319 (72.73%), Query Frame = 2
Query:  902 KIESDENPGS---------VDTANSLTVSFPDSRLD-LEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNP-DSKTEEANKGMRRELSAIAY---------------------------DTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            ++ S+  PGS         V +A +  V+ P   +D LEEF L+PA Q V +KCRI+RDK+G+D+G+YPTYYLHL+R+DGK++FLLA R+RKKS TSNYLIS D TDL R G+S+IGKLRSN +GT F VYDNG+NP  S T      +R+EL+AI Y                           +TNVLGFKGPRKM+VIIPGMN DH+R+  + + D + L+  W+ K   +++ELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI+HDND DYIVMQFGRV+ED FTMDY+YP+CALQAF IALSSFDSKLACE
Sbjct:  205 QLNSNTRPGSATSKKSCKEVASATTPPVNEPAIDVDDLEEFSLRPAPQGVRVKCRITRDKKGMDRGMYPTYYLHLEREDGKKVFLLAGRKRKKSKTSNYLISIDPTDLSRGGESFIGKLRSNLMGTKFTVYDNGLNPMKSTTSLEASNLRQELAAICYVSKRTAMKQLKLYCIVTDNVLLCHFIQETNVLGFKGPRKMSVIIPGMNMDHERVSIRPRNDHESLLARWQNKNTESVIELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHDNDPDYIVMQFGRVAEDVFTMDYNYPMCALQAFAIALSSFDSKLACE 523          
BLAST of Protein king tubby vs. Planmine SMEST
Match: SMESG000073925.1 (SMESG000073925.1)

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 503/503 (100.00%), Postives = 503/503 (100.00%), Query Frame = 2
Query:   20 MENHRRSPNILHEKFNKERQKIKHNQLRKQVHETQKLQPSDLKEITFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKPLVTKDPVLSYETSQNSTKLSSSNILKTKQETYXXXXXXXXXXXXQLPTNNSSEKTDSKNDLKLKKSWIQSTVHSISNNAALDKDQIADVMTSQKHLISKVNETKIHRRRXXXXXXXXXXXXXXXXXXXXXXXXXXTMKVIEQKDETVPEKSAKSGLFLASSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKIESDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWND 1528
            MENHRRSPNILHEKFNKERQKIKHNQLRKQVHETQKLQPSDLKEITFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKPLVTKDPVLSYETSQNSTKLSSSNILKTKQETYEEDIETIETSDSQLPTNNSSEKTDSKNDLKLKKSWIQSTVHSISNNAALDKDQIADVMTSQKHLISKVNETKIHRRRKKNKSKSDKIKNEKIIIDDNKNEIDDTMKVIEQKDETVPEKSAKSGLFLASSIKNNNSDDKQLNQDLDLLKSKLNSIKSNLSNKPKIESDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGKRLFLLAARRRKKSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWND
Sbjct:    1 MENHRRSPNILHEKFNKERQKIKHNQLRKQVHETQKLQPSDLKEITFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKPLVTKDPVLSYETSQNSTKLSSSNILKTKQETYEEDIETIETSDSQLPTNNSSEKTDSKNDLKLKKSWIQSTVHSISNNAALDKDQIADVMTSQKHLISKVNETKIHRRRKKNKSKSDKIKNEKIIIDDNKNEIDDTMKVIEQKDETVPEKSAKSGLFLASSIKNNNSDDKQLNQDLDLLKSKLNSIKSNLSNKPKIESDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGKRLFLLAARRRKKSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWND 503          
BLAST of Protein king tubby vs. Planmine SMEST
Match: SMESG000073925.1 (SMESG000073925.1)

HSP 1 Score: 409.838 bits (1052), Expect = 2.595e-138
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 2
Query:  911 SDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWND 1528
            SDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGKRLFLLAARRRKKSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWND
Sbjct:  162 SDENPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGKRLFLLAARRRKKSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWND 367          

HSP 2 Score: 303.523 bits (776), Expect = 5.495e-97
Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 2
Query:   20 MENHRRSPNILHEKFNKERQKIKHNQLRKQVHETQKLQPSDLKEITFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKPLVTKDPVLSYETSQNSTKLSSSNILKTKQETYXXXXXXXXXXXXQLPTNNSSEKTDSKNDL 502
            MENHRRSPNILHEKFNKERQKIKHNQLRKQVHETQKLQPSDLKEITFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKPLVTKDPVLSYETSQNSTKLSSSNILKTKQETYEEDIETIETSDSQLPTNNSSEKTDSKNDL
Sbjct:    1 MENHRRSPNILHEKFNKERQKIKHNQLRKQVHETQKLQPSDLKEITFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKPLVTKDPVLSYETSQNSTKLSSSNILKTKQETYEEDIETIETSDSQLPTNNSSEKTDSKNDL 161          
BLAST of Protein king tubby vs. Planmine SMEST
Match: SMESG000009644.1 (SMESG000009644.1)

HSP 1 Score: 357.066 bits (915), Expect = 3.913e-116
Identity = 176/266 (66.17%), Postives = 215/266 (80.83%), Query Frame = 2
Query:  959 SFP----DSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKGIYPTYYLHLDRDDGXXXXXXXXXXXXXSTTSNYLISCDATDLKRDGDSYIGKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKGPRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLACE 1744
            SFP    DS L++E FV +PA Q+  +KCRI+RDKRG+DKG+YPTYYLHL+R + K LFLLAARRRK   TSNYLISCDATD+K++G  Y+ KLR+NF+GT F +YDNG  P+     +NK +R EL+AI ++TNVLGFKGPRKMT+IIPGM      I+FQ K  ED L+E  + +K+ NLLELHNK PVWN+D+QSYVLNFHGRVTQASVKNFQIVHDND +YI+MQFGR S+ +F+MD++YPL A+QAFGIALSSFD KLACE
Sbjct:  235 SFPEHILDSNLEIESFVSKPAPQDCVVKCRITRDKRGMDKGMYPTYYLHLERKNAKPLFLLAARRRKYCKTSNYLISCDATDMKKNGFGYLAKLRANFIGTQFSLYDNGQKPEP-VNSSNKPLRAELAAIIFETNVLGFKGPRKMTIIIPGMTPMKTPIDFQPKFGEDDLLEHSRTRKLDNLLELHNKKPVWNEDSQSYVLNFHGRVTQASVKNFQIVHDNDAEYIIMQFGRTSDHSFSMDFAYPLSAVQAFGIALSSFDGKLACE 499          

HSP 2 Score: 49.6766 bits (117), Expect = 5.608e-6
Identity = 29/101 (28.71%), Postives = 59/101 (58.42%), Query Frame = 2
Query:   59 KFNKERQKIKHNQLRKQVHETQKLQPSD------LKEITFKDEKRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKPLVTKDPVL 343
            K N++RQKI+ NQ +K + + + +Q +D      L  ++ K+E   L +NS+++N +    +AYDGPQ++E+ N      + +++  +N   P +T+  ++
Sbjct:    9 KLNQQRQKIRDNQNKKHIQQLKSIQINDNEAILNLNFLSVKEETSLLVKNSSSEN-QISGKFAYDGPQSFELANIYNSHDSEIEIYHLN--DPTITEKSLI 106          
BLAST of Protein king tubby vs. Planmine SMEST
Match: SMESG000043973.1 (SMESG000043973.1)

HSP 1 Score: 72.0182 bits (175), Expect = 9.228e-14
Identity = 44/126 (34.92%), Postives = 71/126 (56.35%), Query Frame = 2
Query: 1370 PRKMTVIIPGMNQDHQRIEFQRK--KDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-VHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLA 1738
            PR +T  IP  ++     +F  +  K+   ++   K +    ++ L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+  +  + +D++YPLC  QAF IALS    K+A
Sbjct:  130 PRTITAAIPNWDESKGYYDFSNELPKERTEVLNLDKDE----IICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGK-CKTHYIVDFTYPLCPFQAFAIALSCCQRKIA 250          
BLAST of Protein king tubby vs. Planmine SMEST
Match: SMESG000043973.1 (SMESG000043973.1)

HSP 1 Score: 71.633 bits (174), Expect = 1.309e-12
Identity = 44/126 (34.92%), Postives = 71/126 (56.35%), Query Frame = 2
Query: 1370 PRKMTVIIPGMNQDHQRIEFQRK--KDEDGLIESWKKKKMHNLLELHNKTPVWNDDTQSYVLNFHGRVTQASVKNFQI-VHDNDVDYIVMQFGRVSEDTFTMDYSYPLCALQAFGIALSSFDSKLA 1738
            PR +T  IP  ++     +F  +  K+   ++   K +    ++ L N+ P +++D + YVLNF GRVT+ SVKNF + ++ N     V Q G+  +  + +D++YPLC  QAF IALS    K+A
Sbjct:  660 PRTITAAIPNWDESKGYYDFSNELPKERTEVLNLDKDE----IICLENELPKYDEDKKLYVLNFGGRVTERSVKNFALNMNINGKSKRVYQLGKC-KTHYIVDFTYPLCPFQAFAIALSCCQRKIA 780          
The following BLAST results are available for this feature:
BLAST of Protein king tubby vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUB8.163e-12569.77TUB bipartite transcription factor [Source:HGNC Sy... [more]
TUB8.668e-12569.77TUB bipartite transcription factor [Source:HGNC Sy... [more]
TUB5.879e-12469.77TUB bipartite transcription factor [Source:HGNC Sy... [more]
TULP31.411e-11560.42TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12... [more]
TULP38.412e-11059.57TUB like protein 3 [Source:HGNC Symbol;Acc:HGNC:12... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tub-17.606e-9256.27Tubby protein homolog 1 [Source:UniProtKB/Swiss-P... [more]
tub-22.439e-1250.00TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53... [more]
tub-22.888e-1150.00TUBby-related [Source:UniProtKB/TrEMBL;Acc:Q9BL53... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ktub4.074e-11162.89gene:FBgn0015721 transcript:FBtr0089600[more]
ktub9.001e-11162.89gene:FBgn0015721 transcript:FBtr0342842[more]
Tusp4.818e-1749.37gene:FBgn0039530 transcript:FBtr0335245[more]
Tusp4.858e-1749.37gene:FBgn0039530 transcript:FBtr0302589[more]
Tusp4.858e-1749.37gene:FBgn0039530 transcript:FBtr0302590[more]
back to top
BLAST of Protein king tubby vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub2.639e-12965.85TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub5.714e-12965.85TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub6.156e-12971.09TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub7.422e-12971.09TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
tub1.077e-12871.09TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tulp35.280e-12067.19TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
tulp35.324e-11967.19TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
tulp35.921e-11967.19TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
tulp37.865e-11967.19TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
tulp31.381e-11867.19TUB like protein 3 [Source:NCBI gene;Acc:100144732... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tub1.386e-12469.77tubby bipartite transcription factor [Source:MGI S... [more]
Tub7.296e-12469.77tubby bipartite transcription factor [Source:MGI S... [more]
Tulp34.382e-12063.74tubby-like protein 3 [Source:MGI Symbol;Acc:MGI:13... [more]
Tulp12.485e-10861.90tubby like protein 1 [Source:MGI Symbol;Acc:MGI:10... [more]
Tulp17.077e-10861.90tubby like protein 1 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Protein king tubby vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50607|TUB_HUMAN4.163e-12469.77Tubby protein homolog OS=Homo sapiens OX=9606 GN=T... [more]
sp|O88808|TUB_RAT2.593e-12369.77Tubby protein homolog OS=Rattus norvegicus OX=1011... [more]
sp|P50586|TUB_MOUSE5.104e-12369.77Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1... [more]
sp|O88413|TULP3_MOUSE3.065e-11963.74Tubby-related protein 3 OS=Mus musculus OX=10090 G... [more]
sp|O75386|TULP3_HUMAN6.776e-11560.42Tubby-related protein 3 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Protein king tubby vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BW798.312e-13574.62Tubby-like protein OS=Lottia gigantea OX=225164 GN... [more]
A0A2C9JMB33.854e-12869.85Tubby-like protein OS=Biomphalaria glabrata OX=652... [more]
R7TT911.347e-12768.46Tub domain-containing protein OS=Capitella teleta ... [more]
A0A1I8HU811.442e-12767.38Tub domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8H5581.972e-12767.38Tub domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub2.518e-12770.82TUB bipartite transcription factor [Source:NCBI ge... [more]
tub3.420e-12770.82TUB bipartite transcription factor [Source:NCBI ge... [more]
tub4.156e-12770.82TUB bipartite transcription factor [Source:NCBI ge... [more]
tub2.061e-12670.82TUB bipartite transcription factor [Source:NCBI ge... [more]
zmp:00000007117.900e-12468.73tubby-related protein 3-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tub2.046e-9358.69TUB bipartite transcription factor [Source:ZFIN;Ac... [more]
ENSPMAT00000003777.12.725e-3433.72pep scaffold:Pmarinus_7.0:GL496087:2648:3421:1 gen... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein king tubby vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO384121.182e-11766.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284621.182e-11766.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein king tubby vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tub1.144e-12771.09TUB bipartite transcription factor [Source:NCBI ge... [more]
tub1.951e-12771.09TUB bipartite transcription factor [Source:NCBI ge... [more]
zmp:00000007112.635e-12268.60TUB like protein 3 [Source:NCBI gene;Acc:101160279... [more]
zmp:00000007118.768e-12268.60TUB like protein 3 [Source:NCBI gene;Acc:101160279... [more]
tub1.840e-12159.56TUB bipartite transcription factor [Source:NCBI ge... [more]
back to top
BLAST of Protein king tubby vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073925.10.000e+0100.00SMESG000073925.1[more]
SMESG000073925.12.595e-138100.00SMESG000073925.1[more]
SMESG000009644.13.913e-11666.17SMESG000009644.1[more]
SMESG000043973.19.228e-1434.92SMESG000043973.1[more]
SMESG000043973.11.309e-1234.92SMESG000043973.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000692 ID=SMED30000692|Name=Protein king tubby|organism=Schmidtea mediterranea sexual|type=transcript|length=1988bp
CTATATAAATCTTATATGAATGGAAAATCACAGAAGATCACCAAACATAT
TGCATGAAAAATTTAACAAAGAGCGCCAGAAAATTAAACATAATCAATTA
AGAAAACAAGTACACGAAACTCAAAAACTTCAACCATCTGATTTGAAAGA
AATAACATTTAAAGATGAAAAGCGGCCACTGTTTGAGAATTCAAATAATG
ATAACACTGAATATCATTGTAATTATGCTTACGATGGACCTCAAGCATAC
GAAATGACAAATCCCGATGGGTTATCCACAACTCACGTACAAGTACTCAA
AGTCAATCCTGAAAAACCCCTAGTCACAAAAGATCCGGTGTTATCCTATG
AAACTAGTCAGAATTCAACAAAATTATCCAGTTCAAATATTCTTAAAACT
AAACAAGAAACTTATGAAGAAGATATAGAAACTATAGAAACTTCCGATTC
CCAATTACCAACAAATAACAGTTCTGAAAAAACTGATAGTAAAAATGATT
TGAAATTGAAAAAGTCTTGGATTCAATCTACAGTTCATTCCATATCTAAT
AACGCCGCTTTAGATAAAGATCAAATAGCTGACGTGATGACATCACAAAA
GCATTTGATATCCAAAGTGAATGAAACTAAAATACATAGACGCCGAAAAA
AAAATAAATCTAAAAGTGACAAAATAAAAAATGAAAAGATAATCATTGAT
GATAACAAAAATGAAATTGATGATACTATGAAAGTTATCGAACAAAAAGA
TGAAACAGTACCCGAAAAGTCTGCAAAATCTGGTTTATTCCTAGCCTCGT
CCATCAAAAATAACAATAGCGATGACAAACAATTGAATCAAGACTTAGAT
TTGCTCAAGTCAAAATTAAATTCCATCAAAAGCAACTTGAGCAACAAACC
AAAAATTGAGAGCGATGAAAATCCAGGCTCAGTTGACACTGCTAATTCCT
TGACAGTAAGCTTTCCAGATTCTAGACTTGATTTAGAAGAATTCGTTTTG
CAACCAGCAATTCAAAATGTTACAATGAAATGCAGAATCTCCCGTGATAA
AAGAGGAGTGGATAAAGGCATTTACCCAACATATTATTTGCATTTGGATC
GTGATGATGGAAAAAGATTATTTCTTTTAGCAGCAAGACGAAGAAAAAAA
TCAACTACTAGCAATTATTTAATTAGTTGTGACGCTACTGATTTGAAAAG
GGACGGTGATAGCTATATTGGAAAATTACGATCAAATTTTCTAGGAACAA
ATTTTGTGGTATATGATAATGGAATGAATCCTGATTCAAAAACAGAAGAA
GCAAATAAAGGAATGAGGCGTGAATTATCAGCTATTGCTTATGATACAAA
TGTATTGGGATTTAAAGGACCTCGTAAAATGACAGTAATTATTCCAGGAA
TGAATCAGGATCATCAAAGAATAGAATTTCAAAGGAAAAAAGATGAAGAC
GGGTTAATTGAAAGTTGGAAAAAAAAGAAAATGCATAATTTATTAGAATT
ACACAATAAAACTCCTGTATGGAATGATGATACGCAATCATATGTTTTAA
ATTTTCATGGTCGAGTTACTCAGGCGTCGGTGAAAAATTTTCAAATCGTT
CATGACAATGACGTTGACTACATTGTGATGCAATTCGGTAGAGTTTCAGA
AGATACTTTTACAATGGATTATTCATATCCGCTATGTGCACTACAAGCAT
TTGGCATCGCTTTATCATCATTCGACAGCAAATTGGCATGTGAATAACAA
TATCTGGATAATGAATTCTCAGTGAAATGATTTTACAAAAAATGCTTTTA
TAATTTATTTCCAAACAATTTCACAACATTTTACTAATTTCACTTTTACC
TTTGGATTTAATTTCATTTTGATTATCTCATTTAATTATTTCTTTTCATA
GAGATTGTATCAAGTACATCACAAAGTAAAAACTTTCAAATTTTTTTCAA
TGTACGAGATTAATTATCTTTGATCATTTATTCGTGAA
back to top

protein sequence of SMED30000692-orf-1

>SMED30000692-orf-1 ID=SMED30000692-orf-1|Name=SMED30000692-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MENHRRSPNILHEKFNKERQKIKHNQLRKQVHETQKLQPSDLKEITFKDE
KRPLFENSNNDNTEYHCNYAYDGPQAYEMTNPDGLSTTHVQVLKVNPEKP
LVTKDPVLSYETSQNSTKLSSSNILKTKQETYEEDIETIETSDSQLPTNN
SSEKTDSKNDLKLKKSWIQSTVHSISNNAALDKDQIADVMTSQKHLISKV
NETKIHRRRKKNKSKSDKIKNEKIIIDDNKNEIDDTMKVIEQKDETVPEK
SAKSGLFLASSIKNNNSDDKQLNQDLDLLKSKLNSIKSNLSNKPKIESDE
NPGSVDTANSLTVSFPDSRLDLEEFVLQPAIQNVTMKCRISRDKRGVDKG
IYPTYYLHLDRDDGKRLFLLAARRRKKSTTSNYLISCDATDLKRDGDSYI
GKLRSNFLGTNFVVYDNGMNPDSKTEEANKGMRRELSAIAYDTNVLGFKG
PRKMTVIIPGMNQDHQRIEFQRKKDEDGLIESWKKKKMHNLLELHNKTPV
WNDDTQSYVLNFHGRVTQASVKNFQIVHDNDVDYIVMQFGRVSEDTFTMD
YSYPLCALQAFGIALSSFDSKLACE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000007Tubby_C
IPR018066Tubby_C_CS
IPR025659Tubby-like_C
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005929cilium
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006909phagocytosis
GO:0006910phagocytosis, recognition
GO:0007605sensory perception of sound
GO:0009725response to hormone
GO:0045494photoreceptor cell maintenance
GO:0050766positive regulation of phagocytosis
GO:0050896response to stimulus
GO:0060041retina development in camera-type eye
GO:0097500receptor localization to non-motile cilium
GO:1903441protein localization to ciliary membrane
GO:1903546protein localization to photoreceptor outer segment
Vocabulary: molecular function
TermDefinition
GO:0032403protein complex binding
GO:0035091phosphatidylinositol binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 17..37
NoneNo IPR availableCOILSCoilCoilcoord: 269..289
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..160
NoneNo IPR availablePANTHERPTHR16517TUBBY-RELATEDcoord: 45..575
NoneNo IPR availablePANTHERPTHR16517:SF20TUBBY PROTEIN HOMOLOGcoord: 45..575
IPR000007Tubby, C-terminalPRINTSPR01573SUPERTUBBYcoord: 433..460
score: 56.82
coord: 532..551
score: 65.68
coord: 494..511
score: 65.15
coord: 383..399
score: 48.93
coord: 399..423
score: 61.45
coord: 553..575
score: 80.04
coord: 512..528
score: 85.29
IPR000007Tubby, C-terminalPFAMPF01167Tubcoord: 328..570
e-value: 1.1E-94
score: 316.7
IPR025659Tubby-like, C-terminalGENE3DG3DSA:3.20.90.10coord: 318..575
e-value: 7.5E-122
score: 407.6
IPR025659Tubby-like, C-terminalSUPERFAMILYSSF54518Tubby C-terminal domain-likecoord: 318..575
IPR018066Tubby, C-terminal, conserved sitePROSITEPS01200TUB_1coord: 512..525
IPR018066Tubby, C-terminal, conserved sitePROSITEPS01201TUB_2coord: 560..575