Protocadherin 1b

Overview
NameProtocadherin 1b
Smed IDSMED30000690
Length (bp)3515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin 1b (SMED30000690) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin 1b (SMED30000690) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin 1b (SMED30000690) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin 1b (SMED30000690) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000690

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000690SMESG000043679.1 PL05003B2E03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
zeta neoblastSMED30000690SMESG000043679.1 SMED30000690smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000690SMESG000043679.1 dd_Smed_v4_2654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000690SMESG000043679.1 dd_Smed_v4_2654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000690SMESG000043679.1 dd_Smed_v4_2654_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000690SMESG000043679.1 dd_Smed_v4_2654_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin 1b vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 271.937 bits (694), Expect = 4.480e-75
Identity = 220/738 (29.81%), Postives = 357/738 (48.37%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI----IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSP----SDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRE L  C NQ+  D  +L F +S + + ++ +       +E+ DINDN P++   S V++    E   + S    I  A D D   N    Y L+   G     ++ ++  +    ++ +L+ +  +DRE+ D Y+L +  +D GSP R  S  L + +LD NDN P F+R  Y A +LSEN+ IG   + V A D+D  AN +I Y     +A E          N G I V+  +D +  +   +FSVLA D       K+   +VV+ V D ND  P I    I  VT +D + N    I  +V   + +A ++V D D G    V+C ++ +   +L Q S     S K++ +      D E+     ++I+  D      +++ S+  Q++D NDN+P FT+          + P   + E+ A D D+  N+++ + +      +  F I   +G++  K  LDRE+ E + + ++A D G P   GT  V + V+D ND  P+F LS Y FS+ EN    + VG VT ID D   N +++  +  D                 +I++  G I++    DRE+QS Y   + A+D G P   ++   V IN++D NDN P     + T   + T ++ +G  +  V A D D G N+E++Y I  GNPYG F   + +  + L   + ++    H+LV+   D+GKPP+    L
Sbjct:   99 LRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF--ASPVITLAIPENTNIGS-LFPIPLASDRDAGPNGVASYELQ--AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEA-ELSENSPIGHSVIQVKANDSDQGANAEIEYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGTNP--KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN----ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDF-------------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP-PRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTAL 807          
BLAST of Protocadherin 1b vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 273.478 bits (698), Expect = 6.704e-75
Identity = 220/738 (29.81%), Postives = 357/738 (48.37%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI----IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSP----SDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRE L  C NQ+  D  +L F +S + + ++ +       +E+ DINDN P++   S V++    E   + S    I  A D D   N    Y L+   G     ++ ++  +    ++ +L+ +  +DRE+ D Y+L +  +D GSP R  S  L + +LD NDN P F+R  Y A +LSEN+ IG   + V A D+D  AN +I Y     +A E          N G I V+  +D +  +   +FSVLA D       K+   +VV+ V D ND  P I    I  VT +D + N    I  +V   + +A ++V D D G    V+C ++ +   +L Q S     S K++ +      D E+     ++I+  D      +++ S+  Q++D NDN+P FT+          + P   + E+ A D D+  N+++ + +      +  F I   +G++  K  LDRE+ E + + ++A D G P   GT  V + V+D ND  P+F LS Y FS+ EN    + VG VT ID D   N +++  +  D                 +I++  G I++    DRE+QS Y   + A+D G P   ++   V IN++D NDN P     + T   + T ++ +G  +  V A D D G N+E++Y I  GNPYG F   + +  + L   + ++    H+LV+   D+GKPP+    L
Sbjct:   99 LRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF--ASPVITLAIPENTNIGS-LFPIPLASDRDAGPNGVASYELQ--AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEA-ELSENSPIGHSVIQVKANDSDQGANAEIEYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGTNP--KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN----ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDF-------------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP-PRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTAL 807          
BLAST of Protocadherin 1b vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 231.491 bits (589), Expect = 8.138e-62
Identity = 212/722 (29.36%), Postives = 336/722 (46.54%), Query Frame = 2
Query:  506 VVTVKNRIDRESLCPN-----QINCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA---SEYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-----------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRII--SDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKT--SNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
            + T  NRIDRE LC       +  C   L   I P+   + + ++I+  D NDNAP +P  S V++ +  E   + SR   I  A DPD   N    Y L   NG++  G+  I       +  +L+  + +DREQ D Y + +  ED G+P+++ +  L + + D NDN P+F   +   + + ENA +G   + + A DAD  +N +I Y    Q A      F + N  G I V++++D +      + +VLA DG+    R T    V I V D ND  P I            V+++++DP+  + A+I            +  KD D  G+  V C +       L+ V   D ++ +   +  D E        I+  D    + +++ + ++   D NDN P F + V    V EN     +++  + A D+D+ +N+ I +Q+ G    FF +D  +G +   +V DREE E+F  T+ A+D G PP      V + V+D ND  P+F+ + ++F +SEN    ++VG +T  D D   N  +   I+  +D F  + Y                G I +    DRE+QS Y   V A D G P   +ST  V IN++DVNDN P   +  SN +   +  +   G  +  V AVD+D G N+E+ Y I  GN  G F  +     + L    +  D   H+LV++  D G P
Sbjct:   85 IFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSR-FPIPSATDPDTGFNGVQHYEL--LNGQSVFGL-DIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH-IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAI-HKVTVLASDGSSTPARAT----VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALIT-----------VSDKDTDVNGK--VICFIEREVPFHLKAVY--DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRR-GLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPY---------------SGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1b vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 231.876 bits (590), Expect = 1.766e-61
Identity = 212/722 (29.36%), Postives = 335/722 (46.40%), Query Frame = 2
Query:  506 VVTVKNRIDRESLCPN-----QINCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA---SEYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-----------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRII--SDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF--KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
            + T  NRIDRE LC       +  C   L   I P+   + + ++I+  D NDNAP +P  S V++ +  E   + SR   I  A DPD   N    Y L   NG++  G+  I       +  +L+  + +DREQ D Y + +  ED G+P+++ +  L + + D NDN P+F   +   + + ENA +G   + + A DAD  +N +I Y    Q A      F + N  G I V++++D +      + +VLA DG+    R T    V I V D ND  P I            V+++++DP+  + A+I            +  KD D  G+  V C +       L+ V   D ++ +   +  D E        I+  D    + +++ + ++   D NDN P F + V    V EN     +++  + A D+D+ +N+ I +Q+ G    FF +D  +G +   +V DREE E+F  T+ A+D G PP      V + V+D ND  P+F+ + ++F +SEN    ++VG +T  D D   N  +   I+  +D F  + Y                G I +    DRE+QS Y   V A D G P   +ST  V IN++DVNDN P      SN +   +  +   G  +  V AVD+D G N+E+ Y I  GN  G F  +     + L    +  D   H+LV++  D G P
Sbjct:   85 IFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSR-FPIPSATDPDTGFNGVQHYEL--LNGQSVFGL-DIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH-IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAI-HKVTVLASDGSSTPARAT----VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALIT-----------VSDKDTDVNGK--VICFIEREVPFHLKAVY--DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRR-GLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPY---------------SGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1b vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 231.876 bits (590), Expect = 1.899e-61
Identity = 212/722 (29.36%), Postives = 335/722 (46.40%), Query Frame = 2
Query:  506 VVTVKNRIDRESLCPN-----QINCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA---SEYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-----------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRII--SDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF--KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
            + T  NRIDRE LC       +  C   L   I P+   + + ++I+  D NDNAP +P  S V++ +  E   + SR   I  A DPD   N    Y L   NG++  G+  I       +  +L+  + +DREQ D Y + +  ED G+P+++ +  L + + D NDN P+F   +   + + ENA +G   + + A DAD  +N +I Y    Q A      F + N  G I V++++D +      + +VLA DG+    R T    V I V D ND  P I            V+++++DP+  + A+I            +  KD D  G+  V C +       L+ V   D ++ +   +  D E        I+  D    + +++ + ++   D NDN P F + V    V EN     +++  + A D+D+ +N+ I +Q+ G    FF +D  +G +   +V DREE E+F  T+ A+D G PP      V + V+D ND  P+F+ + ++F +SEN    ++VG +T  D D   N  +   I+  +D F  + Y                G I +    DRE+QS Y   V A D G P   +ST  V IN++DVNDN P      SN +   +  +   G  +  V AVD+D G N+E+ Y I  GN  G F  +     + L    +  D   H+LV++  D G P
Sbjct:   85 IFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSR-FPIPSATDPDTGFNGVQHYEL--LNGQSVFGL-DIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH-IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAI-HKVTVLASDGSSTPARAT----VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALIT-----------VSDKDTDVNGK--VICFIEREVPFHLKAVY--DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRR-GLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPY---------------SGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1b vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 167.162 bits (422), Expect = 2.223e-41
Identity = 195/695 (28.06%), Postives = 316/695 (45.47%), Query Frame = 2
Query:  446 YRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSL-NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDV----YELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEI---IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE-FQIL------AIANFDREEKSME---KVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDR--GEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG 2458
            Y + +GN   N L I+ ++ V+     +DRE+L  + I  D++     +P   S ++  + ++D+NDNAP +   S  V+  E   N      I   KA D D   N ++ Y +      + +G+  +  D ST         +V  RE++D        ++ A+D   P  + ++ L I ++D ND+ P    A+     L EN  IG     V A D D   NG I Y +E    SE F I  ++G I   K +D +   + +   V A D G P     T    + +++ D ND  P       +VT  + +     II  + + N                        + D+    ++  +D+E F IL      AI +   E K  +   +V+I   DQ      + +V   +D  +++P F    F  ++ E++ +    V  + A D D   N++I + I  +   FF+ID SSG +     LDRE+   F+V + A D   PP   +  + + + DIND  P+F+ S Y  +ISE+  +GTS   V+AID D+  N       I D F  ES    SSS   Q+ R DR  G +     LDRE+ +  +L + A D G P S ++ + + + + DVNDN PTF+  +  ++ I     VG  +GT+ A D D G+N++I ++I  G
Sbjct:  307 YSLGEGNGK-NLLAINAKSGVIQTAAPLDRETL--SLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILE---NITIPAVIATVKATDEDFGTNGKVHYSMA-----SSSGIGGLTIDYSTG--------EVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMIT-LEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTST---TIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDN------------------------DEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG-GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPI-GYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNG------IVDYFLNES----SSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLY-IAENSPVGSTVGTIVARDADEGDNADISFRIFGG 934          

HSP 2 Score: 156.762 bits (395), Expect = 4.153e-38
Identity = 159/582 (27.32%), Postives = 275/582 (47.25%), Query Frame = 2
Query:  857 ELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSI--VFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYL-LTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES--VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPP 2578
            E+   K +DRE +D + L + A +   P  + S  +++ +LD  DN PIF++  Y+  ++ E+A IG   L+V A+D D   NG+I Y + +        I   +G I     +D +  +   +  V+A D    +   T   E  I V+D ND  P   V  +    +T    I+EN  I  +V+A ++  D DFG    V  S++++  +    +  S  E  +      D +   +  V I  KD A    S ++     ++D ND++P          LE        VG V A+D+D+  N  I++ + G+E+ F   + SG + T ++LDRE T ++++ + A+D G P    +  + + + DIND  P F    Y  +ISE    G+ + T+ A+D D   + K+ YRI      +E+  +  S L       D+G I++    + ++Q H + + + A D G          V + I DVN + P F   N   FS++  E   +GY + T++A D D G+N+ IVY I+      +F  +  +  + ++S L ++D     ++++A D   PP
Sbjct:  221 EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFG-EIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRET-LSLIRLDVIASDKGTPKRESTAMVE--ITVVDVNDNAP---VFASDSYNVT----ILENITIP-AVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR--ERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRI------EEADREVFSILDIG----DQGAILS-VSGELKRQDHKVRVEISATDQG---GLQGRCVVNVFIDDVN-SAPYF---NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ---FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPP 763          

HSP 3 Score: 151.369 bits (381), Expect = 1.488e-36
Identity = 179/671 (26.68%), Postives = 306/671 (45.60%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSK-SLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE--DQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEE------HFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEE 2455
            L ID  T  VT++ RID ++   + I   I  +    P+  S   L + ++DIND+AP+     K+++  E      E   ++   A D D   N  I Y ++   G  D   + I  DS       +   K++DRE    Y L + A D G+P    S  + + + D NDN P FD+ +Y    +SE    G   +T+ A D D   + KITYRIE  D++     +IG+ G I+          +K     V     A ++    G C VV + ID+ +  P    H     P + +  I E+  I   V+  ++ +D D G    +  S+ ++   R++   PS  +  + +  + DRE+++   V +   D A    + S   +++  D NDNSP+FT   +   + E+  V   F+ +V A+D D   N  +++ +  NE         F++D +SG +     LDRE+     + I A+D G P  +    +T+ + D+ND  P F    Y+  I+EN+ +G++VGT+ A D D   N  + +RI     +K    +  +       ++    I+T+   D E +++     +   +G     +ST  V+I++ DVNDN P  K     +      + +  +IG + A D D  +N+ + Y +EE
Sbjct:  423 LTIDYSTGEVTLRERIDAKN---SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---AIDEDSGPNGIIKYSME---GSED---FIIDEDSGL-----IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVT-ISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAIL-----SVSGELKRQDHKVRVEISATDQGGLQGRC-VVNVFIDDVNSAPYFNDH-----PFSVK--IPEHSPIGYPVIT-LKAEDHDRGDNARIVYSIDSSQFFRID---PSSGDISVSS--DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFL--NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAE------QNGVVRILTRAEFDYEAKANKFFFELQASSGQ---LSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQ-MARQIGFIPAFDPD--QNATLEYFLEE 1039          

HSP 4 Score: 150.599 bits (379), Expect = 3.196e-36
Identity = 179/670 (26.72%), Postives = 285/670 (42.54%), Query Frame = 2
Query:  602 VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQI----DSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGN---PYGYFSFNTQNKKLILNSVLSKQDDHKLV--ISACDKGKP 2575
             S ++ V +LD+ DN+P + + S    F E   +     T+    A D D  EN +I+Y L + NGK    +  I   S       +     +DRE + +  L +IA D G+PKR  +  + I ++D NDN P+F    Y    L EN  I  V  TV A D D+  NGK+ Y +          I  + G + +R+ I  DA        + A DGA      T    + I VID ND  P +I           +   +E  V     +  +   D D G   I+  S+  ++   +++ S   K  ++L     DRE  +   + +  +D    +   S +I   + D NDN+P F +  +   +         +  + AVD D ++  KI ++I   +   F I    D    +     L R++  K  V I A D G     G  +V + + D+N   P F+   +   I E++ IG  V T+ A D D   N ++ Y I S +F +              I    G+I     LDRE ++ + + V A D+  P   TS T +++ + D+NDN P F TS+    +I     VG     V A+D D G N  + Y + E +       F  +  +  L ++S L ++    +V  I A D+G P
Sbjct:  252 ASTTVVVHVLDVQDNSPIFEKDSY---FGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKN---LLAINAKSGV-----IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTIL-ENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERI--DAKNSPITAVIRAKDGAQPALSST--VPLTINVIDINDHAPTLIA--------AQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLL-----DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGG--LQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR--------------IDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTS-TQIEVILDDINDNSPQF-TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP 870          

HSP 5 Score: 130.183 bits (326), Expect = 4.742e-30
Identity = 104/347 (29.97%), Postives = 166/347 (47.84%), Query Frame = 2
Query: 1457 VSCSLSNNDKMRLEQVSPSDKE----FQILAIANFDREEKSMEKVDI---LCKDQAYN------TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIE 2452
            V  S +++  +    V+P D      F +  ++   R  KSM++  +   + K  AY       +AS ++V  +LD  DNSP F +  +F  +   +     V  V A D D+  N +IE+ +  GN ++   I++ SG + T   LDRE      + ++A D G P +  T +V I VVD+ND  P F+   Y  +I EN  I   + TV A D D   N K+ Y + S           SS +    I +  GE+  +  +D  K S     + A D   P + +ST  + IN+ID+ND+ PT   + K + +++   ++G E+G V A+D D G N  I Y +E
Sbjct:  187 VKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-----------SSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIAAQKMI-TLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME 519          
BLAST of Protocadherin 1b vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 157.918 bits (398), Expect = 1.458e-38
Identity = 177/632 (28.01%), Postives = 287/632 (45.41%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDV----YELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEI---IVHVTKRDPLTNEPAIIENEVISN----SVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDR--GEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG 2458
            + + ++D+NDNAP +   S  V+  E   N      I   KA D D   N ++ Y +      + +G+  +  D ST         +V  RE++D        ++ A+D   P  + ++ L I ++D ND+ P    A+     L EN  IG     V A D D   NG I Y +E    SE F I  ++G I   K +D +   + +   V A D G P     T    + +++ D ND  P       +VT  + +     II  + + N     +   IE  D     R++ S             +     +  IL+++   + +    +V+I   DQ      + +V   +D  +++P F    F  ++ E++ +    V  + A D D   N++I + I  +   FF+ID SSG +     LDRE+   F+V + A D   PP   +  + + + DIND  P+F+ S Y  +ISE+  +GTS   V+AID D+  N       I D F  ES    SSS   Q+ R DR  G +     LDRE+ +  +L + A D G P S ++ + + + + DVNDN PTF+  +  ++ I     VG  +GT+ A D D G+N++I ++I  G
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILE---NITIPAVIATVKATDEDFGTNGKVHYSMA-----SSSGIGGLTIDYSTG--------EVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMIT-LEENVAIGEEVGRVYAIDEDSGPNGIIKYSME---GSEDFIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTST---TIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEAD-----REVFS-------------ILDIGDQGAILSVSGELKRQDHKVRVEISATDQG-GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPI-GYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNG------IVDYFLNES----SSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLY-IAENSPVGSTVGTIVARDADEGDNADISFRIFGG 575          

HSP 2 Score: 150.984 bits (380), Expect = 2.321e-36
Identity = 179/671 (26.68%), Postives = 306/671 (45.60%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSK-SLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE--DQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEE------HFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEE 2455
            L ID  T  VT++ RID ++   + I   I  +    P+  S   L + ++DIND+AP+     K+++  E      E   ++   A D D   N  I Y ++   G  D   + I  DS       +   K++DRE    Y L + A D G+P    S  + + + D NDN P FD+ +Y    +SE    G   +T+ A D D   + KITYRIE  D++     +IG+ G I+          +K     V     A ++    G C VV + ID+ +  P    H     P + +  I E+  I   V+  ++ +D D G    +  S+ ++   R++   PS  +  + +  + DRE+++   V +   D A    + S   +++  D NDNSP+FT   +   + E+  V   F+ +V A+D D   N  +++ +  NE         F++D +SG +     LDRE+     + I A+D G P  +    +T+ + D+ND  P F    Y+  I+EN+ +G++VGT+ A D D   N  + +RI     +K    +  +       ++    I+T+   D E +++     +   +G     +ST  V+I++ DVNDN P  K     +      + +  +IG + A D D  +N+ + Y +EE
Sbjct:   64 LTIDYSTGEVTLRERIDAKN---SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---AIDEDSGPNGIIKYSME---GSED---FIIDEDSGL-----IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVT-ISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAIL-----SVSGELKRQDHKVRVEISATDQGGLQGRC-VVNVFIDDVNSAPYFNDH-----PFSVK--IPEHSPIGYPVIT-LKAEDHDRGDNARIVYSIDSSQFFRID---PSSGDISVSS--DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFL--NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAE------QNGVVRILTRAEFDYEAKANKFFFELQASSGQ---LSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQ-MARQIGFIPAFDPD--QNATLEYFLEE 680          

HSP 3 Score: 81.6481 bits (200), Expect = 3.255e-15
Identity = 57/174 (32.76%), Postives = 86/174 (49.43%), Query Frame = 2
Query: 1931 LVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIE 2452
            +V I VVD+ND  P F+   Y  +I EN  I   + TV A D D   N K+ Y + S           SS +    I +  GE+  +  +D  K S     + A D   P + +ST  + IN+ID+ND+ PT   + K + +++   ++G E+G V A+D D G N  I Y +E
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-----------SSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIAAQKMI-TLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME 160          
BLAST of Protocadherin 1b vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 156.377 bits (394), Expect = 5.774e-38
Identity = 199/728 (27.34%), Postives = 319/728 (43.82%), Query Frame = 2
Query:  527 IDRESLCPNQIN---------CDIMLRFFISPSYVSKSLN------------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEII---VHVTKRD-PLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCS-LSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTA--SKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDRE--ETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDR--GEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSF-----NTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCS 2587
            I   +LCP Q +         C I+ R   S  ++   L             + I DINDNAP W      +S    +G    SRT+    A DPD+ +N  I Y + D           +  D  T R   +     ID       +  + AED GSP  +  L+++  +LD     P F++A +   ++ E+  IG   + V A ++    + +I Y +++Q   E+  +   +G + ++K  D++   K +Q +V+A +   E    T    + I + D ND  P       H+T R+ P   EP ++            +   D D G    VS   LS +    +  V+      + LA   F         + +  KD    ++  S +I   ++D++  +P+F+R  +  R  E+  +P + +G V A+       SK+++ I  G+++H F ID  +GK+Y  + LD +  +T   N+      G    ++    V I + D ND  P+FS SL E SI E+  +      V A D+D   N +++Y IIS             S P   I  D+  G++ T  LLD E   +Y L V A D G P   +S  T+ I+++DVNDN P F+ S  T+  ++ +      +G V A D D  EN +IVY+I  G+   YF       N   K+ I   V+S  D   + I A DKG PP+ S
Sbjct:  377 IGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGG---SRTL---TAKDPDLGQNGWIRYSVLDTE--------LVSIDKETGR---IFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQV-EIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQD--EHLTVDTMSGTVCIQKTFDFEKQ-KSYQTTVIATNANSE----TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLV------------VSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGRF--------HLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDI-LPGIAIGSVGAM-------SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSG----ESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIIS-------------SHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIP-PRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTI-VGKVVARDKDSLENGQIVYRITNGSE--YFGIDEKLGNVYTKRSIDREVISHVD---ISIVAEDKGVPPRSS 1027          

HSP 2 Score: 142.895 bits (359), Expect = 6.864e-34
Identity = 170/666 (25.53%), Postives = 287/666 (43.09%), Query Frame = 2
Query:  620 VEILDINDNAPSWPQQSKVVSFTEFE--GNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRI------ELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA--SEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEI-IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDP--DFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKG 2569
            VE+ D NDNAPS+  Q   +  +EF   G      T+        DV+      + +   N    N V+K+      SR++      +L+    +DRE  D YEL++ A+D G P + G L   I+I+D NDN P+F R++Y A+ +S N +IG   +TV A DAD   N +I+Y I+   A  +  F I  +G I    ++            V+A D G+P     +    V I V+      P + I+ + +    +N   ++EN  +  S++A + +     D   R I S +L         Q +     + +L     DRE  S   +  L +           +  I D NDN+P++ +   H  +               A D D  +N  I + ++  E     ID  +G+++    +D     +    + A+DGG P  +    V  +++D     P+F  +L++  I E+  IGT +  V A +     + +++Y +     +++ +    +           G +  +   D EKQ  Y  TV+A +    NS TST+ + I + DVNDN+P F   N+   +++        +  V A D+D G   E+ Y I   +    FS N    ++     L++   H LV+SA D G
Sbjct:  110 VEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHR-----FVILQGNV---NNVFKL-----ASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTAS-VSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASL---LPASTHDVIVVASDHGSPS---LSSSAVVTITVLGSTLSSPPLDIIWLVE----SNSAHLMENSTL-GSIVARVSIAQQYRDTKLRLIGSSAL-------CPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTLT----AKDPDLGQNGWIRYSVLDTE--LVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ----NQDEHLTVDTM---------SGTVCIQKTFDFEKQKSYQTTVIATN---ANSETSTSLISIRLKDVNDNWPIFY-PNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSES--SSFSINPVTGEVFAQKPLARGRFH-LVVSAKDGG 717          

HSP 3 Score: 135.576 bits (340), Expect = 1.221e-31
Identity = 157/588 (26.70%), Postives = 262/588 (44.56%), Query Frame = 2
Query:  872 KVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKG-FQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEE-HFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPK---CSNPLWVT 2605
            K  D E+   Y+  +IA +  S   T  +   I++ D NDN PIF   +Y+   + E        L VSA D D    G+++Y I  + +S  F+I    G +  +K +      +G F   V A DG  +    +    + I VID++ + P+     +K +  T E            +L  I +     G    V  S+ + D+      S  +   +I      D +      ++I     +  +    +V  I D NDN P+F+  +    + E+  +   F   V A DKD ++N ++ + II +      +ID  +G++ T  +LD E T  + + + A D G PP++    + I V+D+ND  PEF  S Y   + EN+   T VG V A D+D   N ++ YRI +       YF     L         G + TK  +DRE  SH  +++VA D G P   +ST + +I+++DVNDN P+  +    V  +     +   IGT+ A+D D G N  ++Y+ +  +    F   + N  + L   L+  D+   +L +   D+G P K   C  P+ ++
Sbjct:  599 KTFDFEKQKSYQTTVIATNANSETSTSLIS--IRLKDVNDNWPIFYPNEYHLT-VREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS--FSINPVTGEVFAQKPL-----ARGRFHLVVSAKDGGGQSSENS--ANIHITVIDKDTKTPQF--SRSKYEIRTTE-----------DILPGIAIGS--VGAMSKVKYSIYSGDQDH--NFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFY-VVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG----SEYFGIDEKL---------GNVYTKRSIDREVISHVDISIVAEDKGVP-PRSSTASARISVLDVNDNPPSCLSITPIV--VPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQS--SLFVVKS-NGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRIS 1137          

HSP 4 Score: 99.7525 bits (247), Expect = 1.100e-20
Identity = 164/709 (23.13%), Postives = 285/709 (40.20%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFI------SPSYVSKSLNVEILDINDNAPSWPQQS--------KVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFL-KDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDEND----EKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKM-RLEQVSPSDKE------FQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKM----YTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDW---KPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQ---SHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEE 2455
            +Y I +GN + +   +D E  V+     +DRE          I+ R+ +      S   +   ++V + ++NDN PS+P           +V S+    G K              DV+  + + YFL  D +G+T         D  T       P+   D E +  + L + A D      T    L I + D NDN P F +  Y         + G     + A D D  A G +TY +  Q +S  F +      +  K +   AG + +  +V A D     +  +    V+I   +  D    EK E    V +   +  +   +  E    S   H  ++DP+       +  + + DK  RL    P D+E      FQ+      D E  + +KV   C               +LD NDN P FT V ++  L+++      +G++MA D+D+  N ++ ++I+ GN+ +   ++  +G +    +    LD      + + + A+D G P +   G V +  + ++ W    P F L +YE  + E+  +GT +  + A +R    N  + Y +      KE   +         I    GE+  K  LD E +   S YL    ++ +G  N  ++   +KI +  V++  P F  S+ T   I  +   G  +G ++A+D D G +  + Y I +
Sbjct: 1862 TYSIVEGN-IDSAFSVDSEG-VIRTNLELDRE----------ILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAK--------------DVDNLAPLRYFLVSDSSGQTPT---HFNIDQFTGTIHLTAPL---DFEVLPEHTLTIKATDGSFDTFT---NLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSL-GQGSSSIFRVAPESGALFMKVLP-PAGER-YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGE---ESREFHYRIQDPE-------ASKIFSIDKFGRLFVAGPIDREQRATHEFQV----EIDNEMMTSQKVQCKCH------------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVS-LKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSL------KEHQGKLG-------IDVKTGELTLKTHLDWESEPIISMYL----SVSDG--NGRSAVVPLKIVVEPVDEFAPVFTKSSYT-LQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISD 2483          

HSP 5 Score: 92.0485 bits (227), Expect = 2.349e-18
Identity = 83/272 (30.51%), Postives = 127/272 (46.69%), Query Frame = 2
Query: 1514 DKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-------SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINII 2302
            ++  +I  IA+ D E++S  K DI+      +  +  I+ ++ D NDN+P F  +V    + E A +   F    +  D D  +     F I+ GN  + F++ S          +     LDRE  +K+ + I A+DGG P K G    +IE++D ND  P FS S Y  S+S N  IG+ + TV A D D+  N+++ Y I        S F  S S          G I T   L     S + + VVA D+G P S +S+  V I ++
Sbjct:   73 ERSGEISTIAHLDYEKRS--KFDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVT-DGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQS----------GVITTTASL--LPASTHDVIVVASDHGSP-SLSSSAVVTITVL 328          

HSP 6 Score: 80.8777 bits (198), Expect = 5.498e-15
Identity = 86/359 (23.96%), Postives = 155/359 (43.18%), Query Frame = 2
Query: 1541 ANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASV-PNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDW-KPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDR-GEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDH------KLVISACDKGKPPKCS 2587
            A  D E      + I   D +++T +   +F + D NDN+P F++  +   +  A+  P     ++ A D DA     + + +       F++   SG ++ K +      E++ VT+ A D G P  + +  V++ + +     KP F  + + F + EN+ IG  +G ++  +     + +  YRI     SK             +   D+ G +     +DRE+++ +   V  IDN    S        + ++D NDN P F TS     S++ + + G +IG + A D D GEN  + Y+I  GN     + N     + LN     Q D       ++++ A D G P + +
Sbjct: 1988 APLDFEVLPEHTLTIKATDGSFDTFTNLTIF-VSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDAR--GALTYSLGQGSSSIFRVAPESGALFMKVL--PPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEE-----SREFHYRIQDPEASK-------------IFSIDKFGRLFVAGPIDREQRATHEFQV-EIDNEMMTSQKVQCKCHVIVLDENDNLPVF-TSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAA 2321          

HSP 7 Score: 72.0182 bits (175), Expect = 2.691e-12
Identity = 155/642 (24.14%), Postives = 257/642 (40.03%), Query Frame = 2
Query:  587 ISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGP----IFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMV----IDENDEKP-EIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSME-KVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGK-MYTKQVLDREET-------EKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTA-IDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIE 2452
            I P   + +L + +LD+NDNAP + +    +   E   N      +    A D D  EN QI Y +   NG    G+ +   +  T R         IDRE +   ++ ++AED G P R+ +    I +LD NDN P    I        + LS    IG    T+ A D D   NG + YR + Q  S  F + +NG++ +R+ ++  +  +  + SV+  D G P   RK+  C V + +     D   ++P +  + + K  P       +    +S+ ++   E+ +  F  R+ V   +S+          P  +    L I   D+ ++    ++ +L   +A N   K    +I D N    K  R                +GE  A       +    ++    E    ++D +G  +Y    L R +T       EKFN T    DG          V +E+      KP F       +I E+   G+ + TV A +  D  +    ++ ++ D FS + +                G+I     L       Y L V A  +G P    +T  V +N+ DVND+ P F  S  TV  + ++   G  +  V A+DLD  ++ EI Y ++
Sbjct:  919 IPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLE---NSPPKTIVGKVVARDKDSLENGQIVYRIT--NGSEYFGIDEKLGNVYTKRS--------IDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLS--TAIG----TIVAMDPDKGLNGSVLYRAQLQ--SSLFVVKSNGDVYLRRQLNA-SDERHQRLSVIVSDQGVP---RKSVVCHVPVRISKGSADIQIQEPFQKYIEIPKSCPTGCRLTTLNATGVSSWLIQSSEISN-HFAIREGVLFMISH----------PIHRPPYSLVIVLSDKNDRQKSIQLRVLASGEAAN---KEETIRISDSNSIGTKIGR----------------LGEKSA-------DGSFFYRFSSEESCPLELDQTGGLLYLADGLRRGDTHNFSCFFEKFNTT----DGSAEEMR----VDLEISRTKSDKPRFDTGHLRVNIREDTPTGSIITTVNATVSDDSASPISYRFPLLIDNFSIDQF---------------TGDITLIDTLHWHVTPTYNLIVEAFTSG-PG---TTLLVTVNVDDVNDHTP-FIVSQPTVL-LPSSYRKGGMVHRVVAIDLD--KDPEIRYSLK 1467          

HSP 8 Score: 61.2326 bits (147), Expect = 5.368e-9
Identity = 44/162 (27.16%), Postives = 74/162 (45.68%), Query Frame = 2
Query: 2090 RIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKP 2575
            RI++   ++ES F++  + P   I    G I +   LDRE    +LL ++  D G  N    + TV++ + D NDN P    S  +   I  +  VG  +    A D+D G+N +  +++ E +  G      +   L+L  + S Q   K+ +   D G P
Sbjct: 1652 RILATGMTEESRFRFQGNAPKFSINSTTGSI-SVLPLDREASQEHLLIIILTDGGSRND---SCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLE-DSSGSLDLVPETGDLVLRRLSSLQ-SWKIKLRVVDHGVP 1807          
BLAST of Protocadherin 1b vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 144.05 bits (362), Expect = 3.057e-34
Identity = 187/737 (25.37%), Postives = 319/737 (43.28%), Query Frame = 2
Query:  443 SYRIFDGN----KLLNCLHIDPETHVVTVKNRIDRESLCP--NQINCDIMLR------FFISPSYVS-KSLNVEILDINDNAPSWPQQSKVVSFTE-FEGN-KLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELM----------PIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE-DQKASE-------YFNIGN--NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIV-----SCSLSNNDKMRLEQVSP---SDKEFQILAIANFDREEKSMEKVDILCKDQAYNTAS-KSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGE--------VMAVDKDAER-NSKIEFQII----GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKD-------GGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGE-NSEIVYQIE 2452
            +Y   D N    + +N   ID  T +V +++ +    L    N IN  ++++       + S ++ S  +L + I D+N+N P +P  +K     +  EG  K +  TI   +A D D + N  I              V+ + Y  S SR+  ++          P  V DRE     ++ + A D G     G  +  ++++D NDN P F+R   Y   +S    +G   +TV A D D   N +ITY +E D  A E       +F + N  +G I + K I      + F F+V+A D G PE  + +   +V + V+D+  + P+       +  +T    + EN  ++  +L    V   D    D++     S    N  + +  Q +     ++  +++ +   D E+ +   + +   D     AS K+ V ++ D ND  P+FT       ++    PN  + +        V A+D D++   +++ ++I+    G E   F+ID  +G+++  +  DRE+ + + +T+ A D       G + P      V I + D+ND  P F    Y   + E+ G G  V T+ A   DL  ++ ++Y +I               +PF  +R D G I  K  LD E    Y L ++A D  H     +TT V I+I DVNDN P F+        I+    +   +  V A D D  E +S IVY++E
Sbjct:  781 TYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDI--------------VYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPS-YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK--TQKFIFNVIADDNGIPEALQSS--AQVTLNVLDKQQKAPKWQTSPDCKPGIT----VDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKA--HDLDKHSNLRYHLIG---------AGGGRIPFG-VRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH----NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLE 1478          

HSP 2 Score: 132.88 bits (333), Expect = 8.117e-31
Identity = 165/595 (27.73%), Postives = 258/595 (43.36%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADY-LANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYD--AGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKP----EIIVHVTK-RDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKM-RLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK----SIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQI--------DSSGKMYTKQVLDREET---EKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP 2323
            + + I D+NDNAPS+ +Q  +    E EG   +  TI   KA D D + N +  + +    G+   GV   + DS T     +   + +D E  D Y L+LIA D    +   +  + I I D NDN P F++ KY    + E+ +I  V   V A DAD    + +I YR+E Q A E F IG  +G I + K +D D  AGV  + F V AID   +     G  +V + V D ND  P     +  ++ + R+P+ ++     +    +      E  + ++G   IV   L N + + R++Q        +I A+ + DRE  S  +  I  +       S+    ++  ++ D NDN+P F +  +   +E  +     V    A D D E    +    +  E  +F +         S G +  KQ LD E+    + F++ I   DG    +     V + +VD ND  P       E  + E+   GTS+G  TA DRD  A    ++RI      K  +           I  D G +   + LDRE  + Y L + A DN   ++      V + + DVNDN P
Sbjct: 1321 VQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITI---KAHDLDKHSNLRY-HLIGAGGGRIPFGV---RTDSGT-----IFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDD--DGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYG---IVRNKLINGESVFRIDQ-----NTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRD--AGDTARFRINRQSDPKRQF----------TIDQD-GTLRVAHTLDREDIAVYNLIIEAYDN---SNNIGRQMVAVYLQDVNDNGP 1870          

HSP 3 Score: 125.561 bits (314), Expect = 1.263e-28
Identity = 146/548 (26.64%), Postives = 242/548 (44.16%), Query Frame = 2
Query:  923 EDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKG---FQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNND-----KMRLEQVSPSDKEFQI---LAIANFDREEKSMEKVDILCKDQA-------YNTASKSIVFQILDRNDNSPKFTRVFHF----RVLENA--SVPNMFVGEVMAVDKDAERNSKIEFQII---GNEEHFFQIDSSGKMYTKQ---VLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLP-FQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE--IGTVEAVDLDFGENSEIVYQI-EEGNP 2464
            EDN    R   ++L I+I D NDN P F R  Y A ++ E+  +    L V+A D D   N +ITY +++      F+I +NG I  +  +D D   +    ++F+V A D   E    +    + I   + NDE    +       P +   A +  +    + +  I+ +D D   RD V+ S  + +     KM L  +       ++   ++ A+    E  +    I+  D +        +T+  +++  I D N+N P+F     +    +++E    + P   V +V A D D+  N  I + +          F ID    + T     V DRE   + +VT+ A D GD P  G    ++EVVDIND  P+F    YE S+S    +GTSV TV A D D   N ++ Y +  D  + E   ++ + L  F+++    GEI     +  + Q  ++  V+A DNG P +  S+  V +N++D     P ++TS      I   E+V     I    AV      NS+++Y++   G P
Sbjct:  619 EDN----RESHVDLTIRIDDVNDNVPTFTRPLYTA-QVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN----FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHG-EPVSLSSSAMIHIRTENTNDESAVFL-------PTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGE---EHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGP 1141          

HSP 4 Score: 113.235 bits (282), Expect = 8.961e-25
Identity = 185/712 (25.98%), Postives = 311/712 (43.68%), Query Frame = 2
Query:  605 SKSLNVEILDINDNAPSWPQQSKVVSFT-----EFEGN----KLESRTIHIDKAFDPDVN-ENSQIDY-FLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGS-------LELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEY-FNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDR------------------NDNSPKF-TRVFHFRVLENASVP----NMFVGEVMAVDKD--AERNSKIEFQIIGNE----EHFFQID-SSGKMYTKQVLDRE--ETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKES-YFQYSSSLPFQMIRHDRGEIVTKYLLDRE---KQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQI-EEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACD 2563
            +K+  VE+ D+ND  P    Q  V  FT     E   N    K   + I   KA D D +   +++ Y  + + NG+        + D  T    E+ P +  DRE++D+Y L + A D       G+       +++ I I D NDN P F+  KY   ++ E+   G   +T+ A D D  +N  + Y +         F +  ++G I V++ +D++A  + +   ++A DG     R      V I + D ND  P+        +       +IE +V    VL ++   D D   +D  S  +      RLE    +D+ F+I       +   ++E V  L +D      S + V Q +D                   NDNSP F  R+F +  +E    P     ++  +V A D D     N+ IE+ I+ N+    E  F+ID ++GK++  + LDRE     +F + + A D G P + G   VTI+V D+ND  P F  + YE S+ E A IG +V + +A D    A+ + K  + + + S+ES YF  ++    +  +   G +  K  LD E   ++  + L +   D  H     +   V + ++D ND+ P    +  T   ++     G  IG   A D D G+ +   ++I  + +P   F+ + Q+  L +   L ++D   + L+I A D
Sbjct: 1194 TKTFVVEVRDVNDVVP----QFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETK---HFRIDELTG---EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIG-RVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQ-YHLVLIASDG-----RHNATTNVYIHIEDVNDNAPQF-------EQQKYATTVIEEDVDIPKVLFNVHATDAD---QDEKSSRIV----YRLEGQG-ADEVFRI------GKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY--IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFD----ADEEAKDNVFTYQLSEESDYFYVTTDKDSK--QSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH----DAEAAVHVALVDRNDHAPHIHGA--TEHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 5 Score: 92.0485 bits (227), Expect = 2.348e-18
Identity = 179/768 (23.31%), Postives = 307/768 (39.97%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRID-RESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELI-IQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEE--------YRKTGECEV------------VIMVIDENDEKPEI--------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN---FDREEKSMEKVDILCKDQAYNTASKSIVF--QILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI----IGNEEH-----FFQI--DSSGKMYTKQVLDREETEKFNVTILAKDGGDPPK-TGTGLVTIEVVDINDWKPEFSLS---LYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRF---SKESYFQYSSSLPFQMIRHDRG----EIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV----------GYEIGTVEAVDLDF-GENSEIVYQI---EEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDK 2566
              IDP T ++ +   +D  +   P      +  R     S+V   L + I D+NDN P++   ++ +   +   +   ++TI    A D D  +NS+I Y         DN  + I  +   S ++ L   ++ +R    VY   + A D+G P    S  +I I+  + ND   +F     Y   ++E+A  G   + + A+DAD     ++TY   D+        G +   M   +ID   G+   +  V A D A  E         +  G C V            +I + D N+ KPE         I  + +    T+ P I++ E   +   A+           DIV        + R   V   D++  +L  +    FDRE +  E V +   D+          F  +++D NDNSP+F R  +   +         V  V A D DA  N++I + +       EEH     FF++    SG++   + +   +T+KF   ++A D G P     +  VT+ V+D     P++  S       ++ EN  +   +    A+      N+ + Y++ +        ES F+       Q  + + G    E+V    LD E+ ++Y LT+ A D    +   ST T  + + DVND  P F      +F+    E +          G  I TV+A+D D  G  +E+ Y+I     G    +F  +    ++  N    ++  D + L + A D+
Sbjct:  585 FRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVD--LTIRIDDVNDNVPTF---TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITY-------SVDNHNFSINSNGEISAKVRLDADQLNERHF--VYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKN-------GRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSAN----------GDIVYSLYYTQSESRKAFV--IDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFR-------QFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQFTVD---LFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDR 1303          

HSP 6 Score: 81.6481 bits (200), Expect = 3.851e-15
Identity = 126/477 (26.42%), Postives = 202/477 (42.35%), Query Frame = 2
Query:  620 VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNE-NSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDRE---QVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIF-DRAKYYANKLSENANI-GFVALTVSAKDAD--YLANGKITYRIEDQK---ASEYFNIG-NNGNIMVRKNIDYD-AGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVL-AHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKD---------QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVP-NMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPE 1975
            + I D+NDNAP + QQ    +  E E   +     ++  A D D +E +S+I Y L+   G+  + V++I   S T   IEL  +K +DR+    V  +  ++ A D+      G  ++ + + D NDN PIF +R   Y  +  E  +  G   + V A+D D     N  I Y I   K       F I  N G I   +++D + +  + F   V A D G P    + G   V I V D ND  P      T+ +    E A I   V+S S   A  E KD      ++ +  LS              K+  +  +    R ++ ++  D+  +D            + A  ++   ++DRND++P        RV E+  VP    +G   A D+DA   ++       + +  F ID  G +     LDRE+   +N+ I A D  +    G  +V + + D+ND  PE
Sbjct: 1424 IHIEDVNDNAPQFEQQKYATTVIE-EDVDIPKVLFNV-HATDADQDEKSSRIVYRLE---GQGADEVFRIGKYSGT---IEL--VKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPS---REGFANVTIKVTDMNDNAP--FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKD------NVFTYQLSEESDYFYVTTDKDSKQSSVGVL----RVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVRED--VPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPE 1871          
BLAST of Protocadherin 1b vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 144.05 bits (362), Expect = 3.057e-34
Identity = 187/737 (25.37%), Postives = 319/737 (43.28%), Query Frame = 2
Query:  443 SYRIFDGN----KLLNCLHIDPETHVVTVKNRIDRESLCP--NQINCDIMLR------FFISPSYVS-KSLNVEILDINDNAPSWPQQSKVVSFTE-FEGN-KLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELM----------PIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE-DQKASE-------YFNIGN--NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIV-----SCSLSNNDKMRLEQVSP---SDKEFQILAIANFDREEKSMEKVDILCKDQAYNTAS-KSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGE--------VMAVDKDAER-NSKIEFQII----GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKD-------GGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGE-NSEIVYQIE 2452
            +Y   D N    + +N   ID  T +V +++ +    L    N IN  ++++       + S ++ S  +L + I D+N+N P +P  +K     +  EG  K +  TI   +A D D + N  I              V+ + Y  S SR+  ++          P  V DRE     ++ + A D G     G  +  ++++D NDN P F+R   Y   +S    +G   +TV A D D   N +ITY +E D  A E       +F + N  +G I + K I      + F F+V+A D G PE  + +   +V + V+D+  + P+       +  +T    + EN  ++  +L    V   D    D++     S    N  + +  Q +     ++  +++ +   D E+ +   + +   D     AS K+ V ++ D ND  P+FT       ++    PN  + +        V A+D D++   +++ ++I+    G E   F+ID  +G+++  +  DRE+ + + +T+ A D       G + P      V I + D+ND  P F    Y   + E+ G G  V T+ A   DL  ++ ++Y +I               +PF  +R D G I  K  LD E    Y L ++A D  H     +TT V I+I DVNDN P F+        I+    +   +  V A D D  E +S IVY++E
Sbjct:  781 TYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDI--------------VYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPS-YETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK--TQKFIFNVIADDNGIPEALQSS--AQVTLNVLDKQQKAPKWQTSPDCKPGIT----VDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKA--HDLDKHSNLRYHLIG---------AGGGRIPFG-VRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH----NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLE 1478          

HSP 2 Score: 132.88 bits (333), Expect = 8.117e-31
Identity = 165/595 (27.73%), Postives = 258/595 (43.36%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADY-LANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYD--AGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKP----EIIVHVTK-RDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKM-RLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK----SIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQI--------DSSGKMYTKQVLDREET---EKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP 2323
            + + I D+NDNAPS+ +Q  +    E EG   +  TI   KA D D + N +  + +    G+   GV   + DS T     +   + +D E  D Y L+LIA D    +   +  + I I D NDN P F++ KY    + E+ +I  V   V A DAD    + +I YR+E Q A E F IG  +G I + K +D D  AGV  + F V AID   +     G  +V + V D ND  P     +  ++ + R+P+ ++     +    +      E  + ++G   IV   L N + + R++Q        +I A+ + DRE  S  +  I  +       S+    ++  ++ D NDN+P F +  +   +E  +     V    A D D E    +    +  E  +F +         S G +  KQ LD E+    + F++ I   DG    +     V + +VD ND  P       E  + E+   GTS+G  TA DRD  A    ++RI      K  +           I  D G +   + LDRE  + Y L + A DN   ++      V + + DVNDN P
Sbjct: 1321 VQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITI---KAHDLDKHSNLRY-HLIGAGGGRIPFGV---RTDSGT-----IFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDD--DGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYG---IVRNKLINGESVFRIDQ-----NTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRD--AGDTARFRINRQSDPKRQF----------TIDQD-GTLRVAHTLDREDIAVYNLIIEAYDN---SNNIGRQMVAVYLQDVNDNGP 1870          

HSP 3 Score: 125.561 bits (314), Expect = 1.263e-28
Identity = 146/548 (26.64%), Postives = 242/548 (44.16%), Query Frame = 2
Query:  923 EDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKG---FQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNND-----KMRLEQVSPSDKEFQI---LAIANFDREEKSMEKVDILCKDQA-------YNTASKSIVFQILDRNDNSPKFTRVFHF----RVLENA--SVPNMFVGEVMAVDKDAERNSKIEFQII---GNEEHFFQIDSSGKMYTKQ---VLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLP-FQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE--IGTVEAVDLDFGENSEIVYQI-EEGNP 2464
            EDN    R   ++L I+I D NDN P F R  Y A ++ E+  +    L V+A D D   N +ITY +++      F+I +NG I  +  +D D   +    ++F+V A D   E    +    + I   + NDE    +       P +   A +  +    + +  I+ +D D   RD V+ S  + +     KM L  +       ++   ++ A+    E  +    I+  D +        +T+  +++  I D N+N P+F     +    +++E    + P   V +V A D D+  N  I + +          F ID    + T     V DRE   + +VT+ A D GD P  G    ++EVVDIND  P+F    YE S+S    +GTSV TV A D D   N ++ Y +  D  + E   ++ + L  F+++    GEI     +  + Q  ++  V+A DNG P +  S+  V +N++D     P ++TS      I   E+V     I    AV      NS+++Y++   G P
Sbjct:  619 EDN----RESHVDLTIRIDDVNDNVPTFTRPLYTA-QVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN----FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHG-EPVSLSSSAMIHIRTENTNDESAVFL-------PTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV-KVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGE---EHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGP 1141          

HSP 4 Score: 113.235 bits (282), Expect = 8.961e-25
Identity = 185/712 (25.98%), Postives = 311/712 (43.68%), Query Frame = 2
Query:  605 SKSLNVEILDINDNAPSWPQQSKVVSFT-----EFEGN----KLESRTIHIDKAFDPDVN-ENSQIDY-FLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGS-------LELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEY-FNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDR------------------NDNSPKF-TRVFHFRVLENASVP----NMFVGEVMAVDKD--AERNSKIEFQIIGNE----EHFFQID-SSGKMYTKQVLDRE--ETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKES-YFQYSSSLPFQMIRHDRGEIVTKYLLDRE---KQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQI-EEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACD 2563
            +K+  VE+ D+ND  P    Q  V  FT     E   N    K   + I   KA D D +   +++ Y  + + NG+        + D  T    E+ P +  DRE++D+Y L + A D       G+       +++ I I D NDN P F+  KY   ++ E+   G   +T+ A D D  +N  + Y +         F +  ++G I V++ +D++A  + +   ++A DG     R      V I + D ND  P+        +       +IE +V    VL ++   D D   +D  S  +      RLE    +D+ F+I       +   ++E V  L +D      S + V Q +D                   NDNSP F  R+F +  +E    P     ++  +V A D D     N+ IE+ I+ N+    E  F+ID ++GK++  + LDRE     +F + + A D G P + G   VTI+V D+ND  P F  + YE S+ E A IG +V + +A D    A+ + K  + + + S+ES YF  ++    +  +   G +  K  LD E   ++  + L +   D  H     +   V + ++D ND+ P    +  T   ++     G  IG   A D D G+ +   ++I  + +P   F+ + Q+  L +   L ++D   + L+I A D
Sbjct: 1194 TKTFVVEVRDVNDVVP----QFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETK---HFRIDELTG---EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIG-RVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQ-YHLVLIASDG-----RHNATTNVYIHIEDVNDNAPQF-------EQQKYATTVIEEDVDIPKVLFNVHATDAD---QDEKSSRIV----YRLEGQG-ADEVFRI------GKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY--IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFD----ADEEAKDNVFTYQLSEESDYFYVTTDKDSK--QSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH----DAEAAVHVALVDRNDHAPHIHGA--TEHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 5 Score: 92.0485 bits (227), Expect = 2.348e-18
Identity = 179/768 (23.31%), Postives = 307/768 (39.97%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRID-RESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELI-IQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEE--------YRKTGECEV------------VIMVIDENDEKPEI--------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN---FDREEKSMEKVDILCKDQAYNTASKSIVF--QILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI----IGNEEH-----FFQI--DSSGKMYTKQVLDREETEKFNVTILAKDGGDPPK-TGTGLVTIEVVDINDWKPEFSLS---LYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRF---SKESYFQYSSSLPFQMIRHDRG----EIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV----------GYEIGTVEAVDLDF-GENSEIVYQI---EEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDK 2566
              IDP T ++ +   +D  +   P      +  R     S+V   L + I D+NDN P++   ++ +   +   +   ++TI    A D D  +NS+I Y         DN  + I  +   S ++ L   ++ +R    VY   + A D+G P    S  +I I+  + ND   +F     Y   ++E+A  G   + + A+DAD     ++TY   D+        G +   M   +ID   G+   +  V A D A  E         +  G C V            +I + D N+ KPE         I  + +    T+ P I++ E   +   A+           DIV        + R   V   D++  +L  +    FDRE +  E V +   D+          F  +++D NDNSP+F R  +   +         V  V A D DA  N++I + +       EEH     FF++    SG++   + +   +T+KF   ++A D G P     +  VT+ V+D     P++  S       ++ EN  +   +    A+      N+ + Y++ +        ES F+       Q  + + G    E+V    LD E+ ++Y LT+ A D    +   ST T  + + DVND  P F      +F+    E +          G  I TV+A+D D  G  +E+ Y+I     G    +F  +    ++  N    ++  D + L + A D+
Sbjct:  585 FRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVD--LTIRIDDVNDNVPTF---TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITY-------SVDNHNFSINSNGEISAKVRLDADQLNERHF--VYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKN-------GRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSAN----------GDIVYSLYYTQSESRKAFV--IDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFR-------QFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQFTVD---LFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDR 1303          

HSP 6 Score: 81.6481 bits (200), Expect = 3.851e-15
Identity = 126/477 (26.42%), Postives = 202/477 (42.35%), Query Frame = 2
Query:  620 VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNE-NSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDRE---QVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIF-DRAKYYANKLSENANI-GFVALTVSAKDAD--YLANGKITYRIEDQK---ASEYFNIG-NNGNIMVRKNIDYD-AGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVL-AHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKD---------QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVP-NMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPE 1975
            + I D+NDNAP + QQ    +  E E   +     ++  A D D +E +S+I Y L+   G+  + V++I   S T   IEL  +K +DR+    V  +  ++ A D+      G  ++ + + D NDN PIF +R   Y  +  E  +  G   + V A+D D     N  I Y I   K       F I  N G I   +++D + +  + F   V A D G P    + G   V I V D ND  P      T+ +    E A I   V+S S   A  E KD      ++ +  LS              K+  +  +    R ++ ++  D+  +D            + A  ++   ++DRND++P        RV E+  VP    +G   A D+DA   ++       + +  F ID  G +     LDRE+   +N+ I A D  +    G  +V + + D+ND  PE
Sbjct: 1424 IHIEDVNDNAPQFEQQKYATTVIE-EDVDIPKVLFNV-HATDADQDEKSSRIVYRLE---GQGADEVFRIGKYSGT---IEL--VKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPS---REGFANVTIKVTDMNDNAP--FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKD------NVFTYQLSEESDYFYVTTDKDSKQSSVGVL----RVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVRED--VPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPE 1871          
BLAST of Protocadherin 1b vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 236.113 bits (601), Expect = 1.350e-62
Identity = 212/726 (29.20%), Postives = 345/726 (47.52%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYD--SSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQK-------ASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG--GRDIVSCSLSNN-DKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQM-IRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSN------KTVFSIQTTESVGYE--IGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILN----SVLSKQDDHKLVISACDKGK 2572
            +DP T  V     +DRE +   + + D+++     P+Y  + + +++LD+NDN+P +P+ S  +SF+E   +      + +D A D DV EN   D + +   G  DN    +     S  +  + L     +DRE    Y+L + A D GSP R G L++ + ILD NDN PIFD + Y  + L+E A  G   +TV A D D   N KITY + + +        +   +     N   + N+   A  K   F+V A D G+P   R+ G   V + ++D ND  P I        P   + A ++   ++ +V+A + VKD D G  GR  V     N     RLE+ +    +  I+ +    DREE     + ++  DQ     T +  ++  + D ND+ P F +  +  VL   +    FV  + A D+D   N+++ + I+ GNE  +F +D  +G + T   LDRE  +   ++I A+DGG  PK     + + ++D ND  P+FS      ++ E+A   T V  +TA D D   N  + + +     S E  +      P Q  +    G++ T+  LDREK S Y ++V+A D G P   ++T TV +N+ DVNDN P F   +           I+  + V  E  +  V A D D G+N+ I Y++E G   G F  + ++  + L     + +  +  +KL++SA D G+
Sbjct:  105 LDPVTGEVKTNVVLDREGM---RDHYDLVV-LSSQPTYPIE-VRIKVLDVNDNSPEFPEPSIAISFSE---SATSGTRLLLDAATDADVGENGVTDQY-EIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVS-LNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSP---RQDGRTYVTVNLLDTNDHDPIISFRFF---PDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAA----DLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP---SVERLY------PLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE-GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQ 800          

HSP 2 Score: 194.512 bits (493), Expect = 1.555e-49
Identity = 215/761 (28.25%), Postives = 344/761 (45.20%), Query Frame = 2
Query:  476 NCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNV--EILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-------------------SPKR-----------------TGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITY-----RIEDQKASEYFNIGNN---GNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEK---SMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNM-FVGEVMAVDKDAE-RNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQ----NKKLILNSVLSKQDD--HKLVISACDKGK 2572
            +   ++P+T ++T+  R+D E +        +  +    PS +S ++ V   +LD+NDNAP +   S   S   FE   + +  + +  A D D   N  I+Y +   +  ++ G+     DS+ + R      + +DRE    Y L + A D                     SP++                 + ++++ I I D ND  P+F  A   A  + EN  I  V + V A D D   NG I Y     R ED   S+      N   G + V   +D +     +  ++ A D G P +   + E +++I ++DEND  P         DP     ++ EN  I   VL  +   D D G    +  S+   D+     +S      ++    N++R  +   ++   D   ++ A +TA  +I   ILD NDN P F    +  RV+EN   PN  +V  V A D D    NS++ + +   +   F+I+ SSG +   + LDRE+  ++ +T++A D G PP TGTG+V +EV DIND  P F L  Y  ++ EN   GT V T  A D+D   N K+++ ++ +   +   F          I  + GEI T   LDRE+ S Y LT++A D+       S+  + I++ DVNDN P F   + T +++   E +  G  +    A+DLD GEN+ + Y I  G    YF  NT+    + KL L +     DD  + +VISA D+G+
Sbjct: 1968 DVFSLNPQTGMLTLTARLDYEEV--QHYILIVQAQDNGQPS-LSTTITVYCNVLDLNDNAPIFDPMS--YSSEVFENVPIATEVVTV-SAKDIDSGNNGLIEYSITAGDVDSEFGI-----DSNGTIRTR----RNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA--IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDREL-RSSYLLNITARDRGEPPQ---STESQLLIRILDENDNSPVF-------DPKQYSASVAENASIGAMVL-QVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTI--NILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR---FH---------IDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKF---DSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-SGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGE 2681          

HSP 3 Score: 189.119 bits (479), Expect = 6.502e-48
Identity = 199/726 (27.41%), Postives = 333/726 (45.87%), Query Frame = 2
Query:  344 TCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSL-NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGV-WKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP-KRTGSLELIIQIL--DKNDNGPIF--DRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVL---AHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIA-NFDRE----EKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGN 2461
            +  ++ + E    GTE+        +  V+    + I  GN+  +  HID  T  + +   +D E +    +N  I      +PS  +  L NV ++D NDN P +P  + V    E  G  L++  + +  A DPD   N ++ Y +  +  +   G  + I  ++       +  ++ IDRE +D + L ++A D   P +R  S E ++ ++  D NDN P+F    A     K S +       + V AKDAD  +NG +TY I      E F +  N G I       +   V+ +Q ++ + D A +  R++ E  + I+       +  +     +R  L+   ++ ENE I  S+L   AH+   + ++     V+   +   + +++++   D +  IL+ A   DRE    E  +E   I    Q   + +K +   +LD+ND+ P+F    F + V E+  + +  +  + A D D      + F ++ G++  F    S+GK+     LDRE   K+ + I   DG    +      TI+V D ND  P F  ++Y F I ENA  G  VG + A D DL  N ++ Y ++SD ++ + +     SL  Q      G +     LD E+  HY+L V A DNG P S ++T TV  N++D+NDN P F   +   +S +  E+V    E+ TV A D+D G N  I Y I  G+
Sbjct: 1387 SSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRR-DTFHIDSITGSLYLHKPLDYEDITSYTLN--ITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKE--GIPLKTPIVTV-TADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGV-----IHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIV-SGPQELFKLQRNTGIITFTPGPQFKQEVR-YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSV-PQFEQRSKLSG--SVYENEPIGTSILTVTAHLASAEIEY----FVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTK-VRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHT-ISTLRAHDPDTL--GSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSD-WANDVF-----SLNPQT-----GMLTLTARLDYEEVQHYILIVQAQDNGQP-SLSTTITVYCNVLDLNDNAPIF---DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGD 2070          

HSP 4 Score: 174.481 bits (441), Expect = 1.939e-43
Identity = 183/641 (28.55%), Postives = 293/641 (45.71%), Query Frame = 2
Query:  602 VSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRN----GKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGE-CEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNS----VLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPN-MFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGG-DPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSH----YLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG 2458
            +S ++ V IL  D+ND  P +   ++       E   + +  I + KA D D   N  IDY +K+      G++D   + +          +L  +  +DRE    Y L + A D G P ++   +L+I+ILD+NDN P+FD  K Y+  ++ENA+IG + L VSA D D  ANG+I Y I     +  F+I  + G + V KN++Y+  +  +  +V A D A E     G+  E+ I ++D ND +P  +       P      ++EN V  N      +   +   P    +        ++D  R+   S       I  +   DRE++S   + ++  D      T +  +  ++ D NDN P F  + +H  V EN  +P+   V    A DKD   N+K+ F ++G   H F IDS +G++ T   LDREET  +++T++A+D     P+  +  +TI V D+ND  P+F  + Y  ++ E    G  V    A+D D   N  + Y  IS R   + YF          I    G + TK  L  + +SH    Y + + A+D G   S +S   + + I+   + FPTF     + F++      G  I  V A     G   +I Y I  G
Sbjct: 2147 LSSTVKVTILIKDVNDEVPVFISANETAIM---ENVAINTVVIAV-KAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDG-----QLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFD-PKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYER-LSRYSLTVRAEDCALEN--PAGDTAELTINILDINDNRPTFL-----DSPYLAR--VMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASS-----GDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVREN--LPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHY-TISGR--DQHYFD---------INTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGE-QSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGG 2746          

HSP 5 Score: 169.088 bits (427), Expect = 9.016e-42
Identity = 186/703 (26.46%), Postives = 304/703 (43.24%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-SPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKG-----FQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNN---DKMRLEQVSPSDKEFQILAIA--NFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDF-GENSEIVYQIEEGNPYGYFSFNTQNKKLILNS---------VLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPP 2650
            + VE+ DINDN P +  QS   +  E   N      +   +A D D   N+++ + L   +      + +   DS T    E+     +DRE+  VY L L+A+D+  +  R  S+ L I + D NDN P FD   Y    + E  + G       A D D   N  + Y I   +   YF+I N    +V   ++     K      +   + A+D   +      E  V++         PE+         + N    +  +V    ++  +    P  G    +  +++     D +R+      D    +L++     D E   + ++ I   D    +  +   I   + D NDN+P   + +++  VLE  S P + +  V A D+D+  N  + +++  + +  F+I  SG++YT+  LDREE   +   + A D G P  TGT  V + ++D ND  P+F+  L+  +++ENA IG+ V  VT+ D DL AN    Y      FS+    ++        I    G I     LDRE+Q  Y+L VVA D     ++ + T + I I D NDN P F+ S  +    +  +S+   +G + A D D  G NS I Y +++ +P   FS +    ++             V S ++ + L + A D GKPP  S  L V I +V  H    N PP
Sbjct: 2477 VRVEVQDINDNDPVFELQSYHATVRE---NLPSGTHVLTPRATDKDEGLNAKLRFNLLGEH------MHRFHIDSETG---EISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNV-AVPERISKGEFVFGARALDLDDGENAVVHYTISG-RDQHYFDI-NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-------RPPELFPTFAY---MANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRV------DPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQL-IAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT-RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASY-----SFSENPGEKF-------RIEPQSGNITVAGHLDREQQDEYILKVVASD----GAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIAL-VGQIIATDRDKQGPNSVISYSLQQPSP--MFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECL-VNINIVDAH----NNPP 3122          

HSP 6 Score: 165.622 bits (418), Expect = 1.217e-40
Identity = 202/744 (27.15%), Postives = 320/744 (43.01%), Query Frame = 2
Query:  488 IDPETHVVTVKN-----RIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSW---PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNE-NSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNND---------------KMRLEQVSPSDKEFQ-ILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVF--HFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN-EEHFFQID-SSGKMYTKQ-VLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGT----VEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSK--QDDHKLVISACDKGKPPKCSNPLWVTIK 2611
            I  +T VV V       R+ R SL     +C +      +P+  +  L + ILDINDN P++   P  ++V+  T    N     T++   A+D D    NSQ+ YFLK+     D+ +++I   S      ++  +K +DREQ   Y L L+A D GSP  TG+  + +++ D NDN P+F+   Y+A  + EN   G   LT  A D D   N K+ + +  +    +      G I     +D +     +  +++A D +  E R +    + I V D ND  P       K D  T   A+ E  +     +      D D G   +V  ++S  D               K+ L+  + S  +    + I+  D+ E+S+              +SK+ +  IL   +  P F  +   HF + E+   P   + +V A         KI + I G       ++D +SG +   Q  LD E T  + + I A DG  P      L+T+ V D ND  P     +Y   + E       +  V A DRD   N  + YR+ +D    +  F+ + S          GEI T+  LDRE+   Y   V A+D G P+  T T +V ++++D NDN P F      +FS+  TE+   EIG+    V + DLD G N+   Y   E NP   F    Q+  + +   L +  QD++ L + A D     +   P+ +TI+
Sbjct: 2328 ISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALE-----NPAGDTAELTINILDINDNRPTFLDSPYLARVMENT-VPPNGGYVLTVN---AYDADTPPLNSQVRYFLKE----GDSDLFRINASSG-----DIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHAT-VRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREE-TSVYHLTLMAQDSSITEPRAS-SVNLTISVSDVNDNIP-------KFDSTTYNVAVPE-RISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSL--------------SSKAELTVILRPPELFPTFAYMANSHFAMSEDVR-PGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDF---DGTFEITES----------GEIYTRMRLDREEIGDYAFVVEAVDQGVPH-MTGTASVLLHLLDKNDNPPKF----TRLFSLNVTENA--EIGSFVIRVTSSDLDLGANANASYSFSE-NPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAW--RAETPITITIQ 3004          

HSP 7 Score: 163.696 bits (413), Expect = 3.967e-40
Identity = 178/649 (27.43%), Postives = 279/649 (42.99%), Query Frame = 2
Query:  626 ILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVK--------GFQFSV--------------LAIDGAPEEYRKTGECEVVIMVIDENDEKPEII---VHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN---TASKSIVFQILDRNDNSPKFTRVF-HFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINII--DVNDNFPTFKTSNKTVFSIQTTESVGYEIGT--VEAVDLDFGENSEIVYQIEEG 2458
            I D+ND+ P +   S   S  E    K+ +R   +  A D D+ +N +I Y + + N +   GV+   Y         L     +DRE+ D Y L +   D G P R+  + ++I ++D+NDN P F  + +  + + ENA        ++A D D   N ++++ +  Q  ++ F I   NG I   +  D +A VK        G   S+              ++ +G P   R   + +V ++V D ND  PE +    HVT           I       + + H+  +D D G    V  SL+  ++    Q +      Q+      DRE + +  + ++ KD A     +++ SI   +LD NDN+P+FT+      VLE +      +    A D D   NS++ F I  GN    F IDS +G +Y  + LD E+   + + I A D G P  + T L  + VVD ND  P F  +     I E   + T + TVTA D D   N K+ Y I     +  +  +F          I  + G I T   +DRE    + LTVVA D   P+    +T   + +I  D+NDN P F + N  +   + + S G       V A D D   N  + Y+I  G
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPET--TKVNTRFFAL-AATDIDLGDNGRISYEIIEGNTERMFGVFPDGY---------LFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFS-IPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQ--TQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIP---RLQDKVKVKVIVTDVNDNAPEFLRAPYHVT-----------ISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEA--GQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELM-RFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFG---------INTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSG 1646          

HSP 8 Score: 162.54 bits (410), Expect = 9.279e-40
Identity = 188/722 (26.04%), Postives = 327/722 (45.29%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSY--VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGN-KLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQV----DVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII--GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGH-PNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDF-GENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSN 2590
              I+P++  +TV   +DRE         + +L+   S         + + I D NDNAP +       SF E + +  L  + I  D+        NS I Y L+  +            D +T        ++    + V    ++Y L ++A DNG P       + I I+D ++N P F++A+Y A  L ++A  G   + V A D   L   ++ Y +     S  F++G ++G I + K I      + ++  V A D G P +   + E  VVI+V  EN + P   V+       + +  + ENE + +++L  +   D D G   ++  S+S  ++   +  S  ++   I+     D +      ++I  +D  Y+  S   +  I+  D NDN P F  + +H  + EN  V   FV +  A DKD+ +N+ I +  +  G + HFF ++ S+G + +    D EE   + + I AK+     ++   L  + V+ +N++ P+F   ++ F +SE + +GT VG V A D+D   + ++ Y ++     K      ++ L + + RH          LDRE Q+  +LTV+A + G    + T    V I+I D ND  P F     T  +I     VG ++ TV+A+D D   +N++  Y I  GN    F  + Q  ++   S L +++   + LVI A D G PP+  +
Sbjct: 2959 FRIEPQSGNITVAGHLDREQ------QDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRD---KQGPNSVISYSLQQPS-------PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLA-PLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTR-YELVVRATDRGVPPQ---SDETRVVIVVTGENMDTPRFSVN-------SYQVIVPENEPVGSTILT-VGATDDDTGPNGMLRYSISGGNER--QDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPV-GTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLY-VHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIY-VARH----------LDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP-PEFIKHYYTS-TISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGS 3634          

HSP 9 Score: 156.762 bits (395), Expect = 5.657e-38
Identity = 196/744 (26.34%), Postives = 308/744 (41.40%), Query Frame = 2
Query:  473 LNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSS-TSRRIELMPIKVIDREQVDV-YELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANK---LSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMV--RKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHD--RGEIVTKYLLD-------REKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVD-LDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLS--KQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIP 2638
            ++  HID ET  ++    +DRE      +           P   S +L + + D+NDN P +   +  V+  E      +   +   +A D D  EN+ + Y +  R    D   + I   +   S ++EL   K   +   D+ Y +++ A D G    +   EL + IL   +  P F    Y AN    +SE+   G +   VSA        GKI Y I      +   +  N  ++   +  +DY+     ++  + A DG     R      + + V D ND  P +       + L     ++E E     ++A ++  D D G    V   L N+     E      +  +I      DREE       +   DQ   + T + S++  +LD+NDN PKFTR+F   V ENA +   FV  V + D D   N+   +    N    F+I+  SG +     LDRE+ +++ + ++A DG    +T    +TI + D ND  PEF  S Y FS  E       VG + A DR              D+    S   YS   P  M   D   GE+ +K  +        R  ++ Y LTV+A DNG P  Y S   V INI+D ++N P F+ + + +  +      G  I  V A D  D G N E+ Y +   N    FS    +  + L   +       ++LV+ A D+G PP+ S+   V I V  +++  P
Sbjct: 2535 MHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPE---RISKGEFVFGARALDLDDGENAVVHYTISGR----DQHYFDINTKTGVVSTKLEL---KTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTF---AYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYEL-THLYEIWIEAADGDTPSLRSV--TLITLNVTDANDNAPVM-------EQLIYNAEVLEEES-PPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEIT----ESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEI-GSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDR--------------DKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLY-SECLVNINIVDAHNNPPKFEQA-EYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQ-SDETRVVIVVTGENMDTP 3227          

HSP 10 Score: 154.836 bits (390), Expect = 2.256e-37
Identity = 189/761 (24.84%), Postives = 328/761 (43.10%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFT----------EFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKND-----------NGPIFDRAKYYANKLSENAN--IGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKT----GECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAII--ENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDR----EEKSMEKVDILCKDQAYNTASKSIVFQ--ILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDR--FSKESYFQYSSSL-PF------QMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSK--QDDHKLVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            +D  T  +T +  +DRE +   +I+     +   +P   + ++ + + D+NDN P +  +  + S            E E  ++    +H+  A D D  +N+ I+Y L+        G++++    + S  I L             Y+L++ A D G  +R    + I++I+ K+             G  F   + +  + +   N  +G V +    K  +  AN  I Y I     ++ F I   +G I   + +D +     ++ ++LA   +      +    G+C V I +ID ND  P   V    R+   +EP I   EN  +   +     V+D D G    +S SL+NN   +  ++ P      +  +    R    E  S+  V+++  D      S  +     I D ND++P F    +   L   +  N     + A D D   N +I ++II GN E  F +   G ++ +  LDREE + + +T+  +D G P ++    V I V+D ND  P+F+ S + FSI ENA   T VG +TA+DRD+  N ++ + + S    F+ ++   +  +L PF      ++ R+         L      ++ LL     DNG P        VK+ + DVNDN P F  +   V +I    S G  I  V   D D G N ++ Y + +GN  G F+ ++   +L L   L +  Q+ H L++ A D       S+   +TI V+ ++
Sbjct:  652 LDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERI---LLHV-TASDKDDGDNALIEYRLESGG----EGLFQLD---ARSGAISLRGDAPASMHWKPHYKLLVSARDAG--QRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQV----KSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQAN-YRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAP---VFALDRE---SEPTISLPENAAVGQEIYLS-RVRDRDAGVNSRISYSLTNNPNQQF-RIGP------VTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPR-LQDKVKVKVIVTDVNDNAPEFLRAPYHV-TISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDEN 1378          

HSP 11 Score: 152.14 bits (383), Expect = 1.471e-36
Identity = 200/767 (26.08%), Postives = 333/767 (43.42%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVS--KSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNG-----PIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS-------EYFNI-GNNGNIMVRKNIDYDAGVKGFQFSV--LAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAI--IENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEH-FFQIDSSGKMYTKQV-LDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNG-------------------HPNSYTST--------------TTVKINII--DVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG--------NPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCS 2587
            I+ ET V+     IDRES+   ++      R   S   +S  K + V + DINDNAP +   +  +   +F  +K  S  +    A D D + N  + Y +   +G  +  ++K++ ++     I   P     +E    Y+L L + D        S E+ I I+     G     P F++    +  + EN  IG   LTV+A    +LA+ +I Y + +  A+         F+I    G +     +D +AG + ++  V  +A+ G P    +T   +V + V+D+ND  P+ +          + P +  +  ++     ++ +   DPD  G         ++ K  LE   PS    +++     DRE KS  ++ I   D    T + + + Q+ D NDN P F   V+ F + ENA      VG+++A D D  +N+++ + ++ +  +  F ++    M T    LD EE + + + + A+D G P  + T  V   V+D+ND  P F    Y   + EN  I T V TV+A D D   N  ++Y I +     E  F   S+          G I T+  LDRE +S Y LTV A D                      P  Y  T              +TVK+ I+  DVND  P F ++N+T  +I    ++   +  V+AVD D G N  I Y ++E         +P   FS N  + +L +   L ++    + L I+A D+G+PP+ +
Sbjct: 1543 INTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIV--SGPQE--LFKLQRNTGI---ITFTPGPQFKQEVR--YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA----HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQP----RTSRTKVRVTVLDKNDSPPQFL----------DTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLE---PSTG--KLILNDTLDRETKSKYELRIRVSDGVQYTEAYATI-QVSDTNDNPPLFEDTVYSFDIPENAQR-GYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSE--FGIDSN----------GTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANET--AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLP-FSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQST 2260          

HSP 12 Score: 147.517 bits (371), Expect = 3.536e-35
Identity = 197/778 (25.32%), Postives = 338/778 (43.44%), Query Frame = 2
Query:  368 EEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNC-LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKS-LNVEILDINDNAPSWPQQ--SKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEY---FNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIV-HVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQI-----LDRNDNSPKFTRVFHFRVLENA-----SVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKT------GTGLVTIEVVDINDWKPEFSL---SLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQM-IRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF-KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNP---YGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCS 2587
            E   NGT +  +     ++ ++  TS RI  GN+L +  L    + H+V V   +DRE +   + N  ++     +P+  + + L +++ D+ND+ P + +   S V+S     G+ + S T     A D D   N+Q+ Y +   N        ++K+ S       ++    +DRE  D  EL + A D G   +    +L + ILD+ND  P F + +     L E+A    +   ++A D D   NG +T+ +       Y   F +    G +  R+ +D +  +  ++ SV+A D GAP     T    V + V D ND  P+    H        ++   ++ EV    +L H+   D D G   ++   L +  +  L Q+        +   A      K   K+ +  +D     + +  + +I     L+  +        + F+++E+      S PN  VG V     + + NS IE+ II G+    F+ID+ SG++ T + LDREE   + +TILA               G  +V I ++D+ND  P F+L   S    S+ ENA +G  +      DRD   N+++ Y + ++   +      +  L  Q  IR + G ++   L+             A D G     +S  ++ + I DVND+ P F  TS +T  S+  T  V      + A D+D G+N  I Y+I EGN    +G F     +  L + + L ++  D + L +S  D G+P + S
Sbjct:  398 ENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEI--GKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASIT-----ATDEDTGVNAQVHYDILSGN--------ELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVT-LGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREK-MSQYEISVIARDQGAPTPQSAT--ATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE-GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELM-------------ATDAGS-PPLSSKLSLSVLIADVNDHTPVFDHTSYET--SLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP----DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSS 1135          

HSP 13 Score: 141.354 bits (355), Expect = 2.753e-33
Identity = 176/710 (24.79%), Postives = 309/710 (43.52%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCD-----------IMLRFFISPSYVSKS-LNVEILDINDNAP-----SWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNN-DKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT---ASKSIVFQILDRNDNSPKF-TRVFHFRV--------LENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEK--FNVTILAKDGGDPPKTGTGLVTI------EVVDINDWKPEFSLSLYEFSISE------NAGIGTSVGTVTAIDRDLPANTKMKYRII-SDRFSKESYFQYSSSLPFQMIRHD--RGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTT-----VKINIIDVNDNFPTFKTSNKT--VFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQI 2449
            ++PET V++   R++    CP Q N             +  R   SP    ++ + V +LD ND+ P      +P   KV +  E   N +    +      D D   N +    +      + N +   + + +    I +    V+DRE++  Y L ++A D G+P RT +  LII + D ND+ P+F++++Y A  LSE A  G    +++A D D   N ++ Y I      ++F++    G I+    +D +      + S+ A DG P    K    ++ ++++DENDE P+     ++R+    +   +  +    +++A +   D D G    V+ +L+ + +++   Q +      Q+      DRE+ S  ++ ++ +DQ   T   A+ ++   + D NDN P+F  R + + +        L+        +  V A DKD   N+ IE+++    E  FQ+D+ SG +  +         K  + + + A+D G        +V I      E+++    +       YEF + E      N+     VG V     +  AN+ ++Y II  DR               Q  R D   G I T   LDRE+Q++Y LT++A  +   ++  S+ +     V I IID+NDN P F    ++    S+    +VG EI      D D G NS I Y +
Sbjct:  318 VNPETGVISTTERVN----CPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDE---NAVNGTVVAAVAVKDSDSGLNGRTSVRIV-----SGNELGHFRLEEAADLHI-VRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSA-VLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREI-RDTVELSISARDGGPNP--KFAYTQLKVIILDENDEAPQF----SQRE----QNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQ----AGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDR--------------AQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSL 984          

HSP 14 Score: 140.584 bits (353), Expect = 5.466e-33
Identity = 174/696 (25.00%), Postives = 302/696 (43.39%), Query Frame = 2
Query:  590 SPSYVSKSL-NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE-FQILAI----ANFDREEKSMEKVDILCKDQAYNTA-SKSIV-FQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNG-HPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNE 2644
            +PS  S +L  + + D NDNAP   Q   ++   E    +   + I + KA D D  +N  + Y L++      +G ++I        R+ L      DRE++  Y  ++ A D G P  TG+  +++ +LDKNDN P F R   ++  ++ENA IG   + V++ D D  AN   +Y   +    ++     +GNI V  ++D +   + +   V+A DGA   +R   E  + I + D+ND  PE            + P + ++  +   ++A    K    G   ++S SL     M    + P+  E F   A+    + + R  ++M  + +L  D       S+ +V   I+D ++N PKF +  +   L   +V    +  V A DK     +++++ ++  N    F +    G +   + +      ++ + + A D G PP++    V I V   N   P FS++ Y+  + EN  +G+++ TV A D D   N  ++Y  IS    ++ +           +    G IV +  LD +    Y L +   D G HP   +S   + I + DVNDN P F       + I   + VG  +    A D D  +N+ I Y      P  +F    Q+   I +S +S   + + + +   K K P  S   +  + V   H+L  NE
Sbjct: 2787 TPSLRSVTLITLNVTDANDNAPVMEQ---LIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDF----DGTFEITESGEIYTRMRL------DREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR--LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDE-YILKVVASDGA---WR--AETPITITIQDQNDNAPEFEHSFYS----FSFPELQQSIALVGQIIATDRDKQ---GPNSVISYSLQQPSPMF--SIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYS-ISGGNERQDF----------SVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHP--LSSVAMLTIILTDVNDNPPVFNHKEYHCY-IPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTI-SSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYV---HVLGVNE 3434          

HSP 15 Score: 133.65 bits (335), Expect = 6.583e-31
Identity = 169/632 (26.74%), Postives = 278/632 (43.99%), Query Frame = 2
Query:  875 VIDREQV-DVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKI-TYRIEDQKASEYFNI-------GNNGNIMVRKNIDYDAGVKG-FQFSVLAIDG-APEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTAS-KSIVFQILDRNDNSPK----------------FTRVFHFR----------VLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMY---TKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF--KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGY---FSFNTQNKKLILNSVL--SKQDDHKLVISACDKGKP-PKCSNP-LWVTIKVV 2617
            V+DRE + D Y+L+++     S + T  +E+ I++LD NDN P F      A   SE+A  G   L  +A DAD   NG    Y I        F +       G+   + +    + D   +G +Q ++ A DG +P  +   G  +V + ++D ND  P I  H      L NE A+    V++      +   D D G    ++  L+  +      V+P   E  +++         + E+V+   +    ++AS KS VF +  R+  SP+                   +  FR          V ENA V    V  V   D D+  N +   +I+ GNE   F+++ +  ++      VLDREE  K+N+T++A D G P +T T  + I+V D+ND +P F  S Y   +SE A  G+ V ++TA D D   N ++ Y I+S      +  ++ S  P        G IVT   LDRE +    L++ A D G PN   + T +K+ I+D ND  P F  +  N T+      +++   +  + A D D G N  + + +       Y   F+ +    +L     L   K   +++ + A D+G P P+ +   +W+ +  V
Sbjct:  117 VLDREGMRDHYDLVVL-----SSQPTYPIEVRIKVLDVNDNSPEFPEPSI-AISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRF---GYLQVNVTILDVNDNPP-IFDHSDYNVSL-NETALPGTPVVT------VMASDNDLGDNSKITYYLAETEHQF--TVNP---ETGVIS---------TTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENA-VNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSG-----NELKWFSMDPLT------GLIVTTGPLDREIRDTVELSISARDGG-PNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTI---VALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADV 701          

HSP 16 Score: 129.413 bits (324), Expect = 1.349e-29
Identity = 147/554 (26.53%), Postives = 238/554 (42.96%), Query Frame = 2
Query:  719 TIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN--NGNIMVRKNIDYDAG-VKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG--GRDIVSCSLSNNDK-MRLEQVSPSDKEFQILAIA-NFDREEKSMEKVDILCKD----QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAE-RNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTK-MKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKT 2335
            TI    A D D   N  + Y +   N + D  V +        R   ++  + +D + +  Y L +  +D G    +    L I + D NDN P+F+  +Y+   + EN  +G       A D D   N  I Y         +F I N  NG I    + DY+   +   Q      D + E Y       + + V+  N+  P+ +  V   D       + E   +   V A ++  D D G  GR       S+NDK  R+      D    ++ +A + DRE ++   + ++ K+    +  +T    ++  I D ND  P+F + ++   +  A+     V  V A+DKD   +N++  + II GN +  F+ID  +G++ T   LDREET  +N+ I A D G PP+TG+  V IE+ D+ND  P F+       ISEN   GTS+ T+ A D DLP N     Y++I  +              +  +  + G + +    DRE        +   D+G P    S   + I ++D NDN  T ++
Sbjct: 3247 TILTVGATDDDTGPNGMLRYSISGGNERQDFSVDE--------RTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHC-YIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESY-----ANLYVHVLGVNEFYPQFLQPVFHFD-------VSETSAVGTRVGA-VQATDKDSGEDGRVYYLLVGSSNDKGFRI------DTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKS-----------WLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQ-KSQHLLTITVLDQNDNPSTTRS 3759          

HSP 17 Score: 119.013 bits (297), Expect = 2.145e-26
Identity = 174/690 (25.22%), Postives = 302/690 (43.77%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSW-PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDY--FLKDRNG----KTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTG-SLELIIQILDKNDNGPIFDRAKYYANKLSENA---NIGFVALTVSAKDADYLA-NGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN---TASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-----SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFS-LSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTT--ESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPY-GYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKP 2575
            P      L + ILD NDN+P + P+Q    S +  E   + +  + +  A D D   N +I Y   L D+N       D GV ++               K ++ E++  Y L + AED       G + EL I ILD NDN P F  + Y A ++ EN    N G+V LTV+A DAD    N ++ Y +++   S+ F I  ++G+I + K +D +   + +  +++A+D        TG   V +  I++ND   E+   H T R+ L +   ++                D D G    +  +L      R    S +    +I      DREE S+  + ++ +D +      +S ++   + D NDN PKF +  ++  V E  S    FV    A+D D   N+ + + I G ++H+F I++     S K+  K      +   + + I A D G+   +    +T+ ++   +  P F+ ++   F++SE+   G  +  V+A         K++Y I             +S L            V +  LD E    Y + + A D   P S  S T + +N+ D NDN P  +   + +++ +    ES    I  V+A D D G+N  ++Y+++  N + G F   T++ ++     L +++  D+  V+ A D+G P
Sbjct: 2257 PQSTESQLLIRILDENDNSPVFDPKQ---YSASVAENASIGAMVLQV-SATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVA--------------KNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLA-RVMENTVPPNGGYV-LTVNAYDADTPPLNSQVRYFLKEGD-SDLFRINASSGDIALLKPLDREQQSE-YTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTP-----------RATDKDEGLNAKLRFNLLGEHMHRFHIDSETG---EISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERIS-KGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGL----------LSVGQDGLDYELTHLYEIWIEAADGDTP-SLRSVTLITLNVTDANDNAPVME---QLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQ--NDFDGTFEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGVP 2891          

HSP 18 Score: 98.5969 bits (244), Expect = 2.848e-20
Identity = 98/364 (26.92%), Postives = 162/364 (44.51%), Query Frame = 2
Query: 1625 IVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKI-EFQII-GNEEHFFQIDSSG---------KMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHY---------LLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPT----FKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLI--LNSVLSKQD--DHKLVISACDKGKPPKCSNP-LWVTIKVVKQH 2626
            +  ++LD NDNSP+F          E+A+     + +  A D D   N    +++I+ GN ++ F++ ++           + T   LDRE    + + I A+DGG PP+ G   V + ++D+ND  P F  S Y  S++E A  GT V TV A D DL  N+K+ Y      +  E+  Q++       +  + G I T   ++  +Q++          + TV A D+G P      T V +N++D ND+ P     F      V ++      G  +  V   D D G N     +I  GN  G+F         I  +N VL +++   + L + A D+G P + +   L + +  V  H
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDA-ATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITY------YLAETEHQFT-------VNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQ-DGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDH 490          

HSP 19 Score: 56.9954 bits (136), Expect = 1.604e-7
Identity = 54/198 (27.27%), Postives = 86/198 (43.43%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKL 1036
            SY I +GN L     ID +T  ++  +R+DRE      +     +   + P   S ++++E+ D+NDN P++  +      +E   N+    +I    A DPD+  N     F     G        +  +S   R          DRE   + E I+  ED+G PK+     L I +LD+NDN P   R+ + A  L
Sbjct: 3582 SYSIINGN-LKQSFKIDVQTGEISTASRLDREETSTYNLVIG-AIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISE---NEPAGTSIMTLIASDPDLPRNG--GPFTYQLIGGKHKSWLSVDRNSGVVRS-----TTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN-PSTTRSLHIAVSL 3766          
BLAST of Protocadherin 1b vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 219.935 bits (559), Expect = 1.422e-57
Identity = 196/683 (28.70%), Postives = 321/683 (47.00%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPS----YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-------IGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQ 2491
              ID  + V++ ++ +DRE+   +  +  +      S        + S+ V++LD NDN P + +++  V   E +    E  T+   +A D D   N+ I Y +   N ++   +  +  D S         +K +D E V  Y L++ A+D GSP R+ + +L++ ++D NDN P F  +++  + L EN  +G+  + V A D+D  AN +ITY I ++  +    +    G +   K +D +   + F F V+A DG      K+    VVI V D ND  P         +P   E  + E++     V   +   DPD   R     + + N + R    S + +    +A  + D +++    + +   D    + + ++   I D N+ +P F    +   V E+A V    V  V A D D   N++I + +       +G+ + F     +G + T   LDRE T  + +T+ AKDGG+P  + T  V I V D+ND  P F   LY+ SI E+A +GTSV  V A D D+  N ++KY ++SDR  ++  F         +I    G I T   LDRE  + + LT +A+D G P   +ST  V+I + DVND+ PTF  S+K    +     VG  +G + A D D G N+ + Y I  G+    FS  T+
Sbjct:  521 FRIDSRSGVISTRSSLDRET--SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL--------VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVL-ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPP--KSASSSVVITVQDVNDNDPAF-------NPKYYEANVGEDQPPGTPVTT-VTATDPDEDSRLHYEIT-TGNTRGRFAITSQNGRGLITIA-QSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPV-GTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSF---------VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP-PLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTR 1166          

HSP 2 Score: 214.927 bits (546), Expect = 5.537e-56
Identity = 218/753 (28.95%), Postives = 346/753 (45.95%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLK---DRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVS---AKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDSS---GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGN-PYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVF 2689
            +D  T VVT    +DRE +  +          F  P   + +L V +LD ND++P++  +    S    EG  + S  I + +A D D+ +N++I+Y ++   D  G   +    I    S S  I       +DRE  D Y L++ A D  S    +RT +  + +++LD NDN P F   + Y  ++ E+   G    TV+   A DAD   N  I Y I        F+I + +G++ + K +DY++ V+ ++  + A DG      ++   ++++ VID ND  P       +        +++EN  +  +++  ++  D D G    ++ S+S  D      V P     Q   I   DREE+      ++ KD      +AS S+V  + D NDN P F   ++   +     P   V  V A D D   +S++ ++I  GN    F I S    G +   Q LD ++ ++F +T+ A D G   ++ T  V I + D N++ P F  + Y  S+ E+A +GT+V  V+A D D+  N ++ Y +     ++ES     S  PF  I    G IVT   LDRE  S YLLTV A D G+P S + TT V+I + DVNDN P FK+      SI     VG  +  V A D D G N  I Y + + +   G F  +  +  +  N  L ++      L   A DKG PP  S         V+  I + +   +P TF+  K  ++
Sbjct:  409 VDSRTGVVTTSASLDRELMDVHYFRVVATDDSF-PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIR--EGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTR--SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSE-RTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPS--RSNTTQLLVNVIDANDNAPRFYTSQFQE-------SVLENVPVGYNII-RVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ--TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL-----NEESINGLGSPDPFS-INPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQA-SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSS--------TVEVQIRLEDVNDSPPTFASDKITLY 1121          

HSP 3 Score: 119.398 bits (298), Expect = 1.496e-26
Identity = 87/281 (30.96%), Postives = 138/281 (49.11%), Query Frame = 2
Query: 1799 EHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNS--YTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE---IGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVV 2617
            +  F++DS +G + T   LDRE  +     ++A D   PP++GT  + + V+D ND  P F    +E SI E A +G++V T+ A D+D+  N +++Y I  +  +  +       +P   I    G I T+  LDRE    Y L V A D     S   T+T +V++ ++D NDN+P F     TV  +   +  G E   +  + A D D G N+ I Y I  GN    FS ++ +  + L   L  +    ++LVI A D G P + SN   + + V+
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTV-QVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVI 680          
BLAST of Protocadherin 1b vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 219.935 bits (559), Expect = 1.462e-57
Identity = 196/683 (28.70%), Postives = 321/683 (47.00%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPS----YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-------IGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQ 2491
              ID  + V++ ++ +DRE+   +  +  +      S        + S+ V++LD NDN P + +++  V   E +    E  T+   +A D D   N+ I Y +   N ++   +  +  D S         +K +D E V  Y L++ A+D GSP R+ + +L++ ++D NDN P F  +++  + L EN  +G+  + V A D+D  AN +ITY I ++  +    +    G +   K +D +   + F F V+A DG      K+    VVI V D ND  P         +P   E  + E++     V   +   DPD   R     + + N + R    S + +    +A  + D +++    + +   D    + + ++   I D N+ +P F    +   V E+A V    V  V A D D   N++I + +       +G+ + F     +G + T   LDRE T  + +T+ AKDGG+P  + T  V I V D+ND  P F   LY+ SI E+A +GTSV  V A D D+  N ++KY ++SDR  ++  F         +I    G I T   LDRE  + + LT +A+D G P   +ST  V+I + DVND+ PTF  S+K    +     VG  +G + A D D G N+ + Y I  G+    FS  T+
Sbjct:  521 FRIDSRSGVISTRSSLDRET--SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL--------VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVL-ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPP--KSASSSVVITVQDVNDNDPAF-------NPKYYEANVGEDQPPGTPVTT-VTATDPDEDSRLHYEIT-TGNTRGRFAITSQNGRGLITIA-QSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPV-GTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSF---------VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP-PLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTR 1166          

HSP 2 Score: 214.927 bits (546), Expect = 5.999e-56
Identity = 218/753 (28.95%), Postives = 346/753 (45.95%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLK---DRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVS---AKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDSS---GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGN-PYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVF 2689
            +D  T VVT    +DRE +  +          F  P   + +L V +LD ND++P++  +    S    EG  + S  I + +A D D+ +N++I+Y ++   D  G   +    I    S S  I       +DRE  D Y L++ A D  S    +RT +  + +++LD NDN P F   + Y  ++ E+   G    TV+   A DAD   N  I Y I        F+I + +G++ + K +DY++ V+ ++  + A DG      ++   ++++ VID ND  P       +        +++EN  +  +++  ++  D D G    ++ S+S  D      V P     Q   I   DREE+      ++ KD      +AS S+V  + D NDN P F   ++   +     P   V  V A D D   +S++ ++I  GN    F I S    G +   Q LD ++ ++F +T+ A D G   ++ T  V I + D N++ P F  + Y  S+ E+A +GT+V  V+A D D+  N ++ Y +     ++ES     S  PF  I    G IVT   LDRE  S YLLTV A D G+P S + TT V+I + DVNDN P FK+      SI     VG  +  V A D D G N  I Y + + +   G F  +  +  +  N  L ++      L   A DKG PP  S         V+  I + +   +P TF+  K  ++
Sbjct:  409 VDSRTGVVTTSASLDRELMDVHYFRVVATDDSF-PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIR--EGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTR--SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSE-RTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPS--RSNTTQLLVNVIDANDNAPRFYTSQFQE-------SVLENVPVGYNII-RVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ--TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL-----NEESINGLGSPDPFS-INPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQA-SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSS--------TVEVQIRLEDVNDSPPTFASDKITLY 1121          

HSP 3 Score: 119.398 bits (298), Expect = 1.517e-26
Identity = 87/281 (30.96%), Postives = 138/281 (49.11%), Query Frame = 2
Query: 1799 EHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNS--YTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE---IGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVV 2617
            +  F++DS +G + T   LDRE  +     ++A D   PP++GT  + + V+D ND  P F    +E SI E A +G++V T+ A D+D+  N +++Y I  +  +  +       +P   I    G I T+  LDRE    Y L V A D     S   T+T +V++ ++D NDN+P F     TV  +   +  G E   +  + A D D G N+ I Y I  GN    FS ++ +  + L   L  +    ++LVI A D G P + SN   + + V+
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTV-QVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVI 680          
BLAST of Protocadherin 1b vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 219.935 bits (559), Expect = 1.462e-57
Identity = 196/683 (28.70%), Postives = 321/683 (47.00%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPS----YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-------IGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQ 2491
              ID  + V++ ++ +DRE+   +  +  +      S        + S+ V++LD NDN P + +++  V   E +    E  T+   +A D D   N+ I Y +   N ++   +  +  D S         +K +D E V  Y L++ A+D GSP R+ + +L++ ++D NDN P F  +++  + L EN  +G+  + V A D+D  AN +ITY I ++  +    +    G +   K +D +   + F F V+A DG      K+    VVI V D ND  P         +P   E  + E++     V   +   DPD   R     + + N + R    S + +    +A  + D +++    + +   D    + + ++   I D N+ +P F    +   V E+A V    V  V A D D   N++I + +       +G+ + F     +G + T   LDRE T  + +T+ AKDGG+P  + T  V I V D+ND  P F   LY+ SI E+A +GTSV  V A D D+  N ++KY ++SDR  ++  F         +I    G I T   LDRE  + + LT +A+D G P   +ST  V+I + DVND+ PTF  S+K    +     VG  +G + A D D G N+ + Y I  G+    FS  T+
Sbjct:  521 FRIDSRSGVISTRSSLDRET--SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL--------VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVL-ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPP--KSASSSVVITVQDVNDNDPAF-------NPKYYEANVGEDQPPGTPVTT-VTATDPDEDSRLHYEIT-TGNTRGRFAITSQNGRGLITIA-QSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPV-GTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSF---------VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP-PLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTR 1166          

HSP 2 Score: 214.927 bits (546), Expect = 5.999e-56
Identity = 218/753 (28.95%), Postives = 346/753 (45.95%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLK---DRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVS---AKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDSS---GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGN-PYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVF 2689
            +D  T VVT    +DRE +  +          F  P   + +L V +LD ND++P++  +    S    EG  + S  I + +A D D+ +N++I+Y ++   D  G   +    I    S S  I       +DRE  D Y L++ A D  S    +RT +  + +++LD NDN P F   + Y  ++ E+   G    TV+   A DAD   N  I Y I        F+I + +G++ + K +DY++ V+ ++  + A DG      ++   ++++ VID ND  P       +        +++EN  +  +++  ++  D D G    ++ S+S  D      V P     Q   I   DREE+      ++ KD      +AS S+V  + D NDN P F   ++   +     P   V  V A D D   +S++ ++I  GN    F I S    G +   Q LD ++ ++F +T+ A D G   ++ T  V I + D N++ P F  + Y  S+ E+A +GT+V  V+A D D+  N ++ Y +     ++ES     S  PF  I    G IVT   LDRE  S YLLTV A D G+P S + TT V+I + DVNDN P FK+      SI     VG  +  V A D D G N  I Y + + +   G F  +  +  +  N  L ++      L   A DKG PP  S         V+  I + +   +P TF+  K  ++
Sbjct:  409 VDSRTGVVTTSASLDRELMDVHYFRVVATDDSF-PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIR--EGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTR--SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSE-RTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPS--RSNTTQLLVNVIDANDNAPRFYTSQFQE-------SVLENVPVGYNII-RVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ--TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL-----NEESINGLGSPDPFS-INPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQA-SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSS--------TVEVQIRLEDVNDSPPTFASDKITLY 1121          

HSP 3 Score: 119.398 bits (298), Expect = 1.517e-26
Identity = 87/281 (30.96%), Postives = 138/281 (49.11%), Query Frame = 2
Query: 1799 EHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNS--YTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE---IGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVV 2617
            +  F++DS +G + T   LDRE  +     ++A D   PP++GT  + + V+D ND  P F    +E SI E A +G++V T+ A D+D+  N +++Y I  +  +  +       +P   I    G I T+  LDRE    Y L V A D     S   T+T +V++ ++D NDN+P F     TV  +   +  G E   +  + A D D G N+ I Y I  GN    FS ++ +  + L   L  +    ++LVI A D G P + SN   + + V+
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTV-QVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVI 680          
BLAST of Protocadherin 1b vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 219.935 bits (559), Expect = 1.626e-57
Identity = 196/683 (28.70%), Postives = 321/683 (47.00%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPS----YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-------IGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQ 2491
              ID  + V++ ++ +DRE+   +  +  +      S        + S+ V++LD NDN P + +++  V   E +    E  T+   +A D D   N+ I Y +   N ++   +  +  D S         +K +D E V  Y L++ A+D GSP R+ + +L++ ++D NDN P F  +++  + L EN  +G+  + V A D+D  AN +ITY I ++  +    +    G +   K +D +   + F F V+A DG      K+    VVI V D ND  P         +P   E  + E++     V   +   DPD   R     + + N + R    S + +    +A  + D +++    + +   D    + + ++   I D N+ +P F    +   V E+A V    V  V A D D   N++I + +       +G+ + F     +G + T   LDRE T  + +T+ AKDGG+P  + T  V I V D+ND  P F   LY+ SI E+A +GTSV  V A D D+  N ++KY ++SDR  ++  F         +I    G I T   LDRE  + + LT +A+D G P   +ST  V+I + DVND+ PTF  S+K    +     VG  +G + A D D G N+ + Y I  G+    FS  T+
Sbjct:  521 FRIDSRSGVISTRSSLDRET--SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL--------VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVL-ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPP--KSASSSVVITVQDVNDNDPAF-------NPKYYEANVGEDQPPGTPVTT-VTATDPDEDSRLHYEIT-TGNTRGRFAITSQNGRGLITIA-QSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPV-GTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSF---------VIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP-PLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTR 1166          

HSP 2 Score: 214.927 bits (546), Expect = 6.555e-56
Identity = 218/753 (28.95%), Postives = 346/753 (45.95%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLK---DRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVS---AKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDSS---GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGN-PYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVF 2689
            +D  T VVT    +DRE +  +          F  P   + +L V +LD ND++P++  +    S    EG  + S  I + +A D D+ +N++I+Y ++   D  G   +    I    S S  I       +DRE  D Y L++ A D  S    +RT +  + +++LD NDN P F   + Y  ++ E+   G    TV+   A DAD   N  I Y I        F+I + +G++ + K +DY++ V+ ++  + A DG      ++   ++++ VID ND  P       +        +++EN  +  +++  ++  D D G    ++ S+S  D      V P     Q   I   DREE+      ++ KD      +AS S+V  + D NDN P F   ++   +     P   V  V A D D   +S++ ++I  GN    F I S    G +   Q LD ++ ++F +T+ A D G   ++ T  V I + D N++ P F  + Y  S+ E+A +GT+V  V+A D D+  N ++ Y +     ++ES     S  PF  I    G IVT   LDRE  S YLLTV A D G+P S + TT V+I + DVNDN P FK+      SI     VG  +  V A D D G N  I Y + + +   G F  +  +  +  N  L ++      L   A DKG PP  S         V+  I + +   +P TF+  K  ++
Sbjct:  409 VDSRTGVVTTSASLDRELMDVHYFRVVATDDSF-PPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIR--EGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTR--SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSE-RTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQDGGSPS--RSNTTQLLVNVIDANDNAPRFYTSQFQE-------SVLENVPVGYNII-RVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ--TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL-----NEESINGLGSPDPFS-INPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQA-SILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSS--------TVEVQIRLEDVNDSPPTFASDKITLY 1121          

HSP 3 Score: 119.398 bits (298), Expect = 1.558e-26
Identity = 87/281 (30.96%), Postives = 138/281 (49.11%), Query Frame = 2
Query: 1799 EHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNS--YTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE---IGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVV 2617
            +  F++DS +G + T   LDRE  +     ++A D   PP++GT  + + V+D ND  P F    +E SI E A +G++V T+ A D+D+  N +++Y I  +  +  +       +P   I    G I T+  LDRE    Y L V A D     S   T+T +V++ ++D NDN+P F     TV  +   +  G E   +  + A D D G N+ I Y I  GN    FS ++ +  + L   L  +    ++LVI A D G P + SN   + + V+
Sbjct:  404 QSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTV-QVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVI 680          
BLAST of Protocadherin 1b vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 259.61 bits (662), Expect = 5.764e-71
Identity = 234/793 (29.51%), Postives = 371/793 (46.78%), Query Frame = 2
Query:  317 WILLLISSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE------FQILAIANFDR-EEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD-HKLVISACDKGKPPKCSNPL 2596
            WILLL+    C    + EE    T I  L       +      Y++  G   L    +D +T  + T +N IDRESL  C N    D   L F +S + + K          +EILD NDN P +      +S  E   N        I  A D D   N   DY L      T+    ++  DS   +  +L+ +  +DRE  D Y+L +   D GSP R  S  L I I D NDN P F+R+ +Y  +L EN+ +G   L V A D+D   NG++TY +  Q +S    +     N G I V+ ++D +  +   +F V A D  P+   K+ +  V I V D+ND  P I +     VT  D + N    I  ++   + +A +EV D D G   +V+C ++ +   +L   S +  +       Q   + +++R +E  +E V +   + A  +++ S+  Q+ D NDN+P F+   +       + P   V +V+A D D+  N+++ + I G    E  F+I+ ++G++     LDRE+ + +   + A D G P   GT  V ++V+D ND  P+F L+ Y FS+ EN    + VG VT  D D   N +++  +  D  +F               MI++    I++    DREK+S Y   + A+D G P   +S   + IN++D NDN P   K +N +   +    S    + +VEA D+D G NSE+ + I  GNP+G F  +++ +  +      K    H+LV+   DKG PP+ +  L
Sbjct:   48 WILLLL---CCSANVVTEEQPPNTLIGSLAS--DQGLPDTGHLYKLEVGAPYL---RVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPE---NTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSD-EKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERS-HYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLH-QPSSPVMRLLSIDRNTGIIFVKGSVDREE-ISILKFYVQAKDNGPQS--KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVAN----ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPAL-SSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKF---------------MIQNGTYTILSTISFDREKESTYSFRLKAVDGGDP-PRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTAL 802          
BLAST of Protocadherin 1b vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 257.299 bits (656), Expect = 2.797e-70
Identity = 237/815 (29.08%), Postives = 380/815 (46.63%), Query Frame = 2
Query:  272 HSNFNSNFLMITFAA---WILLLISS----ITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE------FQILAIANFDR-EEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD-HKLVISACDKGKPPKCSNPL 2596
            H   ++N +   ++A   WILLL+      +     Q+ EE    T I  L       +      Y++  G   L    +D +T  + T +N IDRESL  C N    D   L F +S + + K          +EILD NDN P +      +S  E   N        I  A D D   N   DY L      T+    ++  DS   +  +L+ +  +DRE  D Y+L +   D GSP R  S  L I I D NDN P F+R+ +Y  +L EN+ +G   L V A D+D   NG++TY +  Q +S    +     N G I V+ ++D +  +   +F V A D  P+   K+ +  V I V D+ND  P I +     VT  D + N    I  ++   + +A +EV D D G   +V+C ++ +   +L   S +  +       Q   + +++R +E  +E V +   + A  +++ S+  Q+ D NDN+P F+   +       + P   V +V+A D D+  N+++ + I G    E  F+I+ ++G++     LDRE+ + +   + A D G P   GT  V ++V+D ND  P+F L+ Y FS+ EN    + VG VT  D D   N +++  +  D  +F               MI++    I++    DREK+S Y   + A+D G P   +S   + IN++D NDN P   K +N +   +    S    + +VEA D+D G NSE+ + I  GNP+G F  +++ +  +      K    H+LV+   DKG PP+ +  L
Sbjct:   18 HPERSANAMWSRWSAMLVWILLLLCCSANVVNTILYQVTEEQPPNTLIGSLAS--DQGLPDTGHLYKLEVGAPYL---RVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPE---NTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSD-EKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERS-HYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLH-QPSSPVMRLLSIDRNTGIIFVKGSVDREE-ISILKFYVQAKDNGPQS--KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVAN----ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPAL-SSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKF---------------MIQNGTYTILSTISFDREKESTYSFRLKAVDGGDP-PRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTAL 797          
BLAST of Protocadherin 1b vs. Ensembl Zebrafish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 257.299 bits (656), Expect = 2.814e-70
Identity = 234/797 (29.36%), Postives = 372/797 (46.68%), Query Frame = 2
Query:  317 WILLLISS----ITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE------FQILAIANFDR-EEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD-HKLVISACDKGKPPKCSNPL 2596
            WILLL+      +     Q+ EE    T I  L       +      Y++  G   L    +D +T  + T +N IDRESL  C N    D   L F +S + + K          +EILD NDN P +      +S  E   N        I  A D D   N   DY L      T+    ++  DS   +  +L+ +  +DRE  D Y+L +   D GSP R  S  L I I D NDN P F+R+ +Y  +L EN+ +G   L V A D+D   NG++TY +  Q +S    +     N G I V+ ++D +  +   +F V A D  P+   K+ +  V I V D+ND  P I +     VT  D + N    I  ++   + +A +EV D D G   +V+C ++ +   +L   S +  +       Q   + +++R +E  +E V +   + A  +++ S+  Q+ D NDN+P F+   +       + P   V +V+A D D+  N+++ + I G    E  F+I+ ++G++     LDRE+ + +   + A D G P   GT  V ++V+D ND  P+F L+ Y FS+ EN    + VG VT  D D   N +++  +  D  +F               MI++    I++    DREK+S Y   + A+D G P   +S   + IN++D NDN P   K +N +   +    S    + +VEA D+D G NSE+ + I  GNP+G F  +++ +  +      K    H+LV+   DKG PP+ +  L
Sbjct:   18 WILLLLCCSANVVNTILYQVTEEQPPNTLIGSLAS--DQGLPDTGHLYKLEVGAPYL---RVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPE---NTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSD-EKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERS-HYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLH-QPSSPVMRLLSIDRNTGIIFVKGSVDREE-ISILKFYVQAKDNGPQS--KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVAN----ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPAL-SSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKF---------------MIQNGTYTILSTISFDREKESTYSFRLKAVDGGDP-PRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTAL 779          
BLAST of Protocadherin 1b vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 256.529 bits (654), Expect = 2.934e-70
Identity = 234/797 (29.36%), Postives = 372/797 (46.68%), Query Frame = 2
Query:  317 WILLLISS----ITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE------FQILAIANFDR-EEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD-HKLVISACDKGKPPKCSNPL 2596
            WILLL+      +     Q+ EE    T I  L       +      Y++  G   L    +D +T  + T +N IDRESL  C N    D   L F +S + + K          +EILD NDN P +      +S  E   N        I  A D D   N   DY L      T+    ++  DS   +  +L+ +  +DRE  D Y+L +   D GSP R  S  L I I D NDN P F+R+ +Y  +L EN+ +G   L V A D+D   NG++TY +  Q +S    +     N G I V+ ++D +  +   +F V A D  P+   K+ +  V I V D+ND  P I +     VT  D + N    I  ++   + +A +EV D D G   +V+C ++ +   +L   S +  +       Q   + +++R +E  +E V +   + A  +++ S+  Q+ D NDN+P F+   +       + P   V +V+A D D+  N+++ + I G    E  F+I+ ++G++     LDRE+ + +   + A D G P   GT  V ++V+D ND  P+F L+ Y FS+ EN    + VG VT  D D   N +++  +  D  +F               MI++    I++    DREK+S Y   + A+D G P   +S   + IN++D NDN P   K +N +   +    S    + +VEA D+D G NSE+ + I  GNP+G F  +++ +  +      K    H+LV+   DKG PP+ +  L
Sbjct:   18 WILLLLCCSANVVNTILYQVTEEQPPNTLIGSLAS--DQGLPDTGHLYKLEVGAPYL---RVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPE---NTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSD-EKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERS-HYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLH-QPSSPVMRLLSIDRNTGIIFVKGSVDREE-ISILKFYVQAKDNGPQS--KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVAN----ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPAL-SSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKF---------------MIQNGTYTILSTISFDREKESTYSFRLKAVDGGDP-PRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTAL 779          
BLAST of Protocadherin 1b vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 256.914 bits (655), Expect = 3.151e-70
Identity = 236/806 (29.28%), Postives = 376/806 (46.65%), Query Frame = 2
Query:  290 NFLMITFAAWILLLISS----ITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE------FQILAIANFDR-EEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD-HKLVISACDKGKPPKCSNPL 2596
            N+ M+    WILLL+      +     Q+ EE    T I  L       +      Y++  G   L    +D +T  + T +N IDRESL  C N    D   L F +S + + K          +EILD NDN P +      +S  E   N        I  A D D   N   DY L      T+    ++  DS   +  +L+ +  +DRE  D Y+L +   D GSP R  S  L I I D NDN P F+R+ +Y  +L EN+ +G   L V A D+D   NG++TY +  Q +S    +     N G I V+ ++D +  +   +F V A D  P+   K+ +  V I V D+ND  P I +     VT  D + N    I  ++   + +A +EV D D G   +V+C ++ +   +L   S +  +       Q   + +++R +E  +E V +   + A  +++ S+  Q+ D NDN+P F+   +       + P   V +V+A D D+  N+++ + I G    E  F+I+ ++G++     LDRE+ + +   + A D G P   GT  V ++V+D ND  P+F L+ Y FS+ EN    + VG VT  D D   N +++  +  D  +F               MI++    I++    DREK+S Y   + A+D G P   +S   + IN++D NDN P   K +N +   +    S    + +VEA D+D G NSE+ + I  GNP+G F  +++ +  +      K    H+LV+   DKG PP+ +  L
Sbjct:   33 NYAML---VWILLLLCCSANVVNTILYQVTEEQPPNTLIGSLAS--DQGLPDTGHLYKLEVGAPYL---RVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPE---NTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSD-EKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERS-HYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLH-QPSSPVMRLLSIDRNTGIIFVKGSVDREE-ISILKFYVQAKDNGPQS--KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVAN----ISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPAL-SSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKF---------------MIQNGTYTILSTISFDREKESTYSFRLKAVDGGDP-PRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTAL 800          
BLAST of Protocadherin 1b vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 247.669 bits (631), Expect = 4.744e-67
Identity = 223/736 (30.30%), Postives = 348/736 (47.28%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQ-------INCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV----SPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRESL  C N        +  ++ +   +SP        +EI+DINDN P++   S V++ +  E   +      I  A D D   N    Y L       D    ++  D    ++ +L+ + ++DREQ D Y+L +  +D G+P R  S  L I ILD NDN P F++  Y A +L EN+ +G   L V A D+D   N +I Y     +AS+          + G I V+  ID +  V   +FSV+A D       KT   +V I + D ND KP I +     VT +  + N    I  +V   + +A ++V D D G    V+C ++ +   +L+QV    S S K++ +      D E      ++I+  D      +++ S+  Q+ D NDN+P F++     V    +  N  V EV A D D+  NS++ + I+ +      F I+  SG++    VLDRE+ E ++  ++A D G P   GT  V I V+D ND  P+F L+ Y FS+ EN    + VG VT ID D   N  +   +  +            S  F +I++  G I++    DRE QS Y   + A+D G P   +S   V IN++D NDN P     +   +   T ++  G  +  V A D+D G N+E+ Y I  GNP+  F  +  N ++ L   + ++    H+LV+   DKGKP +    L
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNF--NSPVITLSIPENTNI-GMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQD-EKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSF--HQASDTVRRLLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANP--KTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVAN----ISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPE------------SGEF-VIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 815          

HSP 2 Score: 150.984 bits (380), Expect = 2.328e-36
Identity = 168/610 (27.54%), Postives = 266/610 (43.61%), Query Frame = 2
Query:  956 LELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRI-----------------EDQKASEYFNIGNNGNIMVRKNID-YDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL--SNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSP-----KFTRVFHFRVLENAS--VP-NMFVGEVMAVDKDAERNSKIEFQIIGNEE-HFFQIDSSGK-------MYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHK----LVISACDKGKPPKCSNPLWVTIKVVKQH-----ILIPN 2641
            L+  I+I+D NDN P F+ +      + EN NIG +    +A D D   NG  +Y +                 +D+K  +   +G    ++ R+  D YD  +K      +   G P    +     + I ++D ND  P       K + +  E  + EN  + +SVL  ++  D D G    +  S   +++   RL  +   D+   ++ +    DRE+    K  ++ KD+  N  TA   +   I D NDN P      F  V H   + N S  VP    V  V   D D   N+ +   + G+      Q+  +G        + T   LD E  +++ + I+A D G+PP + T  + ++V D+ND  P FS SL E    EN  I   V  V+A D D   N+++ Y I+ D  ++  +           I  D G+I    +LDRE++ HY   VVA+D G P S   T +V I ++D NDN P F   N   FS+         +G V  +D D GEN+ I   +E  +      F  QN    + S +S   +H+      + A D G PP+ S  + VTI V+ ++     I++P+
Sbjct:  160 LDGQIEIMDINDNTPNFN-SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMG----MLDREQRDSYDLTIK------VQDGGTPA---RASSALLRISILDTNDNAP-------KFEKMAYEAELPENSPMGHSVL-QVKANDSDQGVNAEIDYSFHQASDTVRRLLHL---DRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF----------SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFML-NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES----GEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSY-VGVTINVLDENDNAPVIVVPS 727          
BLAST of Protocadherin 1b vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 247.284 bits (630), Expect = 6.579e-67
Identity = 223/736 (30.30%), Postives = 348/736 (47.28%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQ-------INCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV----SPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRESL  C N        +  ++ +   +SP        +EI+DINDN P++   S V++ +  E   +      I  A D D   N    Y L       D    ++  D    ++ +L+ + ++DREQ D Y+L +  +D G+P R  S  L I ILD NDN P F++  Y A +L EN+ +G   L V A D+D   N +I Y     +AS+          + G I V+  ID +  V   +FSV+A D       KT   +V I + D ND KP I +     VT +  + N    I  +V   + +A ++V D D G    V+C ++ +   +L+QV    S S K++ +      D E      ++I+  D      +++ S+  Q+ D NDN+P F++     V    +  N  V EV A D D+  NS++ + I+ +      F I+  SG++    VLDRE+ E ++  ++A D G P   GT  V I V+D ND  P+F L+ Y FS+ EN    + VG VT ID D   N  +   +  +            S  F +I++  G I++    DRE QS Y   + A+D G P   +S   V IN++D NDN P     +   +   T ++  G  +  V A D+D G N+E+ Y I  GNP+  F  +  N ++ L   + ++    H+LV+   DKGKP +    L
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNF--NSPVITLSIPENTNI-GMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQD-EKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSF--HQASDTVRRLLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANP--KTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVAN----ISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPE------------SGEF-VIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 815          

HSP 2 Score: 150.599 bits (379), Expect = 3.741e-36
Identity = 162/586 (27.65%), Postives = 256/586 (43.69%), Query Frame = 2
Query:  968 IQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYR-IEDQKASEYFNIG-------NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL--SNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSP-----KFTRVFHFRVLENAS--VP-NMFVGEVMAVDKDAERNSKIEFQIIGNEE-HFFQIDSSGK-------MYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHK----LVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            I+I+D NDN P F+ +      + EN NIG +    +A D D   NG  +Y  I   +A + F +            ++V   +D +     +  ++   DG      +     + I ++D ND  P       K + +  E  + EN  + +SVL  ++  D D G    +  S   +++   RL  +   D+   ++ +    DRE+    K  ++ KD+  N  TA   +   I D NDN P      F  V H   + N S  VP    V  V   D D   N+ +   + G+      Q+  +G        + T   LD E  +++ + I+A D G+PP + T  + ++V D+ND  P FS SL E    EN  I   V  V+A D D   N+++ Y I+ D  ++  +           I  D G+I    +LDRE++ HY   VVA+D G P S   T +V I ++D NDN P F   N   FS+         +G V  +D D GEN+ I   +E  +      F  QN    + S +S   +H+      + A D G PP+ S  + VTI V+ ++
Sbjct:  164 IEIMDINDNTPNFN-SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQ-RDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAP-------KFEKMAYEAELPENSPMGHSVL-QVKANDSDQGVNAEIDYSFHQASDTVRRLLHL---DRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF----------SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFML-NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES----GEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSY-VGVTINVLDEN 717          
BLAST of Protocadherin 1b vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 247.669 bits (631), Expect = 8.872e-67
Identity = 223/738 (30.22%), Postives = 347/738 (47.02%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQ-------INCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV----SPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRI--ISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRESL  C N        +  ++ +   +SP        +EI+DINDN P++   S V++ +  E   +      I  A D D   N    Y L       D    ++  D    ++ +L+ + ++DREQ D Y+L +  +D G+P R  S  L I ILD NDN P F++  Y A +L EN+ +G   L V A D+D   N +I Y     +AS+          + G I V+  ID +  V   +FSV+A D       KT   +V I + D ND KP I +     VT +  + N    I  +V   + +A ++V D D G    V+C ++ +   +L+QV    S S K++ +      D E      ++I+  D      +++ S+  Q+ D NDN+P F++     V    +  N  V EV A D D+  NS++ + I+ +      F I+  SG++    VLDRE+ E ++  ++A D G P   GT  V I V+D ND  P+F L+ Y FS+ EN    + VG VT ID D   N  +   +   S  F               +I++  G I++    DRE QS Y   + A+D G P   +S   V IN++D NDN P     +   +   T ++  G  +  V A D+D G N+E+ Y I  GNP+  F  +  N ++ L   + ++    H+LV+   DKGKP +    L
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNF--NSPVITLSIPENTNI-GMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQD-EKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSF--HQASDTVRRLLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANP--KTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVAN----ISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEF---------------VIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 815          

HSP 2 Score: 151.369 bits (381), Expect = 2.196e-36
Identity = 163/589 (27.67%), Postives = 257/589 (43.63%), Query Frame = 2
Query:  956 LELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYR-IEDQKASEYFNIG-------NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL--SNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSP-----KFTRVFHFRVLENAS--VP-NMFVGEVMAVDKDAERNSKIEFQIIGNEE-HFFQIDSSGK-------MYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHK----LVISACDKGKPPKCSNPLWVTIKVVKQ 2623
            L+  I+I+D NDN P F+ +      + EN NIG +    +A D D   NG  +Y  I   +A + F +            ++V   +D +     +  ++   DG      +     + I ++D ND  P       K + +  E  + EN  + +SVL  ++  D D G    +  S   +++   RL  +   D+   ++ +    DRE+    K  ++ KD+  N  TA   +   I D NDN P      F  V H   + N S  VP    V  V   D D   N+ +   + G+      Q+  +G        + T   LD E  +++ + I+A D G+PP + T  + ++V D+ND  P FS SL E    EN  I   V  V+A D D   N+++ Y I+ D  ++  +           I  D G+I    +LDRE++ HY   VVA+D G P S   T +V I ++D NDN P F   N   FS+         +G V  +D D GEN+ I   +E  +      F  QN    + S +S   +H+      + A D G PP+ S  + VTI V+ +
Sbjct:  160 LDGQIEIMDINDNTPNFN-SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQ-RDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAP-------KFEKMAYEAELPENSPMGHSVL-QVKANDSDQGVNAEIDYSFHQASDTVRRLLHL---DRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF----------SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFML-NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES----GEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSY-VGVTINVLDE 716          
BLAST of Protocadherin 1b vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 248.054 bits (632), Expect = 1.153e-66
Identity = 223/736 (30.30%), Postives = 348/736 (47.28%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQ-------INCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV----SPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRESL  C N        +  ++ +   +SP        +EI+DINDN P++   S V++ +  E   +      I  A D D   N    Y L       D    ++  D    ++ +L+ + ++DREQ D Y+L +  +D G+P R  S  L I ILD NDN P F++  Y A +L EN+ +G   L V A D+D   N +I Y     +AS+          + G I V+  ID +  V   +FSV+A D       KT   +V I + D ND KP I +     VT +  + N    I  +V   + +A ++V D D G    V+C ++ +   +L+QV    S S K++ +      D E      ++I+  D      +++ S+  Q+ D NDN+P F++     V    +  N  V EV A D D+  NS++ + I+ +      F I+  SG++    VLDRE+ E ++  ++A D G P   GT  V I V+D ND  P+F L+ Y FS+ EN    + VG VT ID D   N  +   +  +            S  F +I++  G I++    DRE QS Y   + A+D G P   +S   V IN++D NDN P     +   +   T ++  G  +  V A D+D G N+E+ Y I  GNP+  F  +  N ++ L   + ++    H+LV+   DKGKP +    L
Sbjct:  108 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNF--NSPVITLSIPENTNI-GMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQD-EKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSF--HQASDTVRRLLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANP--KTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVAN----ISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPE------------SGEF-VIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 815          

HSP 2 Score: 151.754 bits (382), Expect = 1.973e-36
Identity = 166/599 (27.71%), Postives = 260/599 (43.41%), Query Frame = 2
Query:  956 LELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRI-----------------EDQKASEYFNIGNNGNIMVRKNID-YDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL--SNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSP-----KFTRVFHFRVLENAS--VP-NMFVGEVMAVDKDAERNSKIEFQIIGNEE-HFFQIDSSGK-------MYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHK----LVISACDKGKPPKCSNPLWVTIKVVKQ 2623
            L+  I+I+D NDN P F+ +      + EN NIG +    +A D D   NG  +Y +                 +D+K  +   +G    ++ R+  D YD  +K      +   G P    +     + I ++D ND  P       K + +  E  + EN  + +SVL  ++  D D G    +  S   +++   RL  +   D+   ++ +    DRE+    K  ++ KD+  N  TA   +   I D NDN P      F  V H   + N S  VP    V  V   D D   N+ +   + G+      Q+  +G        + T   LD E  +++ + I+A D G+PP + T  + ++V D+ND  P FS SL E    EN  I   V  V+A D D   N+++ Y I+ D  ++  +           I  D G+I    +LDRE++ HY   VVA+D G P S   T +V I ++D NDN P F   N   FS+         +G V  +D D GEN+ I   +E  +      F  QN    + S +S   +H+      + A D G PP+ S  + VTI V+ +
Sbjct:  160 LDGQIEIMDINDNTPNFN-SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMG----MLDREQRDSYDLTIK------VQDGGTPA---RASSALLRISILDTNDNAP-------KFEKMAYEAELPENSPMGHSVL-QVKANDSDQGVNAEIDYSFHQASDTVRRLLHL---DRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF----------SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFML-NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES----GEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSY-VGVTINVLDE 716          
BLAST of Protocadherin 1b vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 247.669 bits (631), Expect = 1.613e-66
Identity = 223/738 (30.22%), Postives = 347/738 (47.02%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQ-------INCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV----SPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRI--ISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRESL  C N        +  ++ +   +SP        +EI+DINDN P++   S V++ +  E   +      I  A D D   N    Y L       D    ++  D    ++ +L+ + ++DREQ D Y+L +  +D G+P R  S  L I ILD NDN P F++  Y A +L EN+ +G   L V A D+D   N +I Y     +AS+          + G I V+  ID +  V   +FSV+A D       KT   +V I + D ND KP I +     VT +  + N    I  +V   + +A ++V D D G    V+C ++ +   +L+QV    S S K++ +      D E      ++I+  D      +++ S+  Q+ D NDN+P F++     V    +  N  V EV A D D+  NS++ + I+ +      F I+  SG++    VLDRE+ E ++  ++A D G P   GT  V I V+D ND  P+F L+ Y FS+ EN    + VG VT ID D   N  +   +   S  F               +I++  G I++    DRE QS Y   + A+D G P   +S   V IN++D NDN P     +   +   T ++  G  +  V A D+D G N+E+ Y I  GNP+  F  +  N ++ L   + ++    H+LV+   DKGKP +    L
Sbjct:  100 LRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNF--NSPVITLSIPENTNI-GMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQD-EKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSF--HQASDTVRRLLHLDRSTGLITVQGPIDRE-DVGTLKFSVVAKDKGANP--KTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVAN----ISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEF---------------VIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTAL 807          

HSP 2 Score: 151.369 bits (381), Expect = 2.227e-36
Identity = 163/589 (27.67%), Postives = 257/589 (43.63%), Query Frame = 2
Query:  956 LELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYR-IEDQKASEYFNIG-------NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL--SNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSP-----KFTRVFHFRVLENAS--VP-NMFVGEVMAVDKDAERNSKIEFQIIGNEE-HFFQIDSSGK-------MYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHK----LVISACDKGKPPKCSNPLWVTIKVVKQ 2623
            L+  I+I+D NDN P F+ +      + EN NIG +    +A D D   NG  +Y  I   +A + F +            ++V   +D +     +  ++   DG      +     + I ++D ND  P       K + +  E  + EN  + +SVL  ++  D D G    +  S   +++   RL  +   D+   ++ +    DRE+    K  ++ KD+  N  TA   +   I D NDN P      F  V H   + N S  VP    V  V   D D   N+ +   + G+      Q+  +G        + T   LD E  +++ + I+A D G+PP + T  + ++V D+ND  P FS SL E    EN  I   V  V+A D D   N+++ Y I+ D  ++  +           I  D G+I    +LDRE++ HY   VVA+D G P S   T +V I ++D NDN P F   N   FS+         +G V  +D D GEN+ I   +E  +      F  QN    + S +S   +H+      + A D G PP+ S  + VTI V+ +
Sbjct:  152 LDGQIEIMDINDNTPNFN-SPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQ-RDSYDLTIKVQDGGTPA--RASSALLRISILDTNDNAP-------KFEKMAYEAELPENSPMGHSVL-QVKANDSDQGVNAEIDYSFHQASDTVRRLLHL---DRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIF----------SINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFML-NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPES----GEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSY-VGVTINVLDE 708          
BLAST of Protocadherin 1b vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 269.24 bits (687), Expect = 1.848e-74
Identity = 227/764 (29.71%), Postives = 367/764 (48.04%), Query Frame = 2
Query:  425 IVSVSTSYRIFDGNKLLNC------LHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEI----IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSP----SDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            I S++  Y + D   L         L +D +T  + T +  IDRE L  C NQI  +  +L F +S + + ++ +       +E+ DINDN P++   S V++    E   + S    I  A D D   N    Y L+   G     ++ ++  +    ++ +L+ +  +DRE+ D Y+L +  +D G+P R  S  L + +LD NDN P F+R  Y A +LSEN+ IG   + V A D+D  AN +I Y     +A E          N G I V+  +D +  +   +FSVLA D GA     K+   +VV+ V D ND  P I    I  VT +D + N    I  +V   + +A ++V D D G    V+C ++ +   +L Q S     S K++ +      D E+     ++I+  D      +++ S+  Q++D NDN+P FT+          + P   V EV A D D+  N+++ + +      +  F I   +G++  K  LDRE+ + + + ++A D G P   GT  V + V+D ND  P+F LS Y FS+ EN    + VG VT ID D   N +++  +  D                 +I++  G I++    DRE+QS Y   + A+D G P   ++   V IN++D NDN P     + T   + T ++ +G  +  V A D+D G N+E+ Y I  GNPYG F   + +  + L   + ++    H+LV+   D+GKPP+    L
Sbjct:   52 IGSLAADYGLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF--ASPVITLAIPENTNIGS-LFPIPLATDRDAGPNGVASYELQ--AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEA-ELSENSPIGHSVIQVKANDSDQGANAEIDYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGA---TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN----ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDF-------------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP-PRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTAL 785          
BLAST of Protocadherin 1b vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 269.24 bits (687), Expect = 1.848e-74
Identity = 227/764 (29.71%), Postives = 367/764 (48.04%), Query Frame = 2
Query:  425 IVSVSTSYRIFDGNKLLNC------LHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEI----IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSP----SDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            I S++  Y + D   L         L +D +T  + T +  IDRE L  C NQI  +  +L F +S + + ++ +       +E+ DINDN P++   S V++    E   + S    I  A D D   N    Y L+   G     ++ ++  +    ++ +L+ +  +DRE+ D Y+L +  +D G+P R  S  L + +LD NDN P F+R  Y A +LSEN+ IG   + V A D+D  AN +I Y     +A E          N G I V+  +D +  +   +FSVLA D GA     K+   +VV+ V D ND  P I    I  VT +D + N    I  +V   + +A ++V D D G    V+C ++ +   +L Q S     S K++ +      D E+     ++I+  D      +++ S+  Q++D NDN+P FT+          + P   V EV A D D+  N+++ + +      +  F I   +G++  K  LDRE+ + + + ++A D G P   GT  V + V+D ND  P+F LS Y FS+ EN    + VG VT ID D   N +++  +  D                 +I++  G I++    DRE+QS Y   + A+D G P   ++   V IN++D NDN P     + T   + T ++ +G  +  V A D+D G N+E+ Y I  GNPYG F   + +  + L   + ++    H+LV+   D+GKPP+    L
Sbjct:   52 IGSLAADYGLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF--ASPVITLAIPENTNIGS-LFPIPLATDRDAGPNGVASYELQ--AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEA-ELSENSPIGHSVIQVKANDSDQGANAEIDYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGA---TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN----ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDF-------------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP-PRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTAL 785          
BLAST of Protocadherin 1b vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 254.988 bits (650), Expect = 1.943e-69
Identity = 202/676 (29.88%), Postives = 326/676 (48.22%), Query Frame = 2
Query:  638 NDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSP----SDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            NDN P++   S V++    E   + S    I  A D D   N    Y L+   G     ++ ++  +    ++ +L+ +  +DRE+ D Y+L +  +D G+P R  S  L + +LD NDN P F+R  Y A +LSEN+ IG   + V A D+D  AN +I Y     +A E          N G I V+  +D +  +   +FSVLA D GA     K+   +VV+ V D ND  P I +     VT +D + N    I  +V   + +A ++V D D G    V+C ++ +   +L Q S     S K++ +      D E+     ++I+  D      +++ S+  Q++D NDN+P FT+          + P   V EV A D D+  N+++ + +      +  F I   +G++  K  LDRE+ + + + ++A D G P   GT  V + V+D ND  P+F LS Y FS+ EN    + VG VT ID D   N +++  +  D                 +I++  G I++    DRE+QS Y   + A+D G P   ++   V IN++D NDN P     + T   + T ++ +G  +  V A D+D G N+E+ Y I  GNPYG F   + +  + L   + ++    H+LV+   D+GKPP+    L
Sbjct:    1 NDNTPNF--ASPVITLAIPENTNIGS-LFPIPLATDRDAGPNGVASYELQ--AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEA-ELSENSPIGHSVIQVKANDSDQGANAEIDYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGA---TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN----ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDF-------------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP-PRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTAL 646          

HSP 2 Score: 122.865 bits (307), Expect = 9.480e-28
Identity = 132/517 (25.53%), Postives = 233/517 (45.07%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFI-------SPSYVSKSLNVEILDINDNAPSW--------PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTS----RRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASE-YFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFH--FRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEV 1948
            L +D  T ++TV+  +DRE L          LRF +       +P      + V + D+NDNAP+           Q  + + +E   +  E   + + +  D D  EN+ +   +        +  ++++  S T     ++  L     +D E+V  Y + ++A D+G+P  + +  L +Q++D NDN P+F ++        EN   G V   V+A DAD  +N ++ Y +E + A++  F I   NG I V+ ++D +     ++  V+A D G+P      G   V++ V+D ND  P+ ++       + N PA+        S +  + V D D G    V  S+  ++   + Q    +    IL+  +FDRE++S     +   D      +A   +   +LD NDN+P  T   +   R+L   +     V +V A D D+  N+++ + I  GN    FQI S SG +  ++ ++R       + +   D G PP+ GT LV + V
Sbjct:  169 LRLDRNTGLITVQGPVDREDLS--------TLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISE---DVAEETAVALVQVSDRDEGENAAVTCVV------AGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEV-AFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQ-RDSYELKVVAADRGSPS---LQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPAL--------SPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQ----NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 651          

HSP 3 Score: 122.865 bits (307), Expect = 1.015e-27
Identity = 144/584 (24.66%), Postives = 245/584 (41.95%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWK-IKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFD-RAKYYANKLSENANIG-------FVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGN-------IMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRD-PLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMR-LEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMF-VGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFS---ISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSY 2269
            P   S  L V +LD NDNAP + + +     +  E + +    I + KA D D   N++IDY       +    V + ++ D +T       P   +DRE +      ++A+D G+  ++   ++++ + D NDN P  + R           ANI         VAL V   D D   N  +T  +      +       G+       +     +DY+  VK +   ++A+D        T   +V   V+D ND  P     +T+   P  N+P           V+A +   D D G    +  SL      + L  +SP + E ++    + DRE++   ++ ++  D+   +   + +++  +LD NDN PKF    ++F V+EN  +P +  VG V  +D D   N++++  +  +   F   + +G + +    DRE+   +   + A DGG PP++    VTI V+D ND  P F  +    S   ++    +G +V  VTA D D   N ++ Y I            Y     FQ+  H  G I  +  ++R     + L V   D G P  Y
Sbjct:   98 PRASSALLRVTVLDTNDNAPKFERPTYEAELS--ENSPIGHSVIQV-KANDSDQGANAEIDYTFH----QAPEVVRRLLRLDRNTGLITVQGP---VDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVAL-VQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEK-VKDYTIEIVAVDSGNPPLSSTNSLKV--QVVDVNDNAPVFTQSITEVAFPENNKPG---------EVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVK--TSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMEN--MPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-FITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN-------PYGL---FQIGSHS-GAITLEKEIERRHHGLHRLVVKVSDRGKPPRY 642          
BLAST of Protocadherin 1b vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 228.409 bits (581), Expect = 1.519e-61
Identity = 211/723 (29.18%), Postives = 337/723 (46.61%), Query Frame = 2
Query:  503 HVVTVKNRIDRESLCPN-----QINCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA---SEYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-----------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKT--SNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
             + T  NRIDRE LC       +  C   L   I P+   + + ++I+  D NDNAP +P  S V++ +  E   + SR   I  A DPD   N    Y L   NG++  G+  I       +  +L+  + +DREQ D Y + +  ED G+P+++ +  L + + D NDN P+F   +   + + ENA +G   + + A DAD  +N +I Y    Q A      F + N  G I V++++D +      + +VLA DG+    R T    V I V D ND  P I            V+++++DP+  + A+I            +  KD D  G+  V C +       L+ V   D ++ +   +  D E        I+  D    + +++ + ++   D NDN P F + V    V EN +   +++  + A D+D+ +N+ I +Q+ G    FF +D  +G +   +V +REE E+F  T+ A+D G PP      V + V+D ND  P+F+ + ++F +SEN    ++VG +T  D D   N  +   I++D   F  + Y                G I +    DRE+QS Y   V A D G P   +ST  V IN++DVNDN P   +  SN +   +  +   G  +  V AVD+D G N+E+ Y I  GN  G F  +     + L    +  D   H+LV++  D G P
Sbjct:   84 EIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSR-FPIPSATDPDTGFNGVQHYEL--LNGQSVFGL-DIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH-IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAI-HKVTVLASDGSSTPARAT----VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALIT-----------VSDKDTDVNGK--VICFIEREVPFHLKAVY--DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSEN-NRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPY---------------SGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1b vs. Ensembl Mouse
Match: Fat4 (FAT atypical cadherin 4 [Source:MGI Symbol;Acc:MGI:3045256])

HSP 1 Score: 232.646 bits (592), Expect = 2.413e-61
Identity = 213/753 (28.29%), Postives = 350/753 (46.48%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYD-----SSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPD--FGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKD----------QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQV---LDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSL-SLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHD--RGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPLWVTIKVV 2617
            +YR+ + + L     I+  T  +     IDRESL  + +N  ++     SP+Y ++ + V + D+NDNAP +P  S VV+F E  G+    R + +D A D D+  N    +  +  +G   N   + + D     S     + L+    +DRE    Y+L++  ED G PKR G L++ + + D NDN P+F  + Y A  + E+A +G   L V+A DAD   N  I YR++D+  + +      G I VR+ +D++A  + +  +V A D G P     TG  E  I ++D ND  P +     +  P T+  A ++      +V+A + V D D      +I    L  N++   E          ++ +A+  DRE      + +   D          QA ++ +  ++F + D ND+ P F +  +   L     P  +V  V A D D+  N+ + + I+ GN   +F I     + T      LDRE   +  + I A+D G  PK     + + V+D+ND KP FS    YE S+ ENA  GT +  + A DRDL  N  +++ +      +            ++ R D   G + T   LDRE+Q+ Y L+++A D G P   +ST  V ++++D+NDN P F    +    IQ  E  G  + TV A D D G N  + Y I  G+    F  + ++  +     L +++   ++L + A D G   +  N   VT+ V+
Sbjct:   71 TYRLSESHALF---AINSSTGALYTTATIDRESLPSDVVNLVVLSS---SPTYPTE-VRVLVRDLNDNAPVFPDPSIVVTFKEDSGS---GRQVILDTATDSDIGSNGVDHHSYRIVSG---NEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAG-VPEDAVVGSSVLQVAAADADEGTNADIRYRLQDE-GTPFQMDPETGLITVREPLDFEA-RRQYSLTVQATDRGVPS---LTGRAEAFIQLLDVNDNDPVVKF---RYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIF-VNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQ------------RLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSP-PQSSTAQVNVSLLDINDNSPVFYPV-QYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGD-RSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGN-LQSPNQAIVTVTVL 784          

HSP 2 Score: 213.001 bits (541), Expect = 4.050e-55
Identity = 202/736 (27.45%), Postives = 336/736 (45.65%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPS-----WPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKV---IDREQVDVYELILIAEDN-GSP------KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFS---VLAIDGAPEE-YRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL--SNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKL-ILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKV 2614
              +DPET ++TV+  +D E+     +      R   S +  +++  +++LD+NDN P      +P  S+  S  E          + +  A  P  N N  +             G  +  ++   S+   L  IKV   +DRE++  Y L +   DN G+P       R+    L+I + D ND+ P+F++  Y  N LSE    G     VSA D D   N  + Y I       +F+I  +  ++        AG    + +   VL I    +  + K    ++V+ V+D NDEKP          P   E +++EN      +L  +   D D G    V  SL  + ND+ RL ++ P          ++ DREE++   + IL  D      +++  +   +LD NDNSP F  V +F  ++       +V  V A D D   N  +++ I   +   FQI + SG + TK  LDREE   + + ++A DGG+       +VT+ V+D  D  P FS + Y F + EN  +G  VG+V+A   DL AN  + Y I +    +   F  +            G++ T  ++DRE+QS Y L +VA       + T  T V I + D+NDN P F  + +++ +++  ++ G+ I   +AVD D G N  ++Y +++ NP   F+ N QN  + +L ++      +++ I A D G  P+ S+ + +T+ V
Sbjct:  296 FQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAF-IQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQIL---------GGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVN-LSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSA----AGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVF------SQPEGYEVSVVENAPTGTELLV-LGATDRDLGDNGTVRFSLQEAENDQ-RLFRLDPVSGRLS--TASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGDRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLNAN--ISYLITTG--DQRGMFAMNPV---------TGQLTTASVIDREEQSFYQLKIVA----SGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAVENWQA-GHSIFQAKAVDPDEGVNGRVLYSLKQ-NPKNLFTINEQNGNISLLGALDVHAGSYQVEIVASDMGV-PQLSSSILLTVYV 986          

HSP 3 Score: 187.193 bits (474), Expect = 3.732e-47
Identity = 198/761 (26.02%), Postives = 330/761 (43.36%), Query Frame = 2
Query:  353 KIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRES---LCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPS-WPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSST-SRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREK------QSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVG--YEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPP 2578
            ++ + E    GTE+ VL    ++   + +  + + +         +DP +  ++  + +DRE     C + +  D+       P   +  +NV +LDINDN+P  +P Q     F   + N+     +    A DPD+  N  + Y +       D   ++I   S   S ++ L      DRE+   Y+L ++A D G+ +      + + +LD  DN P+F +A Y +  + EN  +G+   +VSA   D  AN  I+Y I        F +    G +     ID +     +Q  ++A  GA      TG+  V I V D ND  P  +  V   +        +EN    +S+    +  DPD G    V  SL  N K      + +++   I  +   D    S + V+I+  D      S SI+  +   D NDN P F ++ +   L  +   N    +V A DKD+  N +I + I  GN    F I   G++Y K  LDRE  +++ + ++A D    P + T  VT+ + D+ND +P F+ + Y F   E    G+ VG V+A+D+D   N +++Y              +  + P   +    GEI + +  DRE        + +  TV A+D G P       TV + + D+NDN P F    K  +    +E+     ++  V A D+D G N  I Y I +GN    F+ ++ + ++ L   L  +    + L+I A D G  P
Sbjct:  589 EVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLG----SPPQSSTAQVNVSLLDINDNSPVFYPVQY----FAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSIS----AGDRSRFQIHAKSGVISTKMAL------DREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAY-SFVVFENVALGYHVGSVSATTMDLNAN--ISYLITTGDQRGMFAMNPVTGQLTTASVIDREE-QSFYQLKIVASGGA-----VTGDTVVNITVKDLNDNAPHFLQAVESIN-------AVENWQAGHSIF-QAKAVDPDEGVNGRVLYSLKQNPKNLF---TINEQNGNISLLGALDVHAGSYQ-VEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRY-------------AFEVTQPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFL---KDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIP 1294          

HSP 4 Score: 187.193 bits (474), Expect = 3.996e-47
Identity = 197/674 (29.23%), Postives = 301/674 (44.66%), Query Frame = 2
Query:  626 ILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV------SPSDKEFQILAIA-------NFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPK 2581
            ILD+NDN P +   S   S  E   N     T+ +    D D   NSQ+ Y +      + + + +   D    +   L  +K +DRE    Y L++   D   P   + T + ++ I +LD NDN P+F   K     + EN  I  V     A D D   N  I Y + +   ++ F+IG  +G + +   +D +  V  +  +V+A D G P     T   EVV+MV+D ND  P                       +    +  +++K+    G DI+  S ++ND+    QV        + +EF+I ++        + DRE      + +   D+  +  T S ++   +LD ND  P F    +   V EN       + +V+A D D   NS++ + ++G NE++ F + +SG++   Q LDRE  + F + + A D G P  TGTG + I V DIND  P F+ ++Y  SI+E+A  GT V  V A D D  AN  + Y II       S F          I    G+I+T  LLDRE + +Y L VVA D G P S +S+T+V + I DVNDN P F+  +  V  I +    G  +  V   D D G NSE+ Y +  G     F  +     ++    LS   +    +   D G  PK
Sbjct: 1934 ILDVNDNPPVFSMSSYSTSLME---NLPLGSTVLVFNVTDADDGVNSQLSYSIA-----SGDSLGQFAVD----KHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKL--TYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNK-FSIGTIDGEVHLTGELDREE-VSNYSLTVVATDKGQPPLSSST---EVVVMVLDINDNNP-----------------------VFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVVTAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSII----GGNSQF---------TINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQ-HHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSL-SGRNSEKFHIDPLRGAIMAAGPLSGASEVTFSVHVKDGGSFPK 2550          

HSP 5 Score: 185.652 bits (470), Expect = 9.974e-47
Identity = 192/710 (27.04%), Postives = 326/710 (45.92%), Query Frame = 2
Query:  353 KIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVS-KSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL-SNNDKMRLEQVSPSDKEFQILA---IANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFTRVFHFR-VLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIE 2452
            K Q F  P+N     ++T    +++   + SY I  GN L +   IDP T  V++   +D E +   +    I  R    P + S + L++ +LDINDNAP++ +   V    E     L  R I    A D D   N Q+DY + + N ++    + I + +      E+  I+ +DRE++  YEL + + D GSP ++ S+++II ILD+NDN P F  ++ ++  +SEN+ +G+    V+  D D   N    Y I D       N  N G+I++ + ++ +   + ++  V A D        T   +V I V D ND  P      ++     + P + E      S +  +   DPD G    V   + S ++  R+   +      Q+L    ++ F     +     +   D+   +  +  ++    +D NDN P+F +  +F  V +N  V    +      DKD   NS++E+ +  GN    F++D+ +G +     L  +  + F + + AKD G+PP +   +V I V + N   PEFS +    +I E+  IG+ V TV+A DRD   N  + Y IIS   ++E  F  +SS          G +     LD E  S + +T+ A D G   + T   ++ +++IDVNDN P F   ++   ++      G  +  + A D D G N+ I Y ++
Sbjct: 2572 KEQTFMFPENQPVGTLVTTITGSSLRGETLSYYIASGN-LGDTFQIDPLTGQVSISQPLDFEKI--QKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILE----NLSPRKILTVSATDKDSGPNGQLDYEIVNGNQESS---FTINHATG-----EIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRF--SQIFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTIN-PNTGDIVISRPLNREDTDR-YRIRVSAHDSG-----WTVSTDVTIFVTDINDNTPRF----SRPSYYLDCPELPE----LGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISG--NEEGIFAINSS---------TGVVTLAKALDYEMSSKHEMTISATDGGW-VARTGYCSLTVSVIDVNDNSPVF-VPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQ 3236          

HSP 6 Score: 182.956 bits (463), Expect = 7.237e-46
Identity = 187/668 (27.99%), Postives = 295/668 (44.16%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE-DQKASEYFNIGNNGNIMVRKNIDYDA-----GVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY----NTASKSIVFQILDRNDNSPKFTRVFHF-RVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEH-FFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHP--NSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKG 2569
            L V + D+NDN P + Q S  V+ +E E   + SR   + +A D D   N +I Y + D N     G++    D     + EL      DRE  D Y L+++A D      + ++ + + + D NDN P+F+   Y      E    G     VSA D D+  NG++ Y  E  Q   E   +   G I      D ++     G   F F+V A+D G P+  +   +  V + + D ND  P+ +    +        A +     + + +  +   D D G   ++  S+   ++ R  Q +      Q+  +   D E  S   + I   D       +T + SI   ILD NDN+P F +   F  VLEN  +  + V  V A D D+  N+ + + I G+  H  F I  ++G ++  + LD E    + + I AKD G PP++ T  V I+V D ND  P F       SI EN  +GTSV +VTA D D   N ++ Y II  +  + ++F          I   +G I T   +DRE  + + LTV A D   P      +   V I + D+NDN P F + N    +   +  +G  + T+ A D D G N E+ Y+I  G+   +          + ++++  Q  + L++SA D G
Sbjct:  982 LTVYVHDVNDNPPVFDQISYEVTLSESE--PVNSRFFKV-QASDKDSGANGEIAYTITDGNNGDAFGIFP---DGQLYIKSEL------DRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNY-TFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAV--TGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKD--QATVHVYMKDINDNAPKFLKDFYQ--------ATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEER--QFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSI--DILDENDNTPSFPKSTLFVDVLENMRIGEL-VSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAII-QQMPRGNHFS---------IDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQN--ALAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLIYNLIVSATDLG 1607          

HSP 7 Score: 169.859 bits (429), Expect = 7.022e-42
Identity = 193/693 (27.85%), Postives = 311/693 (44.88%), Query Frame = 2
Query:  602 VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYE--------LILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSA-KDADYLANGKITYRIEDQKASEYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIV-HVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSS-GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGH-PNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLD-FGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKC-SNPLWVTIK 2611
            VS  + + + DINDN P + + S  +   E    +L SR   +  A DPD   N Q+ YF+K ++          +Y    +   E+   +V+  + V  +          I+ A D G+P       + I  +D NDN P F + KY+   +++N  +G   + V+A  D D+  N ++ Y + D      F + N+ G I +  ++  D   + F   V A D G P     + +  V I V +EN   PE    H++   P        E+  I  SV+  +  +D D     ++S ++ + ++  +  ++ S      LA A  D E  S  ++ I   D  +   T   S+   ++D NDNSP F    F   V+ENA      +  + A D D+  N+ I + +  ++   F ID + G + T+  LD E  + +++T+ A +  D  K     V I++   N++ P F   LY F +SE A  GT+VG V A DRD+ A+ ++ Y I  +  S++  FQ         I    G+I    LLDREK+    L V+A + G+   +     TV I ++D ND  P F  S    + +Q +E V  G  +  V A D D     S   Y I  GN  G FS N Q  ++ + S L ++    + L + A D G P    S  L VT++
Sbjct: 2856 VSTDVTIFVTDINDNTPRFSRPSYYLDCPELP--ELGSRVTQV-SATDPDEGSNGQVFYFIKSQS----------EYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFT-PVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLN-QNFLIRVTAKDKGNPP---LSSQAVVHITVTEENYHTPEFSQNHISATIP--------ESHSI-GSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAIN-SSTGVVTLAKA-LDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVI-HLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGN--SRKKGFQ---------INKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDP-PVFSLS---TYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLE 3503          

HSP 8 Score: 162.925 bits (411), Expect = 1.106e-39
Identity = 197/758 (25.99%), Postives = 317/758 (41.82%), Query Frame = 2
Query:  356 IQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDN-GVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRD------IVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKS-MEKVDILC--KDQAY-NTASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSV-LSKQDDHKLVISACDKGKPP 2578
            + + E  + G  +  +T    ++ V+    Y I   N       I P T  + +  ++D E+    ++N     +    P   + S+ +++ D NDN PS+P      S  E     L +  I +  A DPD + N Q+ Y +  +  + ++  + ++K    TS  I        DRE  +++EL + A D   P   +R     + I + D NDN P+F      A   S  A IG V  T+ A D D  ANG++ Y I +     +     +G++ V   +     +  +   V A D  PE  + T E  V++  +D        +   TK   +  E   I   VIS      IE   P   G +      IVS         RL  +       Q  AI   DRE+ + +  VD+    K  A+  T    +   + D NDN P F T      V EN    +  + ++ A+D D   N+ + + +I   +  F+ID  SG +   + LDRE   K+++ + A DG    ++    + I + D+ND  P FS  +Y F I E+   G+ V  + A D D   N ++ Y +  D      +    + + F + R           LD E Q +Y+LTV A D G     ++T     NI+DVNDN P F  S+ +  S+     +G  +      D D G NS++ Y I  G+  G F+ +       L ++    Q  + LVI   D  +PP
Sbjct: 1322 VDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNH-GTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGR-PPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVE--NIPLGTSVISV-TAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEI--------DREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPS--AMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLI--YNLIVSATDLGPERRKSTTELTVILQGLDGP------VFTQTKYITILKEGEPIGTNVIS------IEAASPR--GSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAI--LDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIM-QLTAMDADEGANALVTYALISGADDSFRIDPESGDLIATKRLDREHRSKYSLLVRADDG---LQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGV-FNLTR----------ALDYETQQYYILTVRAEDGG---GQSTTIRAYFNILDVNDNPPVFSMSSYST-SLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDKHGVLKTLKALDRESQSFYNLVIQVHDLPQPP 2027          

HSP 9 Score: 162.54 bits (410), Expect = 1.345e-39
Identity = 196/730 (26.85%), Postives = 320/730 (43.84%), Query Frame = 2
Query:  446 YRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA-SEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGA-PEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDI----LCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSK--IEFQIIG--NEE----HFFQID-SSGKMYTKQVLDREETE-KFNVTILAKDGGDP-PKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVL--SKQDDHKLVISACDKG 2569
            Y I  GN+      ID  +  VT+  ++D E+     +    +    I P   + +L+++ILD NDN PS+P+ +  V   E   N      +    A D D   N+ + Y +    G  ++G + I  ++ +     +   K +D E   +Y+L + A+D G P R+ ++ ++IQ+ D NDN P F     +   + EN  +G   ++V+A D D   NG+++Y I  Q     +F+I    G I     ID +     F+ +V A D A P E R+     V I+V D ND  P  I     ++ L  +P+      +  SVL  I   DPD G    V   + N D          D+    L +A+     + +  + +    L  ++  +T   +++ Q LD     P FT+  +  +L+           V++++  + R S+  +E+ I+    EE      F I   +G + T  +LDRE+    + V + A +     P+T    V I + DIND  P F     + ++ EN G G+ +  +TA+D D  AN  + Y +IS   + +S+           I  + G+++    LDRE +S Y L V A D       +S   + I I DVND+ P F   ++ V+S    E    G  +  + A D D G N EI Y +EE +  G F  N       L   L    Q  + L + A D G
Sbjct: 1247 YSILKGNEERQ-FAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAI-PLNSTCTLSIDILDENDNTPSFPKSTLFVDVLE---NMRIGELVSSVTATDSDSGVNADLHYTI---TGSNNHGTFSISPNTGS-----IFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIF-KSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREF-ANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFI----SQNALAADPS-----AMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFT----VDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTVILQGLD----GPVFTQTKYITILKEGEPIGT---NVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISG--ADDSF----------RIDPESGDLIATKRLDREHRSKYSLLVRADDGLQ----SSDMRINITISDVNDHTPRF---SRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGG 1922          

HSP 10 Score: 152.91 bits (385), Expect = 1.158e-36
Identity = 189/690 (27.39%), Postives = 296/690 (42.90%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEII--VHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA---YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSL--PFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVG-YEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            P   S  + V +LDINDN P + Q    V   E   N L    I    A D D   N Q+ Y +   N        + + DS T     +   K +DRE    Y L + A D GS  RT S  + I +LD ND  P+F+ + Y  N       +    L V A+D D   N +++Y +        F +  +G + V +++D +A    F   V A D G+P     TG   + I+V D ND  P     +++T         +I E+      VL  +   D D     ++S S+   +     Q + +    QI+  A  DRE K    + ++  D       ++S S++  I D NDN P+F    +   + + + P  FV  V   D D   NS++ + + G     F ID   G +     L       F+V +  KDGG  PKT +  VT+   +  D+ P+       F   EN  +GT V T+T                 S R    SY+  S +L   FQ I    G++     LD EK   Y++ + A D G P  ++S   + I ++D+NDN PTF+   +  F  +  E++   +I TV A D D G N ++ Y+I  GN    F+ N    ++     L ++    ++L + + DKG P + S  + V I ++ ++
Sbjct: 2133 PLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKE---NILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTH-----QEFRIDSVTG---AITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREA-RDHFVLVVTAADAGSPA---LTGTGTINIIVDDINDNVPTFANNMYLT---------SIAEDARTGTDVLL-VNASDADAAANAVISYSIIGGNS----QFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLSGASEVTFSVHV--KDGGSFPKTDSTTVTVRFANKADF-PKVRAKEQTFMFPENQPVGTLVTTITG---------------SSLRGETLSYYIASGNLGDTFQ-IDPLTGQVSISQPLDFEKIQKYVVWIEARDGGFP-PFSSYEKLDITVLDINDNAPTFE---EDPFVSEILENLSPRKILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQ-STSVKVIISILDEN 2769          

HSP 11 Score: 149.828 bits (377), Expect = 9.490e-36
Identity = 185/691 (26.77%), Postives = 312/691 (45.15%), Query Frame = 2
Query:  605 SKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRT---IHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-SPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTAS--KSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ----------DDHKLVISACDKGKPPKCSNPLWVTIKVV 2617
            + ++N+ + DINDN P++     + S  E      ++RT   + +  A D D   N+ I Y +   N        +   + ST    +++   ++DRE  D Y L+++A D G     + S  +++ I D NDN P F    Y  +  S      FV   V+  DAD  +N ++ Y +  +  SE F+I    G IM    +   +G     FSV   DG    + KT    V +   ++ D  P++           N+P       I+ S L             + +S  +++ +     Q+ P   +  I    +F++ +K +  V I  +D  +   S  + +   +LD NDN+P F    F   +LEN S   +    V A DKD+  N +++++I+ GN+E  F I+ ++G++ + + LDRE+   + +T+ + D G P ++ +  V I ++D ND  P FS  ++   +SEN+ +G +V  VT  D D+  N   +Y I+             +SLPF  I  + G+IV    L+RE    Y + V A D+G    +T +T V I + D+NDN P F   +  +   +  E +G  +  V A D D G N ++ Y I+  +   YF  N    ++    VL  Q          + H  +++A D+G P   S    VTI  V
Sbjct: 2347 TGTINIIVDDINDNVPTFANNMYLTSIAE------DARTGTDVLLVNASDADAAANAVISYSIIGGNS-------QFTINPSTG---QIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFV-FAVTVTDADIGSNSELHYSLSGRN-SEKFHIDPLRGAIMAAGPL---SGASEVTFSVHVKDGG--SFPKTDSTTVTVRFANKAD-FPKVRAKEQTFMFPENQPVGTLVTTITGSSLRG-----------ETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKIQKYV--VWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILT--VSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRFS-QIFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIV------------DTSLPF-TINPNTGDIVISRPLNREDTDRYRIRVSAHDSG----WTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPE-LGSRVTQVSATDPDEGSNGQVFYFIKSQSE--YFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSE-TTVTINTV 2976          

HSP 12 Score: 137.887 bits (346), Expect = 4.815e-32
Identity = 161/638 (25.24%), Postives = 283/638 (44.36%), Query Frame = 2
Query:  446 YRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFI----SPSYVSKSL-NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKD----QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVP-NMFVGEVMAVDKDAERN-SKIEFQI-IGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTK-MKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDN 2317
            Y + DGN L     +D +T  +++ + +  +      +N + ++R       +P   S+++ ++ + + N + P + Q     +  E        RT+    A D D   N  I Y +   N   + G++ I   +S++  + L   K +D E    +E+ + A D G   RTG   L + ++D NDN P+F   +++   + ENA  G   + ++A DAD  AN  I Y ++   +  +    N G I  +  +D++   + +  +V A +   EE  K     V I +   N+  P  +  +   +        +       + +  +   D D G    V   +  N + +  Q++      QI      DRE++    + +L K+    +  +    ++   +LD ND  P    +  +RV  +  VP    V  V A D D+  + S+  + I  GNE   F I+  +G++     LDRE    +N+T+LA D G P  TG+  + + + DIND  P  ++S  E  + EN   GT V T+ + D DLP N     Y ++S      +YF  S++          G + T   +DRE+ + + L+VV  D+G P   +ST TV I ++D NDN
Sbjct: 3023 YFVSDGNHL-GKFKLDNDTGWISIASSLVSD------LNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTV---SARDRDTAMNGLISYNIISGN---EEGIFAI---NSSTGVVTLA--KALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVM-ENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETK-QSYHLTVKAFNVPDEE--KCSFATVDIQLKGTNEYVPRFVSKLYYFE--------VSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQIN--KMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDAND--PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVS--EGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTG-PATNYFSLSTA----------GVLSTTREIDREQIADFYLSVVTRDSGAPQ-MSSTGTVHITVLDQNDN 3612          

HSP 13 Score: 87.0409 bits (214), Expect = 1.406e-16
Identity = 131/539 (24.30%), Postives = 226/539 (41.93%), Query Frame = 2
Query:  383 GTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSW-PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCS-----LSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERN-SKIEFQII--GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDIND 1963
            G+ +  ++   ++  ++   SY I  GN+      I+  T VVT+   +D E    +++        +++ +    SL V ++D+NDN+P + P +      T  E     +  IH++ A D D   N+ I Y ++     +D+ ++ I  +        +     +D E    Y L + A +    ++     + IQ+   N+  P F    YY  ++SE A+ G     V A D D  A+G++ Y I      + F I    G I V   +D +   +     VLA +          E  V I V+D ND  P +    T R         I   V   + +  +   D D     I S S     + + ++     ++P  +  QI   +  DRE   +  + +L  D      T S S+V  + D NDN P  T V    VLEN   P   V  + + D D   N     + ++  G   ++F + ++G + T + +DRE+   F ++++ +D G P  + TG V I V+D ND
Sbjct: 3107 GSVVRTVSARDRDTAMNGLISYNIISGNEE-GIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYC-SLTVSVIDVNDNSPVFVPDE---FFPTVMENAPSGTTVIHLN-ATDADSGANAVIAYTVQ----SSDSDLFVIDPNMGV-----ITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYF-EVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEER-VSLKVLAKNFGNIRGADIDEVTVNITVLDAND--PPVFSLSTYR-------VQISEGVPIGTHVTFVSAFDSD----SIPSWSRFSYFIGSGNENGAFSINP--QTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLT-VSEGEVLENKR-PGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSSTGTVHITVLDQND 3611          

HSP 14 Score: 70.4774 bits (171), Expect = 1.634e-11
Identity = 78/262 (29.77%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  338 SITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVST-SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYV-SKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNEN-SQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRA-----KYYANKLSENANIGFVALTVSAKDADYL 1099
            S++  ++QI E    GT +  ++ +  ++I S S  SY I  GN+      I+P+T  +TV + +DRESL     N  ++     +PS   S SL V + DINDN P        VS  E   NK     +   ++ DPD+  N    +Y+L      T+          ST+R         IDREQ+  + L ++  D+G+P+ + +  + I +LD+NDN P   R       YY N L     +G    +V  +D D L
Sbjct: 3407 SLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTSGLDRESL--PVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVL-----TVSEGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTRE--------IDREQIADFYLSVVTRDSGAPQMSSTGTVHITVLDQNDN-PSQSRTVEIFVNYYGN-LFPGGTLG----SVKPQDPDVL 3646          
BLAST of Protocadherin 1b vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 2.152e-74
Identity = 220/738 (29.81%), Postives = 357/738 (48.37%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI----IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSP----SDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRE L  C NQ+  D  +L F +S + + ++ +       +E+ DINDN P++   S V++    E   + S    I  A D D   N    Y L+   G     ++ ++  +    ++ +L+ +  +DRE+ D Y+L +  +D GSP R  S  L + +LD NDN P F+R  Y A +LSEN+ IG   + V A D+D  AN +I Y     +A E          N G I V+  +D +  +   +FSVLA D       K+   +VV+ V D ND  P I    I  VT +D + N    I  +V   + +A ++V D D G    V+C ++ +   +L Q S     S K++ +      D E+     ++I+  D      +++ S+  Q++D NDN+P FT+          + P   + E+ A D D+  N+++ + +      +  F I   +G++  K  LDRE+ E + + ++A D G P   GT  V + V+D ND  P+F LS Y FS+ EN    + VG VT ID D   N +++  +  D                 +I++  G I++    DRE+QS Y   + A+D G P   ++   V IN++D NDN P     + T   + T ++ +G  +  V A D D G N+E++Y I  GNPYG F   + +  + L   + ++    H+LV+   D+GKPP+    L
Sbjct:   99 LRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNF--ASPVITLAIPENTNIGS-LFPIPLASDRDAGPNGVASYELQ--AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEA-ELSENSPIGHSVIQVKANDSDQGANAEIEYTF--HQAPEVVRRLLRLDRNTGLITVQGPVDRE-DLSTLRFSVLAKDRGTNP--KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMAN----ISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDF-------------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVP-PRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTAL 807          
BLAST of Protocadherin 1b vs. UniProt/SwissProt
Match: sp|P33450|FAT_DROME (Cadherin-related tumor suppressor OS=Drosophila melanogaster OX=7227 GN=ft PE=1 SV=3)

HSP 1 Score: 236.113 bits (601), Expect = 1.354e-61
Identity = 212/726 (29.20%), Postives = 345/726 (47.52%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYD--SSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQK-------ASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG--GRDIVSCSLSNN-DKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQM-IRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSN------KTVFSIQTTESVGYE--IGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILN----SVLSKQDDHKLVISACDKGK 2572
            +DP T  V     +DRE +   + + D+++     P+Y  + + +++LD+NDN+P +P+ S  +SF+E   +      + +D A D DV EN   D + +   G  DN    +     S  +  + L     +DRE    Y+L + A D GSP R G L++ + ILD NDN PIFD + Y  + L+E A  G   +TV A D D   N KITY + + +        +   +     N   + N+   A  K   F+V A D G+P   R+ G   V + ++D ND  P I        P   + A ++   ++ +V+A + VKD D G  GR  V     N     RLE+ +    +  I+ +    DREE     + ++  DQ     T +  ++  + D ND+ P F +  +  VL   +    FV  + A D+D   N+++ + I+ GNE  +F +D  +G + T   LDRE  +   ++I A+DGG  PK     + + ++D ND  P+FS      ++ E+A   T V  +TA D D   N  + + +     S E  +      P Q  +    G++ T+  LDREK S Y ++V+A D G P   ++T TV +N+ DVNDN P F   +           I+  + V  E  +  V A D D G+N+ I Y++E G   G F  + ++  + L     + +  +  +KL++SA D G+
Sbjct:  105 LDPVTGEVKTNVVLDREGM---RDHYDLVV-LSSQPTYPIE-VRIKVLDVNDNSPEFPEPSIAISFSE---SATSGTRLLLDAATDADVGENGVTDQY-EIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVS-LNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSP---RQDGRTYVTVNLLDTNDHDPIISFRFF---PDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAA----DLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP---SVERLY------PLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE-GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQ 800          

HSP 2 Score: 194.512 bits (493), Expect = 1.559e-48
Identity = 215/761 (28.25%), Postives = 344/761 (45.20%), Query Frame = 2
Query:  476 NCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNV--EILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-------------------SPKR-----------------TGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITY-----RIEDQKASEYFNIGNN---GNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEK---SMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNM-FVGEVMAVDKDAE-RNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQ----NKKLILNSVLSKQDD--HKLVISACDKGK 2572
            +   ++P+T ++T+  R+D E +        +  +    PS +S ++ V   +LD+NDNAP +   S   S   FE   + +  + +  A D D   N  I+Y +   +  ++ G+     DS+ + R      + +DRE    Y L + A D                     SP++                 + ++++ I I D ND  P+F  A   A  + EN  I  V + V A D D   NG I Y     R ED   S+      N   G + V   +D +     +  ++ A D G P +   + E +++I ++DEND  P         DP     ++ EN  I   VL  +   D D G    +  S+   D+     +S      ++    N++R  +   ++   D   ++ A +TA  +I   ILD NDN P F    +  RV+EN   PN  +V  V A D D    NS++ + +   +   F+I+ SSG +   + LDRE+  ++ +T++A D G PP TGTG+V +EV DIND  P F L  Y  ++ EN   GT V T  A D+D   N K+++ ++ +   +   F          I  + GEI T   LDRE+ S Y LT++A D+       S+  + I++ DVNDN P F   + T +++   E +  G  +    A+DLD GEN+ + Y I  G    YF  NT+    + KL L +     DD  + +VISA D+G+
Sbjct: 1968 DVFSLNPQTGMLTLTARLDYEEV--QHYILIVQAQDNGQPS-LSTTITVYCNVLDLNDNAPIFDPMS--YSSEVFENVPIATEVVTV-SAKDIDSGNNGLIEYSITAGDVDSEFGI-----DSNGTIRTR----RNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA--IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDREL-RSSYLLNITARDRGEPPQ---STESQLLIRILDENDNSPVF-------DPKQYSASVAENASIGAMVL-QVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTI--NILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR---FH---------IDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKF---DSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-SGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGE 2681          

HSP 3 Score: 189.119 bits (479), Expect = 6.518e-47
Identity = 199/726 (27.41%), Postives = 333/726 (45.87%), Query Frame = 2
Query:  344 TCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSL-NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGV-WKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP-KRTGSLELIIQIL--DKNDNGPIF--DRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVL---AHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIA-NFDRE----EKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGN 2461
            +  ++ + E    GTE+        +  V+    + I  GN+  +  HID  T  + +   +D E +    +N  I      +PS  +  L NV ++D NDN P +P  + V    E  G  L++  + +  A DPD   N ++ Y +  +  +   G  + I  ++       +  ++ IDRE +D + L ++A D   P +R  S E ++ ++  D NDN P+F    A     K S +       + V AKDAD  +NG +TY I      E F +  N G I       +   V+ +Q ++ + D A +  R++ E  + I+       +  +     +R  L+   ++ ENE I  S+L   AH+   + ++     V+   +   + +++++   D +  IL+ A   DRE    E  +E   I    Q   + +K +   +LD+ND+ P+F    F + V E+  + +  +  + A D D      + F ++ G++  F    S+GK+     LDRE   K+ + I   DG    +      TI+V D ND  P F  ++Y F I ENA  G  VG + A D DL  N ++ Y ++SD ++ + +     SL  Q      G +     LD E+  HY+L V A DNG P S ++T TV  N++D+NDN P F   +   +S +  E+V    E+ TV A D+D G N  I Y I  G+
Sbjct: 1387 SSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRR-DTFHIDSITGSLYLHKPLDYEDITSYTLN--ITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKE--GIPLKTPIVTV-TADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGV-----IHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIV-SGPQELFKLQRNTGIITFTPGPQFKQEVR-YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSV-PQFEQRSKLSG--SVYENEPIGTSILTVTAHLASAEIEY----FVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTK-VRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHT-ISTLRAHDPDTL--GSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSD-WANDVF-----SLNPQT-----GMLTLTARLDYEEVQHYILIVQAQDNGQP-SLSTTITVYCNVLDLNDNAPIF---DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGD 2070          

HSP 4 Score: 174.481 bits (441), Expect = 1.943e-42
Identity = 183/641 (28.55%), Postives = 293/641 (45.71%), Query Frame = 2
Query:  602 VSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRN----GKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGE-CEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNS----VLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPN-MFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGG-DPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSH----YLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG 2458
            +S ++ V IL  D+ND  P +   ++       E   + +  I + KA D D   N  IDY +K+      G++D   + +          +L  +  +DRE    Y L + A D G P ++   +L+I+ILD+NDN P+FD  K Y+  ++ENA+IG + L VSA D D  ANG+I Y I     +  F+I  + G + V KN++Y+  +  +  +V A D A E     G+  E+ I ++D ND +P  +       P      ++EN V  N      +   +   P    +        ++D  R+   S       I  +   DRE++S   + ++  D      T +  +  ++ D NDN P F  + +H  V EN  +P+   V    A DKD   N+K+ F ++G   H F IDS +G++ T   LDREET  +++T++A+D     P+  +  +TI V D+ND  P+F  + Y  ++ E    G  V    A+D D   N  + Y  IS R   + YF          I    G + TK  L  + +SH    Y + + A+D G   S +S   + + I+   + FPTF     + F++      G  I  V A     G   +I Y I  G
Sbjct: 2147 LSSTVKVTILIKDVNDEVPVFISANETAIM---ENVAINTVVIAV-KAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDG-----QLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFD-PKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYER-LSRYSLTVRAEDCALEN--PAGDTAELTINILDINDNRPTFL-----DSPYLAR--VMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASS-----GDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVREN--LPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHY-TISGR--DQHYFD---------INTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGE-QSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGG 2746          

HSP 5 Score: 169.088 bits (427), Expect = 9.038e-41
Identity = 186/703 (26.46%), Postives = 304/703 (43.24%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-SPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKG-----FQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNN---DKMRLEQVSPSDKEFQILAIA--NFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDF-GENSEIVYQIEEGNPYGYFSFNTQNKKLILNS---------VLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPP 2650
            + VE+ DINDN P +  QS   +  E   N      +   +A D D   N+++ + L   +      + +   DS T    E+     +DRE+  VY L L+A+D+  +  R  S+ L I + D NDN P FD   Y    + E  + G       A D D   N  + Y I   +   YF+I N    +V   ++     K      +   + A+D   +      E  V++         PE+         + N    +  +V    ++  +    P  G    +  +++     D +R+      D    +L++     D E   + ++ I   D    +  +   I   + D NDN+P   + +++  VLE  S P + +  V A D+D+  N  + +++  + +  F+I  SG++YT+  LDREE   +   + A D G P  TGT  V + ++D ND  P+F+  L+  +++ENA IG+ V  VT+ D DL AN    Y      FS+    ++        I    G I     LDRE+Q  Y+L VVA D     ++ + T + I I D NDN P F+ S  +    +  +S+   +G + A D D  G NS I Y +++ +P   FS +    ++             V S ++ + L + A D GKPP  S  L V I +V  H    N PP
Sbjct: 2477 VRVEVQDINDNDPVFELQSYHATVRE---NLPSGTHVLTPRATDKDEGLNAKLRFNLLGEH------MHRFHIDSETG---EISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNV-AVPERISKGEFVFGARALDLDDGENAVVHYTISG-RDQHYFDI-NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-------RPPELFPTFAY---MANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRV------DPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQL-IAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT-RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASY-----SFSENPGEKF-------RIEPQSGNITVAGHLDREQQDEYILKVVASD----GAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIAL-VGQIIATDRDKQGPNSVISYSLQQPSP--MFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECL-VNINIVDAH----NNPP 3122          

HSP 6 Score: 165.622 bits (418), Expect = 1.220e-39
Identity = 202/744 (27.15%), Postives = 320/744 (43.01%), Query Frame = 2
Query:  488 IDPETHVVTVKN-----RIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSW---PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNE-NSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNND---------------KMRLEQVSPSDKEFQ-ILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVF--HFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN-EEHFFQID-SSGKMYTKQ-VLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGT----VEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSK--QDDHKLVISACDKGKPPKCSNPLWVTIK 2611
            I  +T VV V       R+ R SL     +C +      +P+  +  L + ILDINDN P++   P  ++V+  T    N     T++   A+D D    NSQ+ YFLK+     D+ +++I   S      ++  +K +DREQ   Y L L+A D GSP  TG+  + +++ D NDN P+F+   Y+A  + EN   G   LT  A D D   N K+ + +  +    +      G I     +D +     +  +++A D +  E R +    + I V D ND  P       K D  T   A+ E  +     +      D D G   +V  ++S  D               K+ L+  + S  +    + I+  D+ E+S+              +SK+ +  IL   +  P F  +   HF + E+   P   + +V A         KI + I G       ++D +SG +   Q  LD E T  + + I A DG  P      L+T+ V D ND  P     +Y   + E       +  V A DRD   N  + YR+ +D    +  F+ + S          GEI T+  LDRE+   Y   V A+D G P+  T T +V ++++D NDN P F      +FS+  TE+   EIG+    V + DLD G N+   Y   E NP   F    Q+  + +   L +  QD++ L + A D     +   P+ +TI+
Sbjct: 2328 ISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALE-----NPAGDTAELTINILDINDNRPTFLDSPYLARVMENT-VPPNGGYVLTVN---AYDADTPPLNSQVRYFLKE----GDSDLFRINASSG-----DIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHAT-VRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREE-TSVYHLTLMAQDSSITEPRAS-SVNLTISVSDVNDNIP-------KFDSTTYNVAVPE-RISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSL--------------SSKAELTVILRPPELFPTFAYMANSHFAMSEDVR-PGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDF---DGTFEITES----------GEIYTRMRLDREEIGDYAFVVEAVDQGVPH-MTGTASVLLHLLDKNDNPPKF----TRLFSLNVTENA--EIGSFVIRVTSSDLDLGANANASYSFSE-NPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAW--RAETPITITIQ 3004          

HSP 7 Score: 163.696 bits (413), Expect = 3.976e-39
Identity = 178/649 (27.43%), Postives = 279/649 (42.99%), Query Frame = 2
Query:  626 ILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVK--------GFQFSV--------------LAIDGAPEEYRKTGECEVVIMVIDENDEKPEII---VHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN---TASKSIVFQILDRNDNSPKFTRVF-HFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINII--DVNDNFPTFKTSNKTVFSIQTTESVGYEIGT--VEAVDLDFGENSEIVYQIEEG 2458
            I D+ND+ P +   S   S  E    K+ +R   +  A D D+ +N +I Y + + N +   GV+   Y         L     +DRE+ D Y L +   D G P R+  + ++I ++D+NDN P F  + +  + + ENA        ++A D D   N ++++ +  Q  ++ F I   NG I   +  D +A VK        G   S+              ++ +G P   R   + +V ++V D ND  PE +    HVT           I       + + H+  +D D G    V  SL+  ++    Q +      Q+      DRE + +  + ++ KD A     +++ SI   +LD NDN+P+FT+      VLE +      +    A D D   NS++ F I  GN    F IDS +G +Y  + LD E+   + + I A D G P  + T L  + VVD ND  P F  +     I E   + T + TVTA D D   N K+ Y I     +  +  +F          I  + G I T   +DRE    + LTVVA D   P+    +T   + +I  D+NDN P F + N  +   + + S G       V A D D   N  + Y+I  G
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPET--TKVNTRFFAL-AATDIDLGDNGRISYEIIEGNTERMFGVFPDGY---------LFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFS-IPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQ--TQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIP---RLQDKVKVKVIVTDVNDNAPEFLRAPYHVT-----------ISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEA--GQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELM-RFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFG---------INTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSG 1646          

HSP 8 Score: 162.54 bits (410), Expect = 9.301e-39
Identity = 188/722 (26.04%), Postives = 327/722 (45.29%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSY--VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGN-KLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQV----DVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII--GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGH-PNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDF-GENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSN 2590
              I+P++  +TV   +DRE         + +L+   S         + + I D NDNAP +       SF E + +  L  + I  D+        NS I Y L+  +            D +T        ++    + V    ++Y L ++A DNG P       + I I+D ++N P F++A+Y A  L ++A  G   + V A D   L   ++ Y +     S  F++G ++G I + K I      + ++  V A D G P +   + E  VVI+V  EN + P   V+       + +  + ENE + +++L  +   D D G   ++  S+S  ++   +  S  ++   I+     D +      ++I  +D  Y+  S   +  I+  D NDN P F  + +H  + EN  V   FV +  A DKD+ +N+ I +  +  G + HFF ++ S+G + +    D EE   + + I AK+     ++   L  + V+ +N++ P+F   ++ F +SE + +GT VG V A D+D   + ++ Y ++     K      ++ L + + RH          LDRE Q+  +LTV+A + G    + T    V I+I D ND  P F     T  +I     VG ++ TV+A+D D   +N++  Y I  GN    F  + Q  ++   S L +++   + LVI A D G PP+  +
Sbjct: 2959 FRIEPQSGNITVAGHLDREQ------QDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRD---KQGPNSVISYSLQQPS-------PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLA-PLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTR-YELVVRATDRGVPPQ---SDETRVVIVVTGENMDTPRFSVN-------SYQVIVPENEPVGSTILT-VGATDDDTGPNGMLRYSISGGNER--QDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPV-GTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLY-VHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIY-VARH----------LDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP-PEFIKHYYTS-TISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGS 3634          

HSP 9 Score: 156.762 bits (395), Expect = 5.670e-37
Identity = 196/744 (26.34%), Postives = 308/744 (41.40%), Query Frame = 2
Query:  473 LNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSS-TSRRIELMPIKVIDREQVDV-YELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANK---LSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMV--RKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHD--RGEIVTKYLLD-------REKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVD-LDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLS--KQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIP 2638
            ++  HID ET  ++    +DRE      +           P   S +L + + D+NDN P +   +  V+  E      +   +   +A D D  EN+ + Y +  R    D   + I   +   S ++EL   K   +   D+ Y +++ A D G    +   EL + IL   +  P F    Y AN    +SE+   G +   VSA        GKI Y I      +   +  N  ++   +  +DY+     ++  + A DG     R      + + V D ND  P +       + L     ++E E     ++A ++  D D G    V   L N+     E      +  +I      DREE       +   DQ   + T + S++  +LD+NDN PKFTR+F   V ENA +   FV  V + D D   N+   +    N    F+I+  SG +     LDRE+ +++ + ++A DG    +T    +TI + D ND  PEF  S Y FS  E       VG + A DR              D+    S   YS   P  M   D   GE+ +K  +        R  ++ Y LTV+A DNG P  Y S   V INI+D ++N P F+ + + +  +      G  I  V A D  D G N E+ Y +   N    FS    +  + L   +       ++LV+ A D+G PP+ S+   V I V  +++  P
Sbjct: 2535 MHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPE---RISKGEFVFGARALDLDDGENAVVHYTISGR----DQHYFDINTKTGVVSTKLEL---KTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTF---AYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYEL-THLYEIWIEAADGDTPSLRSV--TLITLNVTDANDNAPVM-------EQLIYNAEVLEEES-PPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEIT----ESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEI-GSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDR--------------DKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLY-SECLVNINIVDAHNNPPKFEQA-EYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQ-SDETRVVIVVTGENMDTP 3227          

HSP 10 Score: 154.836 bits (390), Expect = 2.261e-36
Identity = 189/761 (24.84%), Postives = 328/761 (43.10%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFT----------EFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKND-----------NGPIFDRAKYYANKLSENAN--IGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKT----GECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAII--ENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDR----EEKSMEKVDILCKDQAYNTASKSIVFQ--ILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDR--FSKESYFQYSSSL-PF------QMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSK--QDDHKLVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            +D  T  +T +  +DRE +   +I+     +   +P   + ++ + + D+NDN P +  +  + S            E E  ++    +H+  A D D  +N+ I+Y L+        G++++    + S  I L             Y+L++ A D G  +R    + I++I+ K+             G  F   + +  + +   N  +G V +    K  +  AN  I Y I     ++ F I   +G I   + +D +     ++ ++LA   +      +    G+C V I +ID ND  P   V    R+   +EP I   EN  +   +     V+D D G    +S SL+NN   +  ++ P      +  +    R    E  S+  V+++  D      S  +     I D ND++P F    +   L   +  N     + A D D   N +I ++II GN E  F +   G ++ +  LDREE + + +T+  +D G P ++    V I V+D ND  P+F+ S + FSI ENA   T VG +TA+DRD+  N ++ + + S    F+ ++   +  +L PF      ++ R+         L      ++ LL     DNG P        VK+ + DVNDN P F  +   V +I    S G  I  V   D D G N ++ Y + +GN  G F+ ++   +L L   L +  Q+ H L++ A D       S+   +TI V+ ++
Sbjct:  652 LDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERI---LLHV-TASDKDDGDNALIEYRLESGG----EGLFQLD---ARSGAISLRGDAPASMHWKPHYKLLVSARDAG--QRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQV----KSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQAN-YRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAP---VFALDRE---SEPTISLPENAAVGQEIYLS-RVRDRDAGVNSRISYSLTNNPNQQF-RIGP------VTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPR-LQDKVKVKVIVTDVNDNAPEFLRAPYHV-TISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDEN 1378          

HSP 11 Score: 152.14 bits (383), Expect = 1.474e-35
Identity = 200/767 (26.08%), Postives = 333/767 (43.42%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVS--KSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNG-----PIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS-------EYFNI-GNNGNIMVRKNIDYDAGVKGFQFSV--LAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAI--IENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEH-FFQIDSSGKMYTKQV-LDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNG-------------------HPNSYTST--------------TTVKINII--DVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG--------NPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCS 2587
            I+ ET V+     IDRES+   ++      R   S   +S  K + V + DINDNAP +   +  +   +F  +K  S  +    A D D + N  + Y +   +G  +  ++K++ ++     I   P     +E    Y+L L + D        S E+ I I+     G     P F++    +  + EN  IG   LTV+A    +LA+ +I Y + +  A+         F+I    G +     +D +AG + ++  V  +A+ G P    +T   +V + V+D+ND  P+ +          + P +  +  ++     ++ +   DPD  G         ++ K  LE   PS    +++     DRE KS  ++ I   D    T + + + Q+ D NDN P F   V+ F + ENA      VG+++A D D  +N+++ + ++ +  +  F ++    M T    LD EE + + + + A+D G P  + T  V   V+D+ND  P F    Y   + EN  I T V TV+A D D   N  ++Y I +     E  F   S+          G I T+  LDRE +S Y LTV A D                      P  Y  T              +TVK+ I+  DVND  P F ++N+T  +I    ++   +  V+AVD D G N  I Y ++E         +P   FS N  + +L +   L ++    + L I+A D+G+PP+ +
Sbjct: 1543 INTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIV--SGPQE--LFKLQRNTGI---ITFTPGPQFKQEVR--YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA----HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQP----RTSRTKVRVTVLDKNDSPPQFL----------DTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLE---PSTG--KLILNDTLDRETKSKYELRIRVSDGVQYTEAYATI-QVSDTNDNPPLFEDTVYSFDIPENAQR-GYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSE--FGIDSN----------GTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANET--AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLP-FSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQST 2260          

HSP 12 Score: 147.517 bits (371), Expect = 3.544e-34
Identity = 197/778 (25.32%), Postives = 338/778 (43.44%), Query Frame = 2
Query:  368 EEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNC-LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKS-LNVEILDINDNAPSWPQQ--SKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEY---FNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIV-HVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQI-----LDRNDNSPKFTRVFHFRVLENA-----SVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKT------GTGLVTIEVVDINDWKPEFSL---SLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQM-IRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF-KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNP---YGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCS 2587
            E   NGT +  +     ++ ++  TS RI  GN+L +  L    + H+V V   +DRE +   + N  ++     +P+  + + L +++ D+ND+ P + +   S V+S     G+ + S T     A D D   N+Q+ Y +   N        ++K+ S       ++    +DRE  D  EL + A D G   +    +L + ILD+ND  P F + +     L E+A    +   ++A D D   NG +T+ +       Y   F +    G +  R+ +D +  +  ++ SV+A D GAP     T    V + V D ND  P+    H        ++   ++ EV    +L H+   D D G   ++   L +  +  L Q+        +   A      K   K+ +  +D     + +  + +I     L+  +        + F+++E+      S PN  VG V     + + NS IE+ II G+    F+ID+ SG++ T + LDREE   + +TILA               G  +V I ++D+ND  P F+L   S    S+ ENA +G  +      DRD   N+++ Y + ++   +      +  L  Q  IR + G ++   L+             A D G     +S  ++ + I DVND+ P F  TS +T  S+  T  V      + A D+D G+N  I Y+I EGN    +G F     +  L + + L ++  D + L +S  D G+P + S
Sbjct:  398 ENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEI--GKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASIT-----ATDEDTGVNAQVHYDILSGN--------ELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVT-LGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREK-MSQYEISVIARDQGAPTPQSAT--ATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE-GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELM-------------ATDAGS-PPLSSKLSLSVLIADVNDHTPVFDHTSYET--SLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP----DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSS 1135          

HSP 13 Score: 141.354 bits (355), Expect = 2.759e-32
Identity = 176/710 (24.79%), Postives = 309/710 (43.52%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCD-----------IMLRFFISPSYVSKS-LNVEILDINDNAP-----SWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNN-DKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT---ASKSIVFQILDRNDNSPKF-TRVFHFRV--------LENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEK--FNVTILAKDGGDPPKTGTGLVTI------EVVDINDWKPEFSLSLYEFSISE------NAGIGTSVGTVTAIDRDLPANTKMKYRII-SDRFSKESYFQYSSSLPFQMIRHD--RGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTT-----VKINIIDVNDNFPTFKTSNKT--VFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQI 2449
            ++PET V++   R++    CP Q N             +  R   SP    ++ + V +LD ND+ P      +P   KV +  E   N +    +      D D   N +    +      + N +   + + +    I +    V+DRE++  Y L ++A D G+P RT +  LII + D ND+ P+F++++Y A  LSE A  G    +++A D D   N ++ Y I      ++F++    G I+    +D +      + S+ A DG P    K    ++ ++++DENDE P+     ++R+    +   +  +    +++A +   D D G    V+ +L+ + +++   Q +      Q+      DRE+ S  ++ ++ +DQ   T   A+ ++   + D NDN P+F  R + + +        L+        +  V A DKD   N+ IE+++    E  FQ+D+ SG +  +         K  + + + A+D G        +V I      E+++    +       YEF + E      N+     VG V     +  AN+ ++Y II  DR               Q  R D   G I T   LDRE+Q++Y LT++A  +   ++  S+ +     V I IID+NDN P F    ++    S+    +VG EI      D D G NS I Y +
Sbjct:  318 VNPETGVISTTERVN----CPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDE---NAVNGTVVAAVAVKDSDSGLNGRTSVRIV-----SGNELGHFRLEEAADLHI-VRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSA-VLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREI-RDTVELSISARDGGPNP--KFAYTQLKVIILDENDEAPQF----SQRE----QNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQ----AGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDR--------------AQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSL 984          

HSP 14 Score: 140.584 bits (353), Expect = 5.479e-32
Identity = 174/696 (25.00%), Postives = 302/696 (43.39%), Query Frame = 2
Query:  590 SPSYVSKSL-NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE-FQILAI----ANFDREEKSMEKVDILCKDQAYNTA-SKSIV-FQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNG-HPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNE 2644
            +PS  S +L  + + D NDNAP   Q   ++   E    +   + I + KA D D  +N  + Y L++      +G ++I        R+ L      DRE++  Y  ++ A D G P  TG+  +++ +LDKNDN P F R   ++  ++ENA IG   + V++ D D  AN   +Y   +    ++     +GNI V  ++D +   + +   V+A DGA   +R   E  + I + D+ND  PE            + P + ++  +   ++A    K    G   ++S SL     M    + P+  E F   A+    + + R  ++M  + +L  D       S+ +V   I+D ++N PKF +  +   L   +V    +  V A DK     +++++ ++  N    F +    G +   + +      ++ + + A D G PP++    V I V   N   P FS++ Y+  + EN  +G+++ TV A D D   N  ++Y  IS    ++ +           +    G IV +  LD +    Y L +   D G HP   +S   + I + DVNDN P F       + I   + VG  +    A D D  +N+ I Y      P  +F    Q+   I +S +S   + + + +   K K P  S   +  + V   H+L  NE
Sbjct: 2787 TPSLRSVTLITLNVTDANDNAPVMEQ---LIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDF----DGTFEITESGEIYTRMRL------DREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR--LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDE-YILKVVASDGA---WR--AETPITITIQDQNDNAPEFEHSFYS----FSFPELQQSIALVGQIIATDRDKQ---GPNSVISYSLQQPSPMF--SIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYS-ISGGNERQDF----------SVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHP--LSSVAMLTIILTDVNDNPPVFNHKEYHCY-IPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTI-SSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYV---HVLGVNE 3434          

HSP 15 Score: 133.65 bits (335), Expect = 6.598e-30
Identity = 169/632 (26.74%), Postives = 278/632 (43.99%), Query Frame = 2
Query:  875 VIDREQV-DVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKI-TYRIEDQKASEYFNI-------GNNGNIMVRKNIDYDAGVKG-FQFSVLAIDG-APEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTAS-KSIVFQILDRNDNSPK----------------FTRVFHFR----------VLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMY---TKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF--KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGY---FSFNTQNKKLILNSVL--SKQDDHKLVISACDKGKP-PKCSNP-LWVTIKVV 2617
            V+DRE + D Y+L+++     S + T  +E+ I++LD NDN P F      A   SE+A  G   L  +A DAD   NG    Y I        F +       G+   + +    + D   +G +Q ++ A DG +P  +   G  +V + ++D ND  P I  H      L NE A+    V++      +   D D G    ++  L+  +      V+P   E  +++         + E+V+   +    ++AS KS VF +  R+  SP+                   +  FR          V ENA V    V  V   D D+  N +   +I+ GNE   F+++ +  ++      VLDREE  K+N+T++A D G P +T T  + I+V D+ND +P F  S Y   +SE A  G+ V ++TA D D   N ++ Y I+S      +  ++ S  P        G IVT   LDRE +    L++ A D G PN   + T +K+ I+D ND  P F  +  N T+      +++   +  + A D D G N  + + +       Y   F+ +    +L     L   K   +++ + A D+G P P+ +   +W+ +  V
Sbjct:  117 VLDREGMRDHYDLVVL-----SSQPTYPIEVRIKVLDVNDNSPEFPEPSI-AISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRF---GYLQVNVTILDVNDNPP-IFDHSDYNVSL-NETALPGTPVVT------VMASDNDLGDNSKITYYLAETEHQF--TVNP---ETGVIS---------TTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENA-VNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSG-----NELKWFSMDPLT------GLIVTTGPLDREIRDTVELSISARDGG-PNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTI---VALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADV 701          

HSP 16 Score: 129.413 bits (324), Expect = 1.352e-28
Identity = 147/554 (26.53%), Postives = 238/554 (42.96%), Query Frame = 2
Query:  719 TIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN--NGNIMVRKNIDYDAG-VKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG--GRDIVSCSLSNNDK-MRLEQVSPSDKEFQILAIA-NFDREEKSMEKVDILCKD----QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAE-RNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTK-MKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKT 2335
            TI    A D D   N  + Y +   N + D  V +        R   ++  + +D + +  Y L +  +D G    +    L I + D NDN P+F+  +Y+   + EN  +G       A D D   N  I Y         +F I N  NG I    + DY+   +   Q      D + E Y       + + V+  N+  P+ +  V   D       + E   +   V A ++  D D G  GR       S+NDK  R+      D    ++ +A + DRE ++   + ++ K+    +  +T    ++  I D ND  P+F + ++   +  A+     V  V A+DKD   +N++  + II GN +  F+ID  +G++ T   LDREET  +N+ I A D G PP+TG+  V IE+ D+ND  P F+       ISEN   GTS+ T+ A D DLP N     Y++I  +              +  +  + G + +    DRE        +   D+G P    S   + I ++D NDN  T ++
Sbjct: 3247 TILTVGATDDDTGPNGMLRYSISGGNERQDFSVDE--------RTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHC-YIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESY-----ANLYVHVLGVNEFYPQFLQPVFHFD-------VSETSAVGTRVGA-VQATDKDSGEDGRVYYLLVGSSNDKGFRI------DTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKS-----------WLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQ-KSQHLLTITVLDQNDNPSTTRS 3759          

HSP 17 Score: 119.013 bits (297), Expect = 2.150e-25
Identity = 174/690 (25.22%), Postives = 302/690 (43.77%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSW-PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDY--FLKDRNG----KTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTG-SLELIIQILDKNDNGPIFDRAKYYANKLSENA---NIGFVALTVSAKDADYLA-NGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN---TASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-----SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFS-LSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTT--ESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPY-GYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKP 2575
            P      L + ILD NDN+P + P+Q    S +  E   + +  + +  A D D   N +I Y   L D+N       D GV ++               K ++ E++  Y L + AED       G + EL I ILD NDN P F  + Y A ++ EN    N G+V LTV+A DAD    N ++ Y +++   S+ F I  ++G+I + K +D +   + +  +++A+D        TG   V +  I++ND   E+   H T R+ L +   ++                D D G    +  +L      R    S +    +I      DREE S+  + ++ +D +      +S ++   + D NDN PKF +  ++  V E  S    FV    A+D D   N+ + + I G ++H+F I++     S K+  K      +   + + I A D G+   +    +T+ ++   +  P F+ ++   F++SE+   G  +  V+A         K++Y I             +S L            V +  LD E    Y + + A D   P S  S T + +N+ D NDN P  +   + +++ +    ES    I  V+A D D G+N  ++Y+++  N + G F   T++ ++     L +++  D+  V+ A D+G P
Sbjct: 2257 PQSTESQLLIRILDENDNSPVFDPKQ---YSASVAENASIGAMVLQV-SATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVA--------------KNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLA-RVMENTVPPNGGYV-LTVNAYDADTPPLNSQVRYFLKEGD-SDLFRINASSGDIALLKPLDREQQSE-YTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTP-----------RATDKDEGLNAKLRFNLLGEHMHRFHIDSETG---EISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERIS-KGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGL----------LSVGQDGLDYELTHLYEIWIEAADGDTP-SLRSVTLITLNVTDANDNAPVME---QLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQ--NDFDGTFEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGVP 2891          

HSP 18 Score: 98.5969 bits (244), Expect = 2.855e-19
Identity = 98/364 (26.92%), Postives = 162/364 (44.51%), Query Frame = 2
Query: 1625 IVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKI-EFQII-GNEEHFFQIDSSG---------KMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHY---------LLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPT----FKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLI--LNSVLSKQD--DHKLVISACDKGKPPKCSNP-LWVTIKVVKQH 2626
            +  ++LD NDNSP+F          E+A+     + +  A D D   N    +++I+ GN ++ F++ ++           + T   LDRE    + + I A+DGG PP+ G   V + ++D+ND  P F  S Y  S++E A  GT V TV A D DL  N+K+ Y      +  E+  Q++       +  + G I T   ++  +Q++          + TV A D+G P      T V +N++D ND+ P     F      V ++      G  +  V   D D G N     +I  GN  G+F         I  +N VL +++   + L + A D+G P + +   L + +  V  H
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDA-ATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITY------YLAETEHQFT-------VNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQ-DGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDH 490          

HSP 19 Score: 56.9954 bits (136), Expect = 1.608e-6
Identity = 54/198 (27.27%), Postives = 86/198 (43.43%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKL 1036
            SY I +GN L     ID +T  ++  +R+DRE      +     +   + P   S ++++E+ D+NDN P++  +      +E   N+    +I    A DPD+  N     F     G        +  +S   R          DRE   + E I+  ED+G PK+     L I +LD+NDN P   R+ + A  L
Sbjct: 3582 SYSIINGN-LKQSFKIDVQTGEISTASRLDREETSTYNLVIG-AIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISE---NEPAGTSIMTLIASDPDLPRNG--GPFTYQLIGGKHKSWLSVDRNSGVVRS-----TTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN-PSTTRSLHIAVSL 3766          
BLAST of Protocadherin 1b vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 231.491 bits (589), Expect = 1.268e-60
Identity = 212/722 (29.36%), Postives = 335/722 (46.40%), Query Frame = 2
Query:  506 VVTVKNRIDRESLCPN-----QINCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA---SEYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-----------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRII--SDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF--KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
            + T  NRIDRE LC       +  C   L   I P+   + + ++I+  D NDNAP +P  S V++ +  E   + SR   I  A DPD   N    Y L   NG++  G+  I       +  +L+  + +DREQ D Y + +  ED G+P+++ +  L + + D NDN P+F   +   + + ENA +G   + + A DAD  +N +I Y    Q A      F + N  G I V++++D +      + +VLA DG+    R T    V I V D ND  P I            V+++++DP+  + A+I            +  KD D  G+  V C +       L+ V   D ++ +   +  D E        I+  D    + +++ + ++   D NDN P F + V    V EN     +++  + A D+D+ +N+ I +Q+ G    FF +D  +G +   +V DREE E+F  T+ A+D G PP      V + V+D ND  P+F+ + ++F +SEN    ++VG +T  D D   N  +   I+  +D F  + Y                G I +    DRE+QS Y   V A D G P   +ST  V IN++DVNDN P      SN +   +  +   G  +  V AVD+D G N+E+ Y I  GN  G F  +     + L    +  D   H+LV++  D G P
Sbjct:   85 IFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSR-FPIPSATDPDTGFNGVQHYEL--LNGQSVFGL-DIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH-IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAI-HKVTVLASDGSSTPARAT----VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALIT-----------VSDKDTDVNGK--VICFIEREVPFHLKAVY--DNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRR-GLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPY---------------SGVIKSNVSFDREQQSSYTFDVKATDGGQP-PRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin 1b vs. UniProt/SwissProt
Match: sp|Q2PZL6|FAT4_MOUSE (Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2)

HSP 1 Score: 232.646 bits (592), Expect = 1.688e-60
Identity = 213/753 (28.29%), Postives = 350/753 (46.48%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYD-----SSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPD--FGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKD----------QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQV---LDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSL-SLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHD--RGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPLWVTIKVV 2617
            +YR+ + + L     I+  T  +     IDRESL  + +N  ++     SP+Y ++ + V + D+NDNAP +P  S VV+F E  G+    R + +D A D D+  N    +  +  +G   N   + + D     S     + L+    +DRE    Y+L++  ED G PKR G L++ + + D NDN P+F  + Y A  + E+A +G   L V+A DAD   N  I YR++D+  + +      G I VR+ +D++A  + +  +V A D G P     TG  E  I ++D ND  P +     +  P T+  A ++      +V+A + V D D      +I    L  N++   E          ++ +A+  DRE      + +   D          QA ++ +  ++F + D ND+ P F +  +   L     P  +V  V A D D+  N+ + + I+ GN   +F I     + T      LDRE   +  + I A+D G  PK     + + V+D+ND KP FS    YE S+ ENA  GT +  + A DRDL  N  +++ +      +            ++ R D   G + T   LDRE+Q+ Y L+++A D G P   +ST  V ++++D+NDN P F    +    IQ  E  G  + TV A D D G N  + Y I  G+    F  + ++  +     L +++   ++L + A D G   +  N   VT+ V+
Sbjct:   71 TYRLSESHALF---AINSSTGALYTTATIDRESLPSDVVNLVVLSS---SPTYPTE-VRVLVRDLNDNAPVFPDPSIVVTFKEDSGS---GRQVILDTATDSDIGSNGVDHHSYRIVSG---NEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAG-VPEDAVVGSSVLQVAAADADEGTNADIRYRLQDE-GTPFQMDPETGLITVREPLDFEA-RRQYSLTVQATDRGVPS---LTGRAEAFIQLLDVNDNDPVVKF---RYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIF-VNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQ------------RLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSP-PQSSTAQVNVSLLDINDNSPVFYPV-QYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGD-RSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGN-LQSPNQAIVTVTVL 784          

HSP 2 Score: 213.001 bits (541), Expect = 2.833e-54
Identity = 202/736 (27.45%), Postives = 336/736 (45.65%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPS-----WPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKV---IDREQVDVYELILIAEDN-GSP------KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFS---VLAIDGAPEE-YRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL--SNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKL-ILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKV 2614
              +DPET ++TV+  +D E+     +      R   S +  +++  +++LD+NDN P      +P  S+  S  E          + +  A  P  N N  +             G  +  ++   S+   L  IKV   +DRE++  Y L +   DN G+P       R+    L+I + D ND+ P+F++  Y  N LSE    G     VSA D D   N  + Y I       +F+I  +  ++        AG    + +   VL I    +  + K    ++V+ V+D NDEKP          P   E +++EN      +L  +   D D G    V  SL  + ND+ RL ++ P          ++ DREE++   + IL  D      +++  +   +LD NDNSP F  V +F  ++       +V  V A D D   N  +++ I   +   FQI + SG + TK  LDREE   + + ++A DGG+       +VT+ V+D  D  P FS + Y F + EN  +G  VG+V+A   DL AN  + Y I +    +   F  +            G++ T  ++DRE+QS Y L +VA       + T  T V I + D+NDN P F  + +++ +++  ++ G+ I   +AVD D G N  ++Y +++ NP   F+ N QN  + +L ++      +++ I A D G  P+ S+ + +T+ V
Sbjct:  296 FQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAF-IQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQIL---------GGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVN-LSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSA----AGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVF------SQPEGYEVSVVENAPTGTELLV-LGATDRDLGDNGTVRFSLQEAENDQ-RLFRLDPVSGRLS--TASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGDRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLNAN--ISYLITTG--DQRGMFAMNPV---------TGQLTTASVIDREEQSFYQLKIVA----SGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAVENWQA-GHSIFQAKAVDPDEGVNGRVLYSLKQ-NPKNLFTINEQNGNISLLGALDVHAGSYQVEIVASDMGV-PQLSSSILLTVYV 986          

HSP 3 Score: 187.193 bits (474), Expect = 2.611e-46
Identity = 198/761 (26.02%), Postives = 330/761 (43.36%), Query Frame = 2
Query:  353 KIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRES---LCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPS-WPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSST-SRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREK------QSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVG--YEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPP 2578
            ++ + E    GTE+ VL    ++   + +  + + +         +DP +  ++  + +DRE     C + +  D+       P   +  +NV +LDINDN+P  +P Q     F   + N+     +    A DPD+  N  + Y +       D   ++I   S   S ++ L      DRE+   Y+L ++A D G+ +      + + +LD  DN P+F +A Y +  + EN  +G+   +VSA   D  AN  I+Y I        F +    G +     ID +     +Q  ++A  GA      TG+  V I V D ND  P  +  V   +        +EN    +S+    +  DPD G    V  SL  N K      + +++   I  +   D    S + V+I+  D      S SI+  +   D NDN P F ++ +   L  +   N    +V A DKD+  N +I + I  GN    F I   G++Y K  LDRE  +++ + ++A D    P + T  VT+ + D+ND +P F+ + Y F   E    G+ VG V+A+D+D   N +++Y              +  + P   +    GEI + +  DRE        + +  TV A+D G P       TV + + D+NDN P F    K  +    +E+     ++  V A D+D G N  I Y I +GN    F+ ++ + ++ L   L  +    + L+I A D G  P
Sbjct:  589 EVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLG----SPPQSSTAQVNVSLLDINDNSPVFYPVQY----FAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSIS----AGDRSRFQIHAKSGVISTKMAL------DREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAY-SFVVFENVALGYHVGSVSATTMDLNAN--ISYLITTGDQRGMFAMNPVTGQLTTASVIDREE-QSFYQLKIVASGGA-----VTGDTVVNITVKDLNDNAPHFLQAVESIN-------AVENWQAGHSIF-QAKAVDPDEGVNGRVLYSLKQNPKNLF---TINEQNGNISLLGALDVHAGSYQ-VEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRY-------------AFEVTQPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFL---KDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIP 1294          

HSP 4 Score: 187.193 bits (474), Expect = 2.796e-46
Identity = 197/674 (29.23%), Postives = 301/674 (44.66%), Query Frame = 2
Query:  626 ILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV------SPSDKEFQILAIA-------NFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPK 2581
            ILD+NDN P +   S   S  E   N     T+ +    D D   NSQ+ Y +      + + + +   D    +   L  +K +DRE    Y L++   D   P   + T + ++ I +LD NDN P+F   K     + EN  I  V     A D D   N  I Y + +   ++ F+IG  +G + +   +D +  V  +  +V+A D G P     T   EVV+MV+D ND  P                       +    +  +++K+    G DI+  S ++ND+    QV        + +EF+I ++        + DRE      + +   D+  +  T S ++   +LD ND  P F    +   V EN       + +V+A D D   NS++ + ++G NE++ F + +SG++   Q LDRE  + F + + A D G P  TGTG + I V DIND  P F+ ++Y  SI+E+A  GT V  V A D D  AN  + Y II       S F          I    G+I+T  LLDRE + +Y L VVA D G P S +S+T+V + I DVNDN P F+  +  V  I +    G  +  V   D D G NSE+ Y +  G     F  +     ++    LS   +    +   D G  PK
Sbjct: 1934 ILDVNDNPPVFSMSSYSTSLME---NLPLGSTVLVFNVTDADDGVNSQLSYSIA-----SGDSLGQFAVD----KHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKL--TYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNK-FSIGTIDGEVHLTGELDREE-VSNYSLTVVATDKGQPPLSSST---EVVVMVLDINDNNP-----------------------VFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVVTAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSII----GGNSQF---------TINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQ-HHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSL-SGRNSEKFHIDPLRGAIMAAGPLSGASEVTFSVHVKDGGSFPK 2550          

HSP 5 Score: 185.652 bits (470), Expect = 6.977e-46
Identity = 192/710 (27.04%), Postives = 326/710 (45.92%), Query Frame = 2
Query:  353 KIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVS-KSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL-SNNDKMRLEQVSPSDKEFQILA---IANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFTRVFHFR-VLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIE 2452
            K Q F  P+N     ++T    +++   + SY I  GN L +   IDP T  V++   +D E +   +    I  R    P + S + L++ +LDINDNAP++ +   V    E     L  R I    A D D   N Q+DY + + N ++    + I + +      E+  I+ +DRE++  YEL + + D GSP ++ S+++II ILD+NDN P F  ++ ++  +SEN+ +G+    V+  D D   N    Y I D       N  N G+I++ + ++ +   + ++  V A D        T   +V I V D ND  P      ++     + P + E      S +  +   DPD G    V   + S ++  R+   +      Q+L    ++ F     +     +   D+   +  +  ++    +D NDN P+F +  +F  V +N  V    +      DKD   NS++E+ +  GN    F++D+ +G +     L  +  + F + + AKD G+PP +   +V I V + N   PEFS +    +I E+  IG+ V TV+A DRD   N  + Y IIS   ++E  F  +SS          G +     LD E  S + +T+ A D G   + T   ++ +++IDVNDN P F   ++   ++      G  +  + A D D G N+ I Y ++
Sbjct: 2572 KEQTFMFPENQPVGTLVTTITGSSLRGETLSYYIASGN-LGDTFQIDPLTGQVSISQPLDFEKI--QKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILE----NLSPRKILTVSATDKDSGPNGQLDYEIVNGNQESS---FTINHATG-----EIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRF--SQIFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTIN-PNTGDIVISRPLNREDTDR-YRIRVSAHDSG-----WTVSTDVTIFVTDINDNTPRF----SRPSYYLDCPELPE----LGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISG--NEEGIFAINSS---------TGVVTLAKALDYEMSSKHEMTISATDGGW-VARTGYCSLTVSVIDVNDNSPVF-VPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQ 3236          

HSP 6 Score: 182.956 bits (463), Expect = 5.062e-45
Identity = 187/668 (27.99%), Postives = 295/668 (44.16%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE-DQKASEYFNIGNNGNIMVRKNIDYDA-----GVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY----NTASKSIVFQILDRNDNSPKFTRVFHF-RVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEH-FFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHP--NSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKG 2569
            L V + D+NDN P + Q S  V+ +E E   + SR   + +A D D   N +I Y + D N     G++    D     + EL      DRE  D Y L+++A D      + ++ + + + D NDN P+F+   Y      E    G     VSA D D+  NG++ Y  E  Q   E   +   G I      D ++     G   F F+V A+D G P+  +   +  V + + D ND  P+ +    +        A +     + + +  +   D D G   ++  S+   ++ R  Q +      Q+  +   D E  S   + I   D       +T + SI   ILD NDN+P F +   F  VLEN  +  + V  V A D D+  N+ + + I G+  H  F I  ++G ++  + LD E    + + I AKD G PP++ T  V I+V D ND  P F       SI EN  +GTSV +VTA D D   N ++ Y II  +  + ++F          I   +G I T   +DRE  + + LTV A D   P      +   V I + D+NDN P F + N    +   +  +G  + T+ A D D G N E+ Y+I  G+   +          + ++++  Q  + L++SA D G
Sbjct:  982 LTVYVHDVNDNPPVFDQISYEVTLSESE--PVNSRFFKV-QASDKDSGANGEIAYTITDGNNGDAFGIFP---DGQLYIKSEL------DRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNY-TFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAV--TGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKD--QATVHVYMKDINDNAPKFLKDFYQ--------ATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEER--QFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSI--DILDENDNTPSFPKSTLFVDVLENMRIGEL-VSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAII-QQMPRGNHFS---------IDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQN--ALAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLIYNLIVSATDLG 1607          

HSP 7 Score: 169.859 bits (429), Expect = 4.912e-41
Identity = 193/693 (27.85%), Postives = 311/693 (44.88%), Query Frame = 2
Query:  602 VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYE--------LILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSA-KDADYLANGKITYRIEDQKASEYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIV-HVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSS-GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGH-PNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLD-FGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKC-SNPLWVTIK 2611
            VS  + + + DINDN P + + S  +   E    +L SR   +  A DPD   N Q+ YF+K ++          +Y    +   E+   +V+  + V  +          I+ A D G+P       + I  +D NDN P F + KY+   +++N  +G   + V+A  D D+  N ++ Y + D      F + N+ G I +  ++  D   + F   V A D G P     + +  V I V +EN   PE    H++   P        E+  I  SV+  +  +D D     ++S ++ + ++  +  ++ S      LA A  D E  S  ++ I   D  +   T   S+   ++D NDNSP F    F   V+ENA      +  + A D D+  N+ I + +  ++   F ID + G + T+  LD E  + +++T+ A +  D  K     V I++   N++ P F   LY F +SE A  GT+VG V A DRD+ A+ ++ Y I  +  S++  FQ         I    G+I    LLDREK+    L V+A + G+   +     TV I ++D ND  P F  S    + +Q +E V  G  +  V A D D     S   Y I  GN  G FS N Q  ++ + S L ++    + L + A D G P    S  L VT++
Sbjct: 2856 VSTDVTIFVTDINDNTPRFSRPSYYLDCPELP--ELGSRVTQV-SATDPDEGSNGQVFYFIKSQS----------EYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFT-PVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLN-QNFLIRVTAKDKGNPP---LSSQAVVHITVTEENYHTPEFSQNHISATIP--------ESHSI-GSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAIN-SSTGVVTLAKA-LDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVI-HLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGN--SRKKGFQ---------INKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDP-PVFSLS---TYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLE 3503          

HSP 8 Score: 162.925 bits (411), Expect = 7.739e-39
Identity = 197/758 (25.99%), Postives = 317/758 (41.82%), Query Frame = 2
Query:  356 IQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDN-GVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSP---KRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRD------IVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKS-MEKVDILC--KDQAY-NTASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSV-LSKQDDHKLVISACDKGKPP 2578
            + + E  + G  +  +T    ++ V+    Y I   N       I P T  + +  ++D E+    ++N     +    P   + S+ +++ D NDN PS+P      S  E     L +  I +  A DPD + N Q+ Y +  +  + ++  + ++K    TS  I        DRE  +++EL + A D   P   +R     + I + D NDN P+F      A   S  A IG V  T+ A D D  ANG++ Y I +     +     +G++ V   +     +  +   V A D  PE  + T E  V++  +D        +   TK   +  E   I   VIS      IE   P   G +      IVS         RL  +       Q  AI   DRE+ + +  VD+    K  A+  T    +   + D NDN P F T      V EN    +  + ++ A+D D   N+ + + +I   +  F+ID  SG +   + LDRE   K+++ + A DG    ++    + I + D+ND  P FS  +Y F I E+   G+ V  + A D D   N ++ Y +  D      +    + + F + R           LD E Q +Y+LTV A D G     ++T     NI+DVNDN P F  S+ +  S+     +G  +      D D G NS++ Y I  G+  G F+ +       L ++    Q  + LVI   D  +PP
Sbjct: 1322 VDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNH-GTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGR-PPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVE--NIPLGTSVISV-TAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEI--------DREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPS--AMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLI--YNLIVSATDLGPERRKSTTELTVILQGLDGP------VFTQTKYITILKEGEPIGTNVIS------IEAASPR--GSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAI--LDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIM-QLTAMDADEGANALVTYALISGADDSFRIDPESGDLIATKRLDREHRSKYSLLVRADDG---LQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGV-FNLTR----------ALDYETQQYYILTVRAEDGG---GQSTTIRAYFNILDVNDNPPVFSMSSYST-SLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDKHGVLKTLKALDRESQSFYNLVIQVHDLPQPP 2027          

HSP 9 Score: 162.54 bits (410), Expect = 9.410e-39
Identity = 196/730 (26.85%), Postives = 320/730 (43.84%), Query Frame = 2
Query:  446 YRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA-SEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGA-PEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDI----LCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSK--IEFQIIG--NEE----HFFQID-SSGKMYTKQVLDREETE-KFNVTILAKDGGDP-PKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVL--SKQDDHKLVISACDKG 2569
            Y I  GN+      ID  +  VT+  ++D E+     +    +    I P   + +L+++ILD NDN PS+P+ +  V   E   N      +    A D D   N+ + Y +    G  ++G + I  ++ +     +   K +D E   +Y+L + A+D G P R+ ++ ++IQ+ D NDN P F     +   + EN  +G   ++V+A D D   NG+++Y I  Q     +F+I    G I     ID +     F+ +V A D A P E R+     V I+V D ND  P  I     ++ L  +P+      +  SVL  I   DPD G    V   + N D          D+    L +A+     + +  + +    L  ++  +T   +++ Q LD     P FT+  +  +L+           V++++  + R S+  +E+ I+    EE      F I   +G + T  +LDRE+    + V + A +     P+T    V I + DIND  P F     + ++ EN G G+ +  +TA+D D  AN  + Y +IS   + +S+           I  + G+++    LDRE +S Y L V A D       +S   + I I DVND+ P F   ++ V+S    E    G  +  + A D D G N EI Y +EE +  G F  N       L   L    Q  + L + A D G
Sbjct: 1247 YSILKGNEERQ-FAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAI-PLNSTCTLSIDILDENDNTPSFPKSTLFVDVLE---NMRIGELVSSVTATDSDSGVNADLHYTI---TGSNNHGTFSISPNTGS-----IFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIF-KSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREF-ANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFI----SQNALAADPS-----AMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFT----VDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTVILQGLD----GPVFTQTKYITILKEGEPIGT---NVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISG--ADDSF----------RIDPESGDLIATKRLDREHRSKYSLLVRADDGLQ----SSDMRINITISDVNDHTPRF---SRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGG 1922          

HSP 10 Score: 152.91 bits (385), Expect = 8.102e-36
Identity = 189/690 (27.39%), Postives = 296/690 (42.90%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEII--VHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA---YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSL--PFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVG-YEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            P   S  + V +LDINDN P + Q    V   E   N L    I    A D D   N Q+ Y +   N        + + DS T     +   K +DRE    Y L + A D GS  RT S  + I +LD ND  P+F+ + Y  N       +    L V A+D D   N +++Y +        F +  +G + V +++D +A    F   V A D G+P     TG   + I+V D ND  P     +++T         +I E+      VL  +   D D     ++S S+   +     Q + +    QI+  A  DRE K    + ++  D       ++S S++  I D NDN P+F    +   + + + P  FV  V   D D   NS++ + + G     F ID   G +     L       F+V +  KDGG  PKT +  VT+   +  D+ P+       F   EN  +GT V T+T                 S R    SY+  S +L   FQ I    G++     LD EK   Y++ + A D G P  ++S   + I ++D+NDN PTF+   +  F  +  E++   +I TV A D D G N ++ Y+I  GN    F+ N    ++     L ++    ++L + + DKG P + S  + V I ++ ++
Sbjct: 2133 PLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKE---NILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTH-----QEFRIDSVTG---AITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREA-RDHFVLVVTAADAGSPA---LTGTGTINIIVDDINDNVPTFANNMYLT---------SIAEDARTGTDVLL-VNASDADAAANAVISYSIIGGNS----QFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLSGASEVTFSVHV--KDGGSFPKTDSTTVTVRFANKADF-PKVRAKEQTFMFPENQPVGTLVTTITG---------------SSLRGETLSYYIASGNLGDTFQ-IDPLTGQVSISQPLDFEKIQKYVVWIEARDGGFP-PFSSYEKLDITVLDINDNAPTFE---EDPFVSEILENLSPRKILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQ-STSVKVIISILDEN 2769          

HSP 11 Score: 149.828 bits (377), Expect = 6.638e-35
Identity = 185/691 (26.77%), Postives = 312/691 (45.15%), Query Frame = 2
Query:  605 SKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRT---IHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-SPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTAS--KSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ----------DDHKLVISACDKGKPPKCSNPLWVTIKVV 2617
            + ++N+ + DINDN P++     + S  E      ++RT   + +  A D D   N+ I Y +   N        +   + ST    +++   ++DRE  D Y L+++A D G     + S  +++ I D NDN P F    Y  +  S      FV   V+  DAD  +N ++ Y +  +  SE F+I    G IM    +   +G     FSV   DG    + KT    V +   ++ D  P++           N+P       I+ S L             + +S  +++ +     Q+ P   +  I    +F++ +K +  V I  +D  +   S  + +   +LD NDN+P F    F   +LEN S   +    V A DKD+  N +++++I+ GN+E  F I+ ++G++ + + LDRE+   + +T+ + D G P ++ +  V I ++D ND  P FS  ++   +SEN+ +G +V  VT  D D+  N   +Y I+             +SLPF  I  + G+IV    L+RE    Y + V A D+G    +T +T V I + D+NDN P F   +  +   +  E +G  +  V A D D G N ++ Y I+  +   YF  N    ++    VL  Q          + H  +++A D+G P   S    VTI  V
Sbjct: 2347 TGTINIIVDDINDNVPTFANNMYLTSIAE------DARTGTDVLLVNASDADAAANAVISYSIIGGNS-------QFTINPSTG---QIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFV-FAVTVTDADIGSNSELHYSLSGRN-SEKFHIDPLRGAIMAAGPL---SGASEVTFSVHVKDGG--SFPKTDSTTVTVRFANKAD-FPKVRAKEQTFMFPENQPVGTLVTTITGSSLRG-----------ETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKIQKYV--VWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILT--VSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRFS-QIFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIV------------DTSLPF-TINPNTGDIVISRPLNREDTDRYRIRVSAHDSG----WTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPE-LGSRVTQVSATDPDEGSNGQVFYFIKSQSE--YFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSE-TTVTINTV 2976          

HSP 12 Score: 137.887 bits (346), Expect = 3.368e-31
Identity = 161/638 (25.24%), Postives = 283/638 (44.36%), Query Frame = 2
Query:  446 YRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFI----SPSYVSKSL-NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKD----QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVP-NMFVGEVMAVDKDAERN-SKIEFQI-IGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTK-MKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDN 2317
            Y + DGN L     +D +T  +++ + +  +      +N + ++R       +P   S+++ ++ + + N + P + Q     +  E        RT+    A D D   N  I Y +   N   + G++ I   +S++  + L   K +D E    +E+ + A D G   RTG   L + ++D NDN P+F   +++   + ENA  G   + ++A DAD  AN  I Y ++   +  +    N G I  +  +D++   + +  +V A +   EE  K     V I +   N+  P  +  +   +        +       + +  +   D D G    V   +  N + +  Q++      QI      DRE++    + +L K+    +  +    ++   +LD ND  P    +  +RV  +  VP    V  V A D D+  + S+  + I  GNE   F I+  +G++     LDRE    +N+T+LA D G P  TG+  + + + DIND  P  ++S  E  + EN   GT V T+ + D DLP N     Y ++S      +YF  S++          G + T   +DRE+ + + L+VV  D+G P   +ST TV I ++D NDN
Sbjct: 3023 YFVSDGNHL-GKFKLDNDTGWISIASSLVSD------LNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTV---SARDRDTAMNGLISYNIISGN---EEGIFAI---NSSTGVVTLA--KALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVM-ENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETK-QSYHLTVKAFNVPDEE--KCSFATVDIQLKGTNEYVPRFVSKLYYFE--------VSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQIN--KMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDAND--PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVS--EGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTG-PATNYFSLSTA----------GVLSTTREIDREQIADFYLSVVTRDSGAPQ-MSSTGTVHITVLDQNDN 3612          

HSP 13 Score: 87.0409 bits (214), Expect = 9.833e-16
Identity = 131/539 (24.30%), Postives = 226/539 (41.93%), Query Frame = 2
Query:  383 GTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSW-PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCS-----LSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERN-SKIEFQII--GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDIND 1963
            G+ +  ++   ++  ++   SY I  GN+      I+  T VVT+   +D E    +++        +++ +    SL V ++D+NDN+P + P +      T  E     +  IH++ A D D   N+ I Y ++     +D+ ++ I  +        +     +D E    Y L + A +    ++     + IQ+   N+  P F    YY  ++SE A+ G     V A D D  A+G++ Y I      + F I    G I V   +D +   +     VLA +          E  V I V+D ND  P +    T R         I   V   + +  +   D D     I S S     + + ++     ++P  +  QI   +  DRE   +  + +L  D      T S S+V  + D NDN P  T V    VLEN   P   V  + + D D   N     + ++  G   ++F + ++G + T + +DRE+   F ++++ +D G P  + TG V I V+D ND
Sbjct: 3107 GSVVRTVSARDRDTAMNGLISYNIISGNEE-GIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYC-SLTVSVIDVNDNSPVFVPDE---FFPTVMENAPSGTTVIHLN-ATDADSGANAVIAYTVQ----SSDSDLFVIDPNMGV-----ITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYF-EVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEER-VSLKVLAKNFGNIRGADIDEVTVNITVLDAND--PPVFSLSTYR-------VQISEGVPIGTHVTFVSAFDSD----SIPSWSRFSYFIGSGNENGAFSINP--QTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLT-VSEGEVLENKR-PGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSSTGTVHITVLDQND 3611          

HSP 14 Score: 70.4774 bits (171), Expect = 1.143e-10
Identity = 78/262 (29.77%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  338 SITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVST-SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYV-SKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNEN-SQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRA-----KYYANKLSENANIGFVALTVSAKDADYL 1099
            S++  ++QI E    GT +  ++ +  ++I S S  SY I  GN+      I+P+T  +TV + +DRESL     N  ++     +PS   S SL V + DINDN P        VS  E   NK     +   ++ DPD+  N    +Y+L      T+          ST+R         IDREQ+  + L ++  D+G+P+ + +  + I +LD+NDN P   R       YY N L     +G    +V  +D D L
Sbjct: 3407 SLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNEN-GAFSINPQTGQITVTSGLDRESL--PVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVL-----TVSEGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTRE--------IDREQIADFYLSVVTRDSGAPQMSSTGTVHITVLDQNDN-PSQSRTVEIFVNYYGN-LFPGGTLG----SVKPQDPDVL 3646          
BLAST of Protocadherin 1b vs. UniProt/SwissProt
Match: sp|Q5DRE1|PCDC2_PANTR (Protocadherin alpha-C2 OS=Pan troglodytes OX=9598 GN=PCDHAC2 PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 6.601e-60
Identity = 174/630 (27.62%), Postives = 295/630 (46.83%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE---DQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-------SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGI---------GTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIID 2305
            L +D  +  + V  RIDRE+LC  +  C + L           ++ VEILDINDN+P +P+ +  +  +E   +       HI+ A DPDV  NS   Y L      +++    +K     S+ +EL+  K +DREQ  ++ L+L A D G P R+G+ ++ +++LD NDN P FD++ Y   +L E++  G + + ++A D D  +NG++ Y +      +  + F+I  + G + V   +DY+     +Q  V A D  P      G C+V++ ++D ND  PE++        LT+  + +      N+++A + V D D G    VS  L      RL     S   + ++     DRE  ++  + +   D      T+ +++  +I D NDN P F    +   ++  ++P + +  V A D D + N+++ + ++  E     + S       SG +Y     D E+  +F VT+ A+D G+PP + TG   + VVD+ND  P     LY  S + +A           G  V  V A+D D   N  + Y           +   +S L    +    GEI T   +  E  S + LTVV  DNG P S +++  + + ++D
Sbjct:   90 LELDLTSGALFVNERIDREALCEQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSE---SVAPGARFHIESAQDPDVGANSVQTYELS----PSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRV-QLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYEE-ASSYQIYVQATDRGP--VPMAGHCKVLVDIVDVNDNAPEVV--------LTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFGNS---YTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGNPPLSSTGTANVYVVDMNDHAPHI---LYPSSTNSSAAFEMGPRTAPAGYLVTKVIAMDSDSGQNAWLFY-----------HLAQTSDLDLFKVELHTGEIRTTRKMGDESGSTFNLTVVVRDNGEP-SLSASVAITVAVVD 682          

HSP 2 Score: 143.28 bits (360), Expect = 2.817e-33
Identity = 150/573 (26.18%), Postives = 244/573 (42.58%), Query Frame = 2
Query:  968 IQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-----NNGNIM---VRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEF-QILAIANFDREEKSMEKVDILCKDQAYNTASK--SIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHF-FQIDSSGKMYTKQV---LDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF----KTSNKTVFSIQT-TESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHK--LVISACDKGKPPKCSNPLWVTIKVV 2617
            ++ILD NDN P F R  Y   ++SE+   G      SA+D D  AN   TY +     SE+F +       N  ++   +RK +D +         + A+DG      ++G  ++ + V+D ND  P       +     + P          +++  +   DPD G    +  SLS+    R  Q+   D    ++  I   D EE S  ++ +   D+     +    ++  I+D NDN+P+      +  V ENA+ PN  V  +   D+D+  N K+    +G E    F+++  G  YT  V   LDRE    +N+T+ A DGG P  T    + +E+ DIND  P F    Y   I EN   G  + TV A D D   N ++ Y ++           Y S      I    G +      D EK   + +TV A D G+P   +ST T  + ++D+ND+ P       T++   F +   T   GY +  V A+D D G+N+ + Y + + +    F       ++     +  +      L +   D G+ P  S  + +T+ VV
Sbjct:  136 VEILDINDNSPRFPRPNYQL-QVSESVAPGARFHIESAQDPDVGANSVQTYEL---SPSEHFELDLKPLQENSKVLELVLRKGLDREQAAL-HHLVLTAVDGGIPA--RSGTAQISVRVLDTNDNSPAFDQSTYRVQLREDSPP--------GTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENAT-PNTIVAVLSVNDQDSGPNRKVS---LGLEATLPFRLNGFGNSYTLVVSGPLDRERVAVYNITVTATDGGIPQLTSLRTLKVEISDINDNPPSFLEDSYSIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGLPVTSYVS------INSASGSLYAVNSFDYEKFREFFVTVEAQDKGNP-PLSSTGTANVYVVDMNDHAPHILYPSSTNSSAAFEMGPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFKVELHTGEIRTTRKMGDESGSTFNLTVVVRDNGE-PSLSASVAITVAVV 681          

HSP 3 Score: 140.198 bits (352), Expect = 2.589e-32
Identity = 140/514 (27.24%), Postives = 233/514 (45.33%), Query Frame = 2
Query: 1166 NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIE-VKDPDFGGRDIVSCSLSNND--KMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG----NEEHFFQIDSS-GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRG-EIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEE----GNPY-GYFSFNTQNKKL-ILNSV-LSKQDDHKLVISACDKGKPPKCS----NPLWVTIKVVKQHILIPN 2641
            +G + V + ID +A  +     +L+++            EV I+ I++N          + R P  N    + +E ++     HIE  +DPD G   + +  LS ++  ++ L+ +  + K  +++     DRE+ ++  + +   D      + +  I  ++LD NDNSP F +  +   L   S P   V ++ A D D   N ++ + +       E   F ID+S G++     LD EE   + + + A D G  P  G   V +++VD+ND  PE  L+     + ENA   T V  ++  D+D   N K+   +              ++LPF++        +V    LDRE+ + Y +TV A D G P   TS  T+K+ I D+NDN P+F   + +++ IQ     G  + TV+A D D  EN+E+ Y + E    G P   Y S N+ +  L  +NS    K  +  + + A DKG PP  S    N   V +     HIL P+
Sbjct:   96 SGALFVNERIDREALCEQRPRCLLSLEVLAHNPVAVSAVEVEILDINDN----------SPRFPRPNYQLQV-SESVAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVNDNAPEVVLTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGL-------------EATLPFRLNGFGNSYTLVVSGPLDRERVAVYNITVTATDGGIPQ-LTSLRTLKVEISDINDNPPSFLEDSYSIY-IQENNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGNPPLSSTGTANVYVVDMNDHAPHILYPS 583          

HSP 4 Score: 99.7525 bits (247), Expect = 8.724e-20
Identity = 108/401 (26.93%), Postives = 186/401 (46.38%), Query Frame = 2
Query: 1415 HIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIV-FQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHF------FQIDSSG-KMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDR--GEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAV-DLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKP 2575
            H+    P +   D+ S +L  N+++        D+E      A  ++  + +  +++L    A+N  + S V  +ILD NDNSP+F R  +  +V E+ +    F  E  A D D   NS   +++    EHF       Q +S   ++  ++ LDRE+    ++ + A DGG P ++GT  +++ V+D ND  P F  S Y   + E++  GT V  + A D D  +N +++Y + S          Y+S    Q+   D   GE+     LD E+ S Y + V A D G P        V ++I+DVNDN P    ++  ++S     +    I  V +V D D G N ++   +E   P+    F   +  L+++  L ++    + + ++A D G P
Sbjct:   81 HLGAPSPRYLELDLTSGALFVNERI--------DRE------ALCEQRPRCLLSLEVL----AHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIE-SAQDPDVGANSVQTYEL-SPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGTAQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSS----------YTSDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRG-PVPMAGHCKVLVDIVDVNDNAPEVVLTD--LYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFG-NSYTLVVSGPLDRERVAVYNITVTATDGGIP 447          
BLAST of Protocadherin 1b vs. TrEMBL
Match: A0A0R3X5C4 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8640 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 2.211e-84
Identity = 268/958 (27.97%), Postives = 409/958 (42.69%), Query Frame = 2
Query:  359 QIFEEPKNGTEIEVLTKYLKNNI-VSVSTSYRIFDGNKLLN-CLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNV---------------------EILDINDNAPSWPQQSKVVS-FTEFEGNKLESRT---IHIDKAFDPDVNENSQIDYFLKD-------RNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYY---ANKLSENANIGFVALTVSAKDADYLA-NGKITYRI---EDQKASEYFNIGNNGNIMVRKNIDYDAGVKG-------------------FQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLT--NEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVS--------------PSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPN-----------MFVGEVMAVDKDAERNSKIEFQIIGNEE--------------------------HFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPP----KTGTGLVTIEVVDINDWKPEF-----------------------SLSLYEFSISENAGIGTSVGTVTAIDRDLP-------------ANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINII--DVNDNFPTFKTSNKTVFSIQTTE--------------------------------SVGYEIGT----------------VEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLS---KQDDHKLVISACDKGKPPKCSNPLWVTI 2608
            QI EE  NGTEI  +++YL N I VS   +Y++ D +++L   L I+P+T  + V  RIDRE+LC    +  I L +    +   K +N+                      I D+NDN PSW    K +      E N LE  +   + +  A+DPD   N +I Y L++          + D G          S  ++L P + ID E+  VY+L+LIA D G P   G   L + ++D ND  P+F +  +       +SE  + G V L V+A D D    N ++TY +    ++   E F++  +G I++R  +DY+    G                   F F V A D AP  Y KTG   VVI +IDENDE+P I         L    E  +I         LA+I+ +DPDF GRD V C++ +N+ + L +V+              P + +F +      DRE   + +V I C D+A NTA   I  ++LD ND +P F R VF+F V EN  VP+             +G V+A DKD   N+KI++ ++   E                            F+IDS +G+++  +  D E+ +   + ++A D    P     TGT  V ++V D+NDW P F                       ++  Y+FSI EN    T VG ++AID D+              A+     R ++ +F++ +     ++     I    G++ T   LDRE  S+Y   VVA+D G  +  + T+T  + ++  D NDN P F      V   +  E                                +V   +G+                +EA D D G N +I Y I  GN    F  +     L+L +VL    +  ++ L   ACD+G PP+C+NP  + I
Sbjct:    3 QIIEESSNGTEISGVSEYLHNAIGVSSKATYQLLDSHEMLTRLLKIEPQTGRLYVDGRIDREALCSQ--SSKIPLTYLDPEASCVKQINILATAQTENNQEVSVQTIPIKLVIQDVNDNKPSWNLAGKQLDDLPILEANILEQGSGNKVLVPAAYDPDSGRNGEISYRLENYISSSSSGANERDQGPAPFTISGPISGMLQLTPFQPIDYEKQSVYDLLLIASDAGEPTNVGRAHLRVNVIDVNDECPVFTQQVFTPPGGRGISERTHPGKVILNVTAIDGDASERNSRLTYSMVPSSNRLIGEIFSVHPDGRIILRHWLDYETLEPGLMASSTSALREAPPTEGKQFAFFVKATDSAPPPYEKTGTALVVIPIIDENDERPIITSRFLGSPELVKHGEAGVITENSSVPVRLAYIQARDPDFEGRDSVECTVPDNENLSLRRVTPFTHRSSSDDVNMPPKNNDFLLSLEEPVDRETTKVLQVRIHCVDEANNTADLLINIRVLDVNDETPTFLRPVFYFSVNENTKVPSDGNGANGTLQGYRIGRVIAYDKDEGDNAKIKYGLLPTIEIEEPKLRPSLFPLSDYGQEVAPTQAFDLFRIDSITGELFALRSFDAEKEKLIKLKVIAVDQPSDPTATSHTGTASVYVQVFDMNDWSPVFHQVVDNTKPNQQLYAPSILDEPTTVDSYQFSIKENLPAYTLVGRISAIDPDVSFWGVIGSVNNSNGADGSRALRSVTIQFAQGTAPYVENAF---TIHSASGQLRTTGPLDREAYSNYTFNVVAVDRGPVDGISRTSTAGVTVLVEDENDNDPVFVRPAAEVADTRGPEESFFEEEALSPLSQSIESPPTSTTDTDHIPVVAVSLPVGSGSVDVSSNQIPRPLIRIEAQDPDAGANGQIRYAITSGNTDEIFYLDPNTGSLVLKTVLPATKETSNYLLQFEACDQGSPPRCANPARLRI 955          
BLAST of Protocadherin 1b vs. TrEMBL
Match: A0A0R3SI41 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4604 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.574e-83
Identity = 261/897 (29.10%), Postives = 391/897 (43.59%), Query Frame = 2
Query:  362 IFEEPKNGTEIEVLTKYLKN-NIVSV----STSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQI----------NCDIMLRFFI--------SPSYVSKSLNVEILDINDNAPSWPQQSKVV--------SFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKT--------DNGVWKIKYDSS-TSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIF-----------------DRAKYYANK--LSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS---EYFNIGNNGNIM-VRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTN----------------------EPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSD-----------------------KEFQILAIA--------------NFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT--RVFHFRVLEN-ASVPN--MFVGEVMAVDKDAERNSKIEF------------QIIGNEEHFFQIDS-SGKMYTKQVLDREETEK---FNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPAN-TKMKYR-------IISDRFSKESYFQYS-SSLPFQM------------IRHDR-----------GEIVTKYLLDREKQSHYLLTVVAIDNGHPNS-------------------------YTSTTTVKINIIDVNDNFPTFKTSNKTV-FSIQTTESVGYEIGTVEAVDLDFGENSEIVYQI 2449
            + EE   GT I  + +YLK   +V+V    ST+Y++   +       I+P+T  +    RIDRES+C   +          +C   L   I        + S +   + + I+DINDN+P WP +  +         S T F   ++ +++  +D+A DPD   N  + Y LK              DNG    +YD    +  + L P+  +DRE  + Y L L A D G+P+R+ S+ L + + D ND+ P+F                 D  +    +  L E A IG   L ++A D D   N +ITY I    A+    YF++  +  I+ VR+ +DYD G + F+F VLA+DGAPE  R TG   V I + D NDE P I + + +   L                        + A IE     + V+A+++V D D  G D V C L   D   L+  SPS                         E++ILA                  DRE    + + I+CKD+  N A + I   +LD NDN PKF     F+F + EN   V N  +++G V A D D   N++I +            Q   + +  F++   +G +Y +  LDRE       +++ ILA D G P  TGT  V I V+D+NDW PEF+  +Y F + E+  +   VG V A+DRD  A    + YR       I+      ES  +    S+P Q             +R +R           GEI     LDRE  S++   V+AID+    S                         +T+T TV + + DVNDN P F+  N ++   +   E++G++I TV+AVD D+GEN+ I Y I
Sbjct:   29 VVEECPPGTLISGVAEYLKQIMLVTVEMPNSTTYQLMGTDPFTKSFVINPKTGELRTVGRIDRESICTPDVTSRNDLGIDSSCLKSLNVLINSRGIDGAARSGMRMQIMLRIVDINDNSPKWPGKRILTVRFVESFQSGTSFGKQEMTTQSQLLDRAVDPDAGPNGTVSYSLKGNGADMFRLEYPDLDNG----RYDQQDINSPLRLKPVVPLDREMFEYYNLTLYAFDAGNPQRSSSIPLDVYVTDFNDHAPVFHSYNSGHSGYSRDNKQGDSVRIIPERTHLMETARIGSEVLQLNATDEDSGENARITYSIFPGDAALVQPYFDLDPSSGILRVRQRLDYDLGPRKFKFKVLAVDGAPEPIRLTGTTSVEIELTDYNDEPPNIEILIPQNGNLNGGNTANINGGITPILSAGGKYQEQVAFIEESPSPDIVIAYVQVSDMDENGEDQVECHLGPRDNFTLQADSPSSGGKSDHFGFDSGASLSDRLSKRISEYRILAKVPSDHSSGSSSSLQNRLDRETTPTQLLTIICKDRNGNQAERRIRLHLLDINDNPPKFINDSYFNFSIAENREPVGNQQVWLGRVQAFDPDLGENARITYHLAPEQNGYHDGQFASSAQQLFRVQPDTGDIYAQVSLDRENAPDNGVYSMNILAVDHGKPQLTGTARVDITVLDVNDWPPEFTRDIYTFEVPEDLELREVVGVVEAVDRDATAGPNTITYRLNPPRSGIVQRSLGNESLERVKRDSMPLQQQPLFMPHLEPSKVRDERPLSYFSIDSRTGEIRVIRKLDRETNSYFTFEVLAIDSPLSGSSQVPMTQSSNQIQQGSRRGFKGGETFTATATVVVTLTDVNDNAPEFRYPNTSILLHMAPGETLGHKILTVQAVDADYGENARISYNI 921          
BLAST of Protocadherin 1b vs. TrEMBL
Match: R7VJZ4 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_32685 PE=4 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 1.921e-82
Identity = 217/693 (31.31%), Postives = 356/693 (51.37%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSL--NVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSST--SRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEY---FNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH-VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDP-PKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQY---SSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF---KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKL 2503
            L +DP + +++   R+DR+ +C     C + L   I  + + + +  +VEILD+NDN+P +P     +SF   E     + +  I +A DPD   N+   Y L           W++  +     +R + L     +DRE    Y L ++A D GS  R+GS+++ I++ D NDN P+FD A Y    + EN       + + A+DAD+  NGK+ Y +  + AS Y   F I N+ G + V+  +D+++    +  +++A D        +    ++I V D ND  P I ++ +  RD  TN   + E+  I + V  H+ VKDPD G     +CSL N    RLEQ  P  +E+ +L     DRE+++  ++ + C D+     T++K I   + D NDN+P F    +   L   +    +V  V A D+D  RN++I + +  N+  FF ID+ +G +  +  LDRE   ++N+ ++A+D G+P PKT T  + ++V+D+ND KP F+ ++Y F + EN   G  VG ++A D D P             +++ S F     S S  F+M   D G + T   LDRE+QS Y L  VA D   P + +ST TV I+++D+NDN P F     +N+TV  +     +G+ +  ++A D D   N +I+YQ+ +GN  G F+ +  +  L
Sbjct:   46 LSVDPRSGLISTSGRLDRDVICAGFFTCIVPLDIAIHANKIFQVVKASVEILDLNDNSPKFPDPR--ISFQVLESAHPGATSFLIPEARDPDSPSNAVQSYELVAEGSDA----WRLNVEEEVDGAREVMLALTDHLDRETNGHYHLQVVAYDGGSSPRSGSIDIFIEVEDANDNSPVFDSASYEVT-IDENTPRLTNIIQLRAQDADWGVNGKVQYSLSARSASTYGHLFGIHNSTGQVFVKGAVDFESS-PSYHLTIVARDSGSGSVPSS--ASLLISVRDLNDHAPHITMNTLLARD--TNRSFVPEDAPIGHFV-GHVIVKDPDSGTNGAFNCSLENR-AFRLEQTFP--EEYHVLTTKELDREQRNEYRLTMRCVDRGSPPMTSTKHISVVVTDVNDNAPVFREASYVAELFENNYHGAYVTRVNATDEDEGRNAEIVYGLGPNDLAFFDIDAVTGVISARDSLDRERRSEYNLRVVARDNGEPTPKTSTVSLLVKVLDVNDEKPLFTSAVYSFGVDENLPAGHEVGFLSAHDADSPP------------YNQHSMFLLPAGSLSDAFEM-DDDTGMVRTTRPLDREQQSVYELIAVARDINSP-TISSTATVSIHVMDLNDNPPFFIFPAPANRTV-QLSHKVPLGHVVTQIKARDRDRDSNGKIMYQLTQGNTEGVFTVDPNSGAL 707          

HSP 2 Score: 100.908 bits (250), Expect = 7.769e-18
Identity = 94/344 (27.33%), Postives = 161/344 (46.80%), Query Frame = 2
Query: 1634 QILDRNDNSPKFT--RVFHFRVLENA--SVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFF------QIDSSGKMYTKQV--LDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-------VGYEIGTVEAVDLDFGENSEI-------VYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCS 2587
            +ILD NDNSPKF   R+  F+VLE+A     +  + E  A D D+  N+   ++++      +      ++D + ++       LDRE    +++ ++A DGG  P++G+  + IEV D ND  P F  + YE +I EN    T++  + A D D   N K++Y +     S  S   Y        I +  G++  K  +D E    Y LT+VA D+G   S  S+ ++ I++ D+ND+ P    +  T+ +  T  S       +G+ +G V   D D G N           +++E+  P  Y    T+           ++++++L +   D+G PP  S
Sbjct:   95 EILDLNDNSPKFPDPRI-SFQVLESAHPGATSFLIPE--ARDPDSPSNAVQSYELVAEGSDAWRLNVEEEVDGAREVMLALTDHLDRETNGHYHLQVVAYDGGSSPRSGSIDIFIEVEDANDNSPVFDSASYEVTIDENTPRLTNIIQLRAQDADWGVNGKVQYSL-----SARSASTYGHLF---GIHNSTGQVFVKGAVDFESSPSYHLTIVARDSGS-GSVPSSASLLISVRDLNDHAP--HITMNTLLARDTNRSFVPEDAPIGHFVGHVIVKDPDSGTNGAFNCSLENRAFRLEQTFPEEYHVLTTKELD------REQRNEYRLTMRCVDRGSPPMTS 418          
BLAST of Protocadherin 1b vs. TrEMBL
Match: A0A2H5BFB8 (Pcd11x OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 4.266e-80
Identity = 230/715 (32.17%), Postives = 352/715 (49.23%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFF-ISPSYVS----KSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITY----RIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDH--KLVISACDKGKPPK 2581
            I+  T V+    RIDR++LCP Q  C ++L     +P          + V I DINDN P +P     +S    E + +      I  A DPD  + S  DY L   + K +  V K K D ST  R+ L     +DRE VD Y++ ++A D G+P ++GS+++ I + D NDN P+F  A Y    ++ENA  G     V A D D    G+I Y    R +D   + +      G I V+  +DY+     +   VLA D   +      E  V++ V+D ND  P I V+ T     T    ++EN     + +AH+ V DPD G     +CSL N+D  RL+Q    D E++I+     DRE      + +LC+D       A K +   + D ND++P F++  +   + EN  +  +F+  V A DKD+  N  I++++  +    F +D  +G +  + VLDRE+T++    ++A D G P K+GT  V + V D+ND KP F+ S Y F + EN   GTSVGTV A+D D     + +Y I+    ++ S+           I    G+I T  +LDRE +  Y L ++A D G P   +ST TV I + D NDN P F+  + T  +I  +  V  GY +  V+A+D D G N+ + Y I  GN   +F  +     + +++ L   +DH   + +   D G+P K
Sbjct:   83 INKSTGVIRTDGRIDRDALCPRQDTCRVILDVVAFTPGQTQFLEIIKVKVNIEDINDNWPHFPDAR--ISHQILE-SAVPGYGFVIPTAIDPDSGQFSVRDYELVSSSDKFELSV-KTKLDGSTDVRLILK--DSLDREDVDFYQVRVVAYDGGNPPKSGSVDVNIIVQDANDNDPMFTNATYEVT-IAENAAPGTTLTKVHASDKDAGLYGQIRYSFSSRTQDTHGAVFGIKNTTGEIYVKGEVDYETS-PVYHLVVLADDRGSDTI--PAEATVIVRVLDVNDNAPLITVN-TLTQAGTEVAEVVEN-ADPETFVAHLTVTDPDNGKNGKFNCSL-NDDSFRLQQFF--DSEYKIVTRKKLDRETHDKYNLSVLCQDFGDEPLVAIKRLQIIVTDDNDHAPVFSQSTYEASLTENNHI-GVFITRVNATDKDSGENGLIDYKLHPDAGGDFHVDGLTGTVSARAVLDREQTQQIRFRVIASDRGQPRKSGTATVIVNVQDVNDEKPMFAQSAYSFGVYENEPEGTSVGTVHAVDPDTDPYNQFQYSILPGHSAENSF----------AIDPHTGKITTTTVLDREDKPVYYLLIMASDKGVP-PMSSTATVSIYVADKNDNPPVFEFPSDTNNTISISNQVPKGYLVTKVKAIDRDIGGNANLTYYISRGNHLNFFHMDPIFGVITVSTELKDIEDHVFHMQLKVSDSGQPEK 770          

HSP 2 Score: 161.77 bits (408), Expect = 2.617e-36
Identity = 166/579 (28.67%), Postives = 261/579 (45.08%), Query Frame = 2
Query:  935 SPKRTGSLELI---IQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYR-IEDQKASEYFNIG--------NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV-SPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFT-------RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE---EHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPY-GYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCS 2587
            +P +T  LE+I   + I D NDN P F  A+  ++++ E+A  G+  +  +A D D   +G+ + R  E   +S+ F +          +  ++++ ++D +  V  +Q  V+A DG      K+G  +V I+V D ND  P            T E  I EN     + L  +   D D G    +  S S+  +     V    +   +I      D E   +  + +L  D+  +T  A  +++ ++LD NDN+P  T             V+ENA  P  FV  +   D D  +N K    +  +    + FF  DS  K+ T++ LDRE  +K+N+++L +D GD P      + I V D ND  P FS S YE S++EN  IG  +  V A D+D   N  + Y++  D       F               G +  + +LDRE+       V+A D G P   + T TV +N+ DVND  P F  S  + F +   E  G  +GTV AVD D    ++  Y I  G+     F+ +    K+   +VL ++D   + L+I A DKG PP  S
Sbjct:  118 TPGQTQFLEIIKVKVNIEDINDNWPHFPDARI-SHQILESAVPGYGFVIPTAIDPD---SGQFSVRDYELVSSSDKFELSVKTKLDGSTDVRLILKDSLDRE-DVDFYQVRVVAYDGGNPP--KSGSVDVNIIVQDANDNDPMFT-------NATYEVTIAENAA-PGTTLTKVHASDKDAGLYGQIRYSFSSRTQDTHGAVFGIKNTTGEIYVKGEVDYETSPVYHLVVLADDRGSDTIPAEATVIVRVLDVNDNAPLITVNTLTQAGTEVAEVVENAD-PETFVAHLTVTDPDNGKNGKFNCSLNDDSFRLQQFF--DSEYKIVTRKKLDRETHDKYNLSVLCQDFGDEPLVAIKRLQIIVTDDNDHAPVFSQSTYEASLTENNHIGVFITRVNATDKDSGENGLIDYKLHPDAGGD---FHVDGLT---------GTVSARAVLDREQTQQIRFRVIASDRGQPRK-SGTATVIVNVQDVNDEKPMFAQSAYS-FGVYENEPEGTSVGTVHAVDPDTDPYNQFQYSILPGHSAENSFAIDPHTGKITTTTVLDREDKPVYYLLIMASDKGVPPMSS 664          
BLAST of Protocadherin 1b vs. TrEMBL
Match: A0A210PLD8 (Protocadherin-11 X-linked OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12667 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 7.963e-80
Identity = 234/749 (31.24%), Postives = 388/749 (51.80%), Query Frame = 2
Query:  464 NKLLNCLHIDPETHVVTVKNRIDRESLCPNQINC----DIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASE---YFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTN--EPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHF-RVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQI-DSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF----KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLV--ISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPP 2650
            N L++  HI+     +    ++DRE+LC  +  C    +++ R      Y    +++ +LDINDN+PS+   S     +E     L    I I+ A D D   N  I Y++ +         ++   D + S RI L     +DRE    Y++ +IA D G P +TG LE+II +LD NDN P F+  + Y   ++E+  +     TV A D D   NG++TY++   +A +    F I  ++G++++  ++ Y+ G K +   V A D A +      + +V I V+D ++  PEI +     DPL+N  +  I+EN ++  +V AHI + DPD G   IV+CS+ N+DK  L++ +    E++++     +RE K   +V + C D       AS   V  ++D NDN+PKFT+  +F  V EN S+ +  V +V A D D  +N+++ F +    + +F+I ++SG +    VLDRE   + + ++ A D G P  TG+  V + V D+ND KPEF    +E+++ EN  +  ++G + A D+D   N+++ Y I         +  Y + +PF ++ +  G I+   ++DRE ++ Y  TV+A D G+P S  ++  V + ++DVNDN P F      +N  V S QT   V   + TVE  D+D G NS + Y +++ N    F  N  + +++L+  L+  D  K    I A DKG PP+  N + ++I V  Q I     PP
Sbjct:   80 NSLVSLFHINERQSSLYTAQQLDRENLCEYKDECVLELEVIARSTSGSLYKKIKVSITLLDINDNSPSFSVPSITRDISE---GSLTGFYIPIEAAKDADTG-NFSIQYYILEPPSSPFTVGYQEFVDGTYSVRIVLD--GQLDRETTSSYKVNVIARDGGEPPKTGVLEVIINVLDINDNRPRFN-TQMYNVTVNEDVAVNTTITTVFADDPDQGENGRVTYKLSPNQAEKIPTLFTIDESSGDVIIVGSLIYEPG-KSYTIIVEASDNALQPL--ISQSKVFIHVLDVHNNPPEISI-----DPLSNTEDSEILENAILDTAV-AHITIFDPDTGKNGIVNCSVVNSDKFTLQRFAV--HEYKVVLSQALNREIKDRYEVTVHCHDIGTPQLNASAMFVVHVMDINDNTPKFTQQQYFVSVQENKSLTSS-VMQVAANDFDNGKNAEVMFSLDSEGQKYFRISETSGVITVNSVLDRETVSQISFSVFAADKGSPSLTGSAQVRMIVTDVNDNKPEFMEDTFEYNLEENNHVNINIGVLVANDKDDGNNSQITYSI---------HPNYHAGIPFAIMPN--GSILATQVIDREAKARYDFTVIAEDMGNP-SLRNSAHVTVFVLDVNDNNPEFVFPNAHNNTVVISYQT--PVNTIVSTVETRDIDEGMNSRVTYFMKDKNFSHIFKLNNLSGRIVLDKALTVADAKKYTFGIIAQDKGTPPRI-NEIAMSIVVTTQKIGGDVTPP 794          
BLAST of Protocadherin 1b vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 263.462 bits (672), Expect = 1.058e-72
Identity = 213/727 (29.30%), Postives = 351/727 (48.28%), Query Frame = 2
Query:  482 LHIDPET-HVVTVKNRIDRESLCPNQINCD-IMLRFFIS---------PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRI-ELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQK--ASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSD----KEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF-KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPK 2581
            L +D +T  + T +  IDRE+L   +I      L F +S         P  +     +E+ DINDN P +P     +S  E   N     T  I +A D D   N  + Y L    G   + ++ ++  +    ++ +L+ +  +DRE  D Y+L + A D G+P R  S  L + I D NDN P F+++ Y A ++SEN+ +G+  L V A D+D   NG+I Y I        +   I  + G I V+  +D +  +  F+F V+A D  P    K+    V I V D+ND  P + +        ++  A I  ++   + +A ++V D D G   +V+C ++ +   +L     S     K++ +      D E     +V+I+  D      +++ S+  Q+ D NDNSP F+           + P   V +V+A+D D+  N+++ + II +      F+ID SSG++  +  LDRE  E++   + A D G P   GT  V I+V+D ND  P+F LS Y FS+ EN    + VG VT +D D   N +++  +  D  +              ++++  G I++    DREK+S Y   + A+D G P   +S   V IN++D NDN P   K SN +   +    +    +  VEA D+D+G N+E+VY I  GNP+  F  +  + ++ L   L+++    H+LV+   D+GKP +
Sbjct:   64 LRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEG--RIEVQDINDNTPQFPSPVLTLSVQE---NAHMGATFAIPQATDRDTERNGVLKYDLS--AGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEA-EVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREE-ISSFKFHVIARDKGPSP--KSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNF-------------VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSR 765          

HSP 2 Score: 103.605 bits (257), Expect = 6.560e-22
Identity = 174/713 (24.40%), Postives = 288/713 (40.39%), Query Frame = 2
Query:  599 YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIK-VIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFD--------RAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGN-------IMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG-GRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSL-SLYEFS-ISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFG---ENSEIVY---------------------QIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLW 2599
            Y S  L V I D NDNAP + + S     +E   N     ++   KA D D+  N +I+Y +     +  + V K+       R   ++ +K  +DRE++  ++  +IA D G   ++ +  + I++ D+NDN P  +         +   AN +SE+  +G     V   D D   N  +T  +      +    G++         +     +DY+  ++ ++  ++A+D        T    V   V D ND  P          P   E    E       VL  I + D D G   ++V   ++++    L ++ PS  E  + A +  DRE K   +  +   D+    +  + ++V ++LDRNDN PKF    + F VLEN   P   VG V  +D D   N++++  +  +  +F   + +G + +    DRE+   +   + A DGG+PP++    VTI V+D ND  P  +  S   F  +S  A   + V  V A D D  +N ++ Y I      +  Y   S            GEI     L R+    + L V   D G P+ +     + +  I VN+       SN ++       S+   + T  A D D+G   + S IVY                     +++     GY +   + K L       KQ    +      KGKPPK   PL 
Sbjct:  224 YSSALLRVVITDANDNAPQFEKSSYEAEVSE---NSPVGYSVLQVKANDSDLGPNGEIEYTIH----QASDPVPKML---QIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVAN-ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYER-IRDYRVEIVAVDSGNPALSSTNSLRV--QVTDTNDNSPIF-------SPPLFEVEFAEENQPGEKVLDVIAL-DADSGTNAELVYSIIADSSTRGLFEIDPSSGE--VRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMP-PLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSD-----------GEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHA----IALVHIYVNETI-----SNVSLVEGLVGHSLYTPLDTDIAGDPDYGLAAQRSNIVYGSLAGVAGVVTVIIVVVFIRHRLQRETKSGYQAGKKETKDLYA----PKQGTKSIKGKKGRKGKPPKSPKPLG 887          
BLAST of Protocadherin 1b vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 264.233 bits (674), Expect = 3.060e-72
Identity = 213/725 (29.38%), Postives = 350/725 (48.28%), Query Frame = 2
Query:  482 LHIDPET-HVVTVKNRIDRESLCPNQINCD-IMLRFFIS---------PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRI-ELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQK--ASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSD----KEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF-KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
            L +D +T  + T +  IDRE+L   +I      L F +S         P  +     +E+ DINDN P +P     +S  E   N     T  I +A D D   N  + Y L    G   + ++ ++  +    ++ +L+ +  +DRE  D Y+L + A D G+P R  S  L + I D NDN P F+++ Y A ++SEN+ +G+  L V A D+D   NG+I Y I        +   I  + G I V+  +D +  +  F+F V+A D  P    K+    V I V D+ND  P + +        ++  A I  ++   + +A ++V D D G   +V+C ++ +   +L     S     K++ +      D E     +V+I+  D      +++ S+  Q+ D NDNSP F+           + P   V +V+A+D D+  N+++ + II +      F+ID SSG++  +  LDRE  E++   + A D G P   GT  V I+V+D ND  P+F LS Y FS+ EN    + VG VT +D D   N +++  +  D  +              ++++  G I++    DREK+S Y   + A+D G P   +S   V IN++D NDN P   K SN +   +    +    +  VEA D+D+G N+E+VY I  GNP+  F  +  + ++ L   L+++    H+LV+   D+GKP
Sbjct:  100 LRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEG--RIEVQDINDNTPQFPSPVLTLSVQE---NAHMGATFAIPQATDRDTERNGVLKYDLS--AGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEA-EVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREE-ISSFKFHVIARDKGPSP--KSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNF-------------VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKP 799          

HSP 2 Score: 104.76 bits (260), Expect = 3.235e-22
Identity = 172/707 (24.33%), Postives = 286/707 (40.45%), Query Frame = 2
Query:  599 YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIK-VIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFD--------RAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGN-------IMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG-GRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFS-LSLYEFS-ISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFG---ENSEIVY---------------------QIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPK 2581
            Y S  L V I D NDNAP + + S     +E   N     ++   KA D D+  N +I+Y +     +  + V K+       R   ++ +K  +DRE++  ++  +IA D G   ++ +  + I++ D+NDN P  +         +   AN +SE+  +G     V   D D   N  +T  +      +    G++         +     +DY+  ++ ++  ++A+D        T    V   V D ND  P          P   E    E       VL  I + D D G   ++V   ++++    L ++ PS  E  + A +  DRE K   +  +   D+   +   + ++V ++LDRNDN PKF    + F VLEN   P   VG V  +D D   N++++  +  +  +F   + +G + +    DRE+   +   + A DGG+PP++    VTI V+D ND  P  +  S   F  +S  A   + V  V A D D  +N ++ Y I      +  Y   S            GEI     L R+    + L V   D G P+ +     + +  I VN+       SN ++       S+   + T  A D D+G   + S IVY                     +++     GY +   + K L       KQ    +      KGKPPK
Sbjct:  260 YSSALLRVVITDANDNAPQFEKSSYEAEVSE---NSPVGYSVLQVKANDSDLGPNGEIEYTIH----QASDPVPKML---QIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVAN-ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYER-IRDYRVEIVAVDSGNPALSSTNSLRV--QVTDTNDNSPIF-------SPPLFEVEFAEENQPGEKVLDVIAL-DADSGTNAELVYSIIADSSTRGLFEIDPSSGE--VRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMP-PLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSD-----------GEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHA----IALVHIYVNETI-----SNVSLVEGLVGHSLYTPLDTDIAGDPDYGLAAQRSNIVYGSLAGVAGVVTVIIVVVFIRHRLQRETKSGYQAGKKETKDLYA----PKQGTKSIKGKKGRKGKPPK 917          
BLAST of Protocadherin 1b vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 258.84 bits (660), Expect = 5.249e-71
Identity = 230/797 (28.86%), Postives = 376/797 (47.18%), Query Frame = 2
Query:  317 WILLLI----SSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN-------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRI-ELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS--EYFNIGNN-GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSD----KEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            W +LL+    SS+     Q+ EE    T +  L       +      Y++  G   L    +D +T  + T    IDRE+L  C N    D   L F +S + + K          +EI D NDN P +P     ++  E   N        I  A D D   N   DY L   +G     ++ ++   +T  ++ +L+ +  +DREQ D Y+L +   D G+P R  S  L I I D NDN P F+R+ +Y  +++EN  +G   L V A D D  ANG++TY       +     +I +N G I V+ ++D +  V   +FSV A D  P+   K+ +  V I V D ND  P I +     V   D + N    +  ++   + +A +EV D D G   +V+C ++ +   +L   S SD    +++ +      D E     +++I+  D      +++ S+  Q+ D NDN+P F+   +       + P   V +V+A D D+  N+++ + II +   +  F I+ ++G++     LDRE  E++   + A D G P   GT  V + V+D ND  P+F L+ Y FS+ EN    + VG VT ID D   N  ++  +  +  +F               +I++  G I++    DREK+S Y   + A+D G P   +S   + IN++D NDN P   K SN +   +Q   S    +  V+A D+D G N+E+VY I  GNP+G F  ++ + ++ L    +++ +  H+LV+   DKGKP + +  L
Sbjct:   20 WTVLLLYSCGSSLASITYQLREEQPPNTLVGSLAA--DQGLPDTGHLYKLEVGGPYL---RVDGKTGDIYTTDVPIDRETLKDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPE---NTYVGAHYSIPVAMDKDAGSNGIADYKLN--SGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERS-HYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREE-VPLLKFSVQARDNGPQA--KSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIAN----VSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKF---------------VIQNGTGTILSSISFDREKESTYTFRLKAVDGGDP-PRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTAL 782          

HSP 2 Score: 140.969 bits (354), Expect = 2.064e-33
Identity = 168/592 (28.38%), Postives = 260/592 (43.92%), Query Frame = 2
Query:  956 LELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRI-EDQKASEYFNIGNNGN-------IMVRKNIDYDAGVKGFQFSVLAIDGA-PEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAI-ANFDREEKSMEKVDILCKDQAYNT-ASKSIV-FQILDRNDNSPK-----FTRVFHFRVLENASVPNMFVGEVMAV----DKDAERNSKIEFQIIGNEEHFFQI------DSSGK----MYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLS----KQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            +E  I+I D+NDN P F  +      + EN  +G       A D D  +NG   Y++     A   F++    N       ++V  N+D +     +  S+  IDG  P  Y       + I + D ND  P+      +R     E A  EN  +  SVL  ++  D D G    V+ S  +     ++++   D    I+ +  + DREE  + K  +  +D      +SK++V   + DRNDN+P      F  V H   + N S  +M VG  +A+    DKD   N+ +   + G+    FQ+      DS+ K    + T   LD E  +++ + I+A D G+P  + T  + ++V D+ND  P FS SLYE   +E    G  V  V A D D   N ++ Y II+D  +K  +           I  + GE+     LDRE +  Y   V A D G P S   T TV + ++D NDN P F   N   FS+         +G V  +D D GEN+ +   +E  N      F  QN    + S +S    K+  +   + A D G PP+ S  + +TI V+ ++
Sbjct:  127 IEGRIEIQDENDNTPQFP-SPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQ-RDTYDLSIKVIDGGTPPRYSS---ALLRITITDTNDNVPKF-----ERSHYEGEMA--ENTPVGQSVL-QVKANDDDLGANGQVTYSF-HQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVS-EDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVP--FQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLF----------DINPNTGEVRVMNQLDREYKERYEFHVEAADKGVP-SLKGTATVVVRVLDRNDNDPKFML-NGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPEN----GKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSY-VGITINVLDEN 684          

HSP 3 Score: 119.783 bits (299), Expect = 7.365e-27
Identity = 161/659 (24.43%), Postives = 272/659 (41.27%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLE----SRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYA--------NKLSENANIGFVALTVSAKDADYLAN--------GKITYRIEDQKASE------YFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG-GRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKP---EFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES-VGYEIGTVEAVDLDFG--------ENSEIVY 2443
            P Y S  L + I D NDN P + +       + +EG   E     +++   KA D D+  N Q+ Y       +    V ++ +    +  I++     +DRE+V + +  + A DNG   ++    + I + D+NDN P   R + +           +SE+  +G     V   D D   N        G + +++    AS+      YF       +     +DY+  +K ++  ++A+D        T   +V   V D ND  P          P   E    E     + VL  +   D D G   +++   ++++    L  ++P+  E +++     DRE K   +  +   D+   +   + ++V ++LDRNDN PKF    + F VLEN   P   VG V  +D D   N+ ++  +      F   + +G + +    DRE+   +   + A DGGDPP++    +TI V+D ND  P   + S S Y+F +       T V  V A D D   N ++ Y I     +    F+ SS+          GEI       R+    + L V   D G P+ +T T  V I +             N+T+ ++   ES VG+ + T  ++D+D          +NS IVY
Sbjct:  234 PRYSSALLRITITDTNDNVPKFER-------SHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFH----QPSPNVQRLLHIDHNTGIIQVK--GSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSI-RIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYF-------LQTTTPLDYER-IKEYRIEIVAVDSGNPALSSTNSLKV--QVTDMNDNAPVF-------SPSLYEVDFAEENQPGDKVL-DVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMN--QLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMP-PLSPVGMVTVIDADKGENAHVQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKF-LQPLTSPDTRVEKVDAEDIDTGLNAELVYSITGG--NPHGLFRISST---------DGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHT-TALVHIFV-------------NETISNVTLVESLVGHSLYT--SLDMDIAGDPSYERVQNSNIVY 829          
BLAST of Protocadherin 1b vs. Ensembl Cavefish
Match: ENSAMXT00000036470.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10716691:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000036470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 240.736 bits (613), Expect = 2.965e-65
Identity = 215/765 (28.10%), Postives = 355/765 (46.41%), Query Frame = 2
Query:  362 IFEEPKNGTEIEVLTKYLKNNIVSV-STSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQ---KASEYFNI----GNNGNI----MVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQV-SPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK--SIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQV----LDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQT-----TESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKP 2575
            + EE K GT +  + K L  N+  + +  +RI    K      +  +T  + V +RIDRE+LC     C + +            + V I+DINDNAP +P   ++++ TE      E  T+ +  A DPD   N+  +Y L      + N  + +   +   S  +EL+  K +DRE   V  LIL A D G P  +G+ E+ I ILD NDN P+F ++ Y   K+ ENA  G   L++SA D D   N +ITY I  Q    A+EYF++    G   NI    +++K +D +      Q  + A+DG      ++G  ++ I VID ND  P     + K        +++EN +    V+  +   D D G    +  SL ++ K +   + + +    +I      DRE+ +  ++    +D+  +  +    ++ ++LD ND+ P  +       +   +     VG +   D D  +N ++  ++ G     F + +S K Y   V    LDRE+  +++VTILA D G PP + + ++ +++ D+ND  P FS  +  F + EN+  G  + TVTA D D+  N ++ Y +I+ +    S+       P        G+I +K   + E+   +   V A D+G P   +S  TV + I+D NDN P          S+ T     +   GY +G V A+D D G N+ + Y I E      F   + + ++     +S  D   H LVI+ CD G+P
Sbjct:   34 VSEEVKAGTVVGNVAKDLNINVQDLEARMFRIVSSRK---SFDVSLKTGALFVTDRIDREALCSTIKKCSMHIEAMAQNPLKLFRIEVHIMDINDNAPLFPVSKQILNITELSAVG-EKFTLPL--AEDPDTGSNAVKNYKL------SPNEYFSLNVQNGEDSGSVELVLQKALDRETQSVIHLILTAIDGGKPPLSGTTEIAILILDVNDNSPVFSQSLYKV-KVKENAAFGTKVLSLSATDLDEGLNSEITYAIIRQGTLSANEYFSLNVQSGGEQNISPQLVLQKALDREKQAT-VQLILTALDGG--RPHRSGTLDLSINVIDVNDNTPAFSKEMYKV-------SVLENTLPGTPVI-KLNATDLDAGLNGEIVYSLISHGKEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGP--FALQASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVS------GDIYSKQSFNYEEVKSFQFKVQATDSGAP-PLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPKGNNLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEP 765          

HSP 2 Score: 134.806 bits (338), Expect = 1.507e-31
Identity = 108/358 (30.17%), Postives = 179/358 (50.00%), Query Frame = 2
Query: 1625 IVFQILDRNDNSPKFTRVFH-FRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-------SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRII-SDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGNPYGY---FSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPP 2650
            I   I+D NDN+P F        + E ++V   F    +A D D   N+   +++  NE  +F ++        S ++  ++ LDRE     ++ + A DGG PP +GT  + I ++D+ND  P FS SLY+  + ENA  GT V +++A D D   N+++ Y II     S   YF  +     +  ++   ++V +  LDREKQ+   L + A+D G P+  + T  + IN+IDVNDN P F   +K ++ +   E+   G  +  + A DLD G N EIVY +       +   F+ N+   ++ +   L ++D    +L   A DKG  P+ S+      KV+ + + + + PP
Sbjct:  116 IEVHIMDINDNAPLFPVSKQILNITELSAVGEKFTLP-LAEDPDTGSNAVKNYKLSPNE--YFSLNVQNGEDSGSVELVLQKALDRETQSVIHLILTAIDGGKPPLSGTTEIAILILDVNDNSPVFSQSLYKVKVKENAAFGTKVLSLSATDLDEGLNSEITYAIIRQGTLSANEYFSLNVQSGGE--QNISPQLVLQKALDREKQATVQLILTALDGGRPHR-SGTLDLSINVIDVNDNTPAF---SKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASH-----CKVLIEVLDVNDSPP 459          

HSP 3 Score: 85.8853 bits (211), Expect = 1.678e-16
Identity = 113/466 (24.25%), Postives = 201/466 (43.13%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI----GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSD---KEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQ--ILDRNDNSPKFTRVF-HFRVLENASVP-----NMFVGEVMAVDKDAERNSKIEFQII---GNEEHFFQI-DSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVV 1951
            L++ ++D+NDN P++ ++   VS  E   N L    +    A D D   N +I Y L     +    ++ I      S   E+     +DRE    +EL   A+D GS  R    +++I++LD ND+ P+        + + E+A  G     ++  D D   NG+++ ++   K +  F +     N  +++V   +D +  +  +  ++LA D G P     +    + + + D ND  P     VT      N P        S +++A +  +DPD      +  SL N   M    +S  D       I +  +F+ EE    +  +   D      S ++     I+D NDN P     +     L   ++P       FVG+V A+D D+  N+ + + I    GN  + F+I  SSG++ TK+ +   + +   + I   D G+P  + T  V+++VV
Sbjct:  339 LSINVIDVNDNTPAFSKEMYKVSVLE---NTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKEKWADIFAIN-----SITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVI-SVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKV---KGTGPFALQASYKNYYSLVVNGPLDRE-DMPQYSVTILATDKGTPP---LSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSP--------SGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPKGN--NLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSAT--VSVDVV 776          
BLAST of Protocadherin 1b vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 238.424 bits (607), Expect = 3.018e-64
Identity = 210/710 (29.58%), Postives = 335/710 (47.18%), Query Frame = 2
Query:  506 VVTVKNRIDRESLCPN----QINCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI----GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP--TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
            + T  NRIDRE LCP        C   +   I P+   + + ++I+  D NDNAP +P  S V++ +  E   + SR   I  A DPD+  NS   Y L   NG++  G+  I       +  +L+  + +DREQ D Y + +  ED GSP+++ +  L + + D NDN P+F  ++   + + E++ +G   + + A DAD  AN +I Y    Q +     +       G I V++ +D +      + SVLA DG+    R T    V I V D ND  P I +        TN   ++  +   N+ +A I V D D      V C +  +    L+ V   D ++ +   A  D E        I+  D    + +++ + ++   D NDN P FT+ V    V EN    ++++  + A D+D+ RN++I +Q +G    FF +D  +G +   +V DRE+ E+F  T+ A+D G         V + ++D ND  P+F+ + ++F +SEN    ++VG +T  D D   N  +   I++D   F  + Y                G I +    DRE+QS Y   V A+D+GHP   +S   V IN+IDVNDN P   +  SN +   +  +   G  +  V AVD D G N+E+ Y I  GN  G F  +     + L    ++ D   H+LV++  D G P
Sbjct:   85 IFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFP--SPVINISIPENTLINSR-FAIPSATDPDMGPNSVYKYELV--NGQSAFGL-DIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVH-IPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREE-TANHKLSVLASDGSSSSARAT----VTINVTDVNDNAPNIDLRYIISP--TNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVY--DNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKR-DLYLTTITATDEDSGRNAEIVYQ-LGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPY---------------TGVIKSNVSFDREQQSSYTFDVRAVDSGHP-PCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          
BLAST of Protocadherin 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.72 bits (587), Expect = 6.945e-63
Identity = 203/749 (27.10%), Postives = 340/749 (45.39%), Query Frame = 2
Query:  509 VTVKNRIDRESLCPNQINCDIMLRFF--ISPSYVSKS--------LNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNG-KTDNGVWKI--------------KYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-----GNNGNIMVR--KNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK--SIVFQILDRNDNSPKF---------TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEF---QIIGNEE--HFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEF------SLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKT--SNKTVFSIQTTESVGYEIG-TVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKG 2569
            ++V  R+DRE+LC  + +      F   +  + ++K         L+V++L  DIND+AP++      VS +E E      R + + +A DPD   NS   Y +   +G     G + +                D     R  L   + +DRE V  YEL+L  ED G+PK +GS+ L I ++D NDN P+F        +++E++ +G   + + A D D   NG I Y    +  S          G  G + VR  + +D +  +   +  V+A DG   +  ++    V + + D+ND  P   V   + + L +    I   + S + +  I V DPD G    V   L       L   SP+  +F +      D EE     V +L  D+     SK  +++  ++D NDN+P F           V+   + EN     + +  ++A D D+  N  I F   ++ G E     F ++  +G++     LDRE+  ++ +++ A DGG P +    +V + V+D ND  P F      +  +Y+F + E   +GT VGTV+  D D   N ++   ++  R +   +   +   P  ++R       T  +LDRE +  Y L+V A+D+G P + +++  V I + D NDN P   +  +N T   ++T    G  +G +V A D+D G+N   +Y+I  GNP G F  N  +  L L   +S  D+  H+LV+   D+G
Sbjct:   83 LSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEA---VGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRET-MPVHRLVVVARDGG--QLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAEL--ASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVL-NLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLV--REAGPDWIGGAGDTPGGVVR-------TLVVLDREDRVQYELSVRAVDSGRP-ALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 104.76 bits (260), Expect = 5.177e-23
Identity = 127/509 (24.95%), Postives = 221/509 (43.42%), Query Frame = 2
Query:  479 CLHIDPETHVVTVKN--RIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNK----LESRT-IHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIF-------DRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIED----QKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL---SNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKS--IVFQILDRNDNSPKFTRV------FHFRVLENASVPNMFVG-EVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGG 1906
             LH+D  T +VTV+N  ++DRE++  +++         +S S  S ++ VE+ D NDNAP +   +    +    G K    L S T + +    DPD+  +  +D  L+   G       K+++   T+R        ++D E+   Y + ++A D G+PK +  L LII ++D NDN P+F            Y   L EN   G V L + A DAD   NG IT+ + +    +  +E F++    G + +   +D +  ++ ++ SV A DG   +  +     V + V+DEND  P  +      + +      +E E    + +  +   D D G    V+ +L   +  D +     +P      +  +   DRE++   ++ +   D      S S  +   + D NDN+P  T         H R    A    M VG  V A D DA  N +  ++II GN +  F +++ SG +   + +   +     + +  +D G
Sbjct:  324 ALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRS-ASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTR--------LLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMR-YELSVEACDGGSPQ--RKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQ--FFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGV---VRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPA---GMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          
BLAST of Protocadherin 1b vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 216.853 bits (551), Expect = 3.656e-58
Identity = 203/729 (27.85%), Postives = 337/729 (46.23%), Query Frame = 2
Query:  479 CLHIDPET-HVVTVKNRIDRESLCPNQI---NCDIMLRFFISP-------SYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPI-KVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS--------EYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRD---PLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNND-KMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK--SIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPT--FKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKG 2569
             + ++P T  +     ++DRE+LC  Q     C + ++  + P         +   +NVE  DINDNAP++      VS  E   N    +   I  A DPD   N    Y L   +  T +       +++   ++  + + K +DRE+  +YE+ L A D GSP  +GS  L I + D NDN P+FD+A+    ++ EN+ +G   + + A D D  +N ++ YR+                F +  N  ++    +        ++  +LA D  PE    T    V +  +++N    EI      RD   P+     I E   + N  +A I V DPD G    V+C + N +   +L++++    ++ +      D E K+   V I   D    + S+  S+  ++LD NDN+P FT   +   V EN  +    +  V A D+D ++N+++ + +  +    F +D  +G +   + LDRE+   ++ TILAKD G P   G   V + V+D+ND +P FSL+ ++F ++EN    ++VG VT  D D   N +++  I+      ++   +S      MIR + G        DRE++ +Y+L V A D G P   +ST  V I+++D+NDN P      SN T   +      G  +  V AVD D   N+E+ Y I  GNP+  F  +     + L   L++     H+LV+   D G
Sbjct:   85 LVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVE--DINDNAPAFAAPVLTVSVPE---NAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNV-EIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEI------RDIVAPVNGVIYISEASHV-NLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLT-YPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLI-TVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSIL----GTDNRQLFSIDPESGMIRSNVG-------FDREQRHYYVLEVQATDGGEP-VRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          
BLAST of Protocadherin 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 6.728e-58
Identity = 214/783 (27.33%), Postives = 353/783 (45.08%), Query Frame = 2
Query:  368 EEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDY-FLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESY-FQYSSSLPFQMIRHDRGEIVTKYLLDREK------QSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVG--YEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDS 2674
            E    G+ ++ +T    ++ ++    Y I  GN L     +D  T +VT   ++DRE      +N     +    P     SL V +LD+ND  P + Q   V +  E   N L    +    A D D+ EN  + Y F  D   +        + DS T +   +  +K +DRE+++ Y L++ A+D GSP    + ++ + + D NDN P+F   +Y+A+ L EN   G    TV+A D D  ANG + Y++    A+ +      G +  R ++D +     +Q  V A+DG     R      V I V D  D  P        RD  +    + EN V   +++  +     D    ++    +S + +          + F   AI   DREE++  ++ ++           S+   + D N+++P F R  +   + E+  V + F   V A DKD+ +N +++++I  GN    F I   G++Y +  LDRE  E++++T+ A D G  P + +  V + V+D+ND KP F+ S Y F   E   +G+ VG V A D D  +N  + Y      F K    F+  S         + G I +  + DRE        + +  +VVA D G P       TV++ + DVNDN P F    K+V+    +ES     ++  V A D+D G N  + Y I EGN  G F+ +    ++ L   L +++   + LV+SA D G     ++PL  +  V  Q +   +E  NP  F++S
Sbjct:  352 EGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL-GWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQG-AQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVE---NSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYRE---MFRLDSLTGK---VTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASIL-ENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAV-YQLQVTALDGG--HLRARSPAIVTITVADAQDTPPTF-----ARDDYSF--VVFEN-VAPGTLVGSVSASTLDLNA-NVTYLIVSGDQRGSFSIEWSGGRIFTANAI---DREEQAFYQLRVVANSGGV-AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFF-SVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTY-----SFEKPQVNFELDS---------ETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA---KSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSG-----TSPLAASCTVAVQVL---DENDNPPRFTES 1080          

HSP 2 Score: 200.675 bits (509), Expect = 2.871e-52
Identity = 194/691 (28.08%), Postives = 322/691 (46.60%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRR--IELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKD---PDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQA---YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDR--GEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPLWVTIKVV 2617
            P+Y ++ + V + D+NDNAPS+P+    V    F+ +    R + +D A D DV  N    +  K  +G  +    ++      ++R  + L     +DRE    Y L + AED GSP+R G L++ + + D NDN P F++  Y A+ ++E++ +G      + +D  +   G +    + +           G +  R+ +D++A  + +  S+ A DG       +G    VI ++D ND  P I  V++    P     A ++      +V A + V D   P   G   VS  +  N++      +P     ++L +A+  DRE   M  + IL  D       +A+ S+V  + D ND++P+F    +   L   +    +V +V A+D D+  N+K+ + I+ GN+  +F +D S+G + T   +DRE      + I A+D G  PKT    +T+ ++D+ND  P F+ + Y  +  EN+  G  V +V+A D DL  N  ++Y      F  +   QY      +M R D   G++ T   LDRE+   Y L V A D G P    ST  V + + D+NDN P F    +   SI   E  G  + TV A D D G N  + YQ+  G+    F  N     +     L +++   ++L ++A D G   +  +P  VTI V 
Sbjct:    3 PTYPTE-VRVVVGDVNDNAPSFPEPG--VMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEG---RLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRAS-VAEDSPVG-----AALRDLLHRGRGPLAVPFDPK----------TGMVSTRQPLDFEA-RRQYTLSLRAADGGNPPL--SGRATAVIQLLDVNDNDPAIRFVYL----PPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSI-VGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY-----NFDPDMPAQYR-----EMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSP-PLGSTAKVTVVVGDLNDNHPVFYPV-QYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGD-AARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGH-LRARSPAIVTITVA 649          

HSP 3 Score: 197.593 bits (501), Expect = 2.714e-51
Identity = 200/744 (26.88%), Postives = 330/744 (44.35%), Query Frame = 2
Query:  362 IFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDA-----GVKGFQFSVLAIDGA---PEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDRE-KQSHYLLTVVAIDNGHP--NSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDH 2539
            +FE    GT +  ++    +  ++ + +Y I  G++      I+     +   N IDRE     Q      LR   +   V+   +V +L  D+N++AP + + S  VS  E E   + SR   + +A D D  +N ++ Y + + NG    G++    D     R EL      DRE  + Y L + A D G    + S+ + + +LD NDN P+F+ + Y  +   E   +G +   V A DAD  +NG +TY  E  + +   +    G I   +  D +A     G   F FSV+A DG    P + R T    V + V D ND  P+    V +        A +     + + L  +   D D G    +  +++  ++     V  S    QI  + + DREE +   + +   D   +   AS ++  Q+LD NDN P+FT  +     LE+  V  + +  + A D+D   +  + + I+ GN    F ID S+G ++  + LD E    + + + A+DGG PP++   ++ + V D ND  P F       SI EN  IGT V TVTA D D   N ++ Y  I+ +F   ++F          I  + GEI T   +DRE     + +TV A D   P     ++   V + + D NDN P F T    +       + G  +GT++A D D  EN+ + Y +  G+    F  + +   +  ++ L ++  H
Sbjct:  667 VFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQR-GSFSIEWSGGRIFTANAIDREEQAFYQ------LRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDE--PVNSRFFSV-RATDKDSGKNGEVKYEIGEGNGGEKFGIFP---DGQLYVRYEL------DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFH-FCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELD-SETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRAT----VQVFVQDVNDNPPQFAKSVYQ--------ASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTG--QITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLI-TLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYS-IARQFPPGAHF---------TIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVD-GLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRESGH 1361          

HSP 4 Score: 170.244 bits (430), Expect = 6.922e-43
Identity = 183/666 (27.48%), Postives = 287/666 (43.09%), Query Frame = 2
Query:  599 YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKD--RNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGP----IFDRAKYYANKLSENANIGFVALTVSAKDADY-LANGKITYRIEDQKASEYFNIGNNGN-----IMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL-SNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQ----IIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD 2533
            Y    +NV + D NDN P++ +                        A+   V E+S +   L+D    G+   G   + +D  T       P+    R Q   Y L L A D G+P  +G    +IQ+LD NDN P    ++      +  + E+A  G VA  V+  DAD   ANG+++  I       +F +   G      + V   +D +  +  +  ++LA D G P    ++    +V+ V D ND  P   +           PA         S +  +   D D G    +  S+ S ND   L   S  +    +      DRE  S   ++I  +DQ     TA  S+   +LD ND  P FT+  +       S+P +FV  V A D D   N  + +     +       F++DS +GK+ T + LDREE E++ + + A+D G PP   T  VT+ V D+ND  P F    Y  SI EN   GT+V TVTA D D  AN  ++Y++ +   ++   FQ ++           G + T+  LDRE+++ Y L V A+D GH  +  S   V I + D  D  PTF   + + F +    + G  +G+V A  LD   N+ + Y I  G+  G FS      ++   + + +++
Sbjct:  117 YGRLQVNVTVQDANDNPPAFEK-----------------------PAYRASVAEDSPVGAALRDLLHRGR---GPLAVPFDPKTGMVSTRQPLDFEARRQ---YTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRER-IPMYNLTILASDNGKP--VARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPA--------GSYVKDVTAMDADSGLNAKLRYSIVSGND---LGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR---FQVNAVT---------GAVSTRVSLDREERAVYQLQVTALDGGHLRAR-SPAIVTITVADAQDTPPTFARDDYS-FVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREE 723          

HSP 5 Score: 165.236 bits (417), Expect = 2.267e-41
Identity = 184/689 (26.71%), Postives = 292/689 (42.38%), Query Frame = 2
Query:  584 FISPSYVS-KSLNVEILDINDNAPSW--PQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIG----FVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNN-----GNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK-----SIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHF----------FQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSV-LSKQDDHKLVISACD 2563
            FI P   S   + + + D+NDN P +  P+        E E N  E   I    A D D  +N+ + Y +         G + +   S       L   + +DRE+   Y L + A D           L + + D NDN P F R  Y  +   + A  G     V  TV A DAD    G++TY +   + S++ +         G + V + +D ++    +     A DG            + + V+D ND  P +     + D L  E   +  +    + L  I   D D G    +  S+S+ D      V     + Q+      DRE +S   + +   D+A +  ++      +   + D NDN+P FT        E++ V    V  V AVD D+ RNS +E+ +  + E            F +++ +G++   + LDRE  + + +T+LA D G PP T T  + + V D ND  P F    YE +I+E+   GT V  ++A D D  AN +++Y I S   + +  F+    L         G +     LDRE+ + Y L V A D G P + + T +V++ + DVND  P F+ S  TV + + T+     I  V A D D G + ++ Y    GN  G FS +      +L S+    Q  H L+I+A D
Sbjct: 1491 FIRPPMSSFNQVEISVEDVNDNPPVFAVPEME-----LEVEENTGEGEVIFTLSATDADQGQNALVTYSVL----SGSEGAFVVDAASGV-----LRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRAC-YVLRARATDGG----GLAATARLYVNVLDANDNAPSV-----QNDSLAAE---VPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVG---NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPV-GAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--FRLDPVL---------GTLAVARPLDRERTASYELAVRARDGGGP-ARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 6 Score: 114.775 bits (286), Expect = 7.218e-26
Identity = 106/379 (27.97%), Postives = 171/379 (45.12%), Query Frame = 2
Query: 1547 FDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTR-VFHFRVLENAS----VPNMFVGEVMAVDKDAERNSKIEFQIIGNEEH------FFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGH--PNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIE---------EGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNP-LWVTI 2608
             DREE++   + +   D  + T ++ +   + D NDNSP+F+R  + F V E+A+         +G V+A D D+    ++ + +  +E+       F     +G +   + LDRE    + +   A DGG      T  + + V+D ND  P          + E+A  GTS+  ++A D D   N ++++ I S     E  F   +           G++     LDRE+QS Y L V   D     P   +S   V + + DVNDN P F TS ++  + + +  VG  + TV+AVD D G NS + Y +           G   G F+ NT   ++ L   L ++    + L + A DKG+PP  S   L VT+
Sbjct: 1578 LDREERASYLLTVRASDGTHATDAR-LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSG--DPEGRFAVGND----------GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSP-VGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTV 1939          
BLAST of Protocadherin 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 3.854e-48
Identity = 187/712 (26.26%), Postives = 316/712 (44.38%), Query Frame = 2
Query:  368 EEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKP---EIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL-SNNDKMRLEQVSPSDKEFQIL---------AIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG 2458
            E+   GT I V+    +++  +   SY +  G  L +   +DP++  V+V   +D E     ++  +     F  P      L V++LDINDNAP +          E        RTI +  A D D   N Q+DY + D N      V+++  +S      E+  +  +DRE V  YEL + A D GSP +  +++++I + D+NDN P F   + ++  + E+A +GF  L VS  DAD   N  IT+ + D   S  F+I  + G I V + ++ +    G+   V A D A      T   +V I+V D ND  P   +   ++   +P   E           +++A +   D D G    V   + S  +  R+ + S      + L         + AN ++    +  +D   + +   ++  ++   I+  N N+P+F R  +   +         + ++ AVD D + N +I + ++ GN    F +D+ G ++ +  L  +    F+VT+ A+D G PP +      I V + N + P F+    E S+ EN   G+S+  VTA D D   N  + Y I S   S    F  S +          G+++    LD E +  Y L+V A D G   + T  + V I++ DVNDN P    S+      +   S G  +  ++AVD D   N+  +Y +++G
Sbjct:  243 EDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGF-PPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPE----NTPPRTIVVLTAVDKDSGINGQVDYSIIDGN---IGNVFRVNPNSG-----EIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF--TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDP--SLPFSIHPSTGEITVSRRLNRE-DRSGYAVKVRASDPA-----WTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGE-----------ALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMD---RGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGS--GLFDISRA---------SGDVLLVGELDYETEKLYNLSVCAADGGW-QAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPS-GTTVLVMDAVDADSPSNAVTMYSLDDG 902          

HSP 2 Score: 186.037 bits (471), Expect = 1.114e-47
Identity = 187/714 (26.19%), Postives = 310/714 (43.42%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTE-FEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELM----PIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGA--PEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVL-ENASVPNMFVGEVM-AVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSY-TSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGEN-SEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPK 2581
            I P T  +TV  R++RE    ++    + +R       VS  + + + D+NDNAP + Q +  + F E  EG  L +R      A D D   N Q+ +F++    +T+N  +++  DS     +  +    P        ++ Y  ++ A D G P  +    + I I+  N N P F R +Y +  ++     G   L +SA D D   NG+I Y +    AS  F++   G + +R ++  DAG   F  +V A D    P   R T     +I V +EN   P          PL  E ++ EN    +S LA +   D D G    +  S+++ D   L  +S +  +  +L +   D E + +  + +   D  +   T    +   + D NDN P      ++ V+ ENA  P+     VM AVD D+  N+   + +   E   F ++  +G + T+  LD E  + + +T+ A +  D     T  V +++  +N++ P F    Y F +SE+A +G  VG+V A DRD   +  + Y +  +  SK           F +  H  GEI+    LDRE+++   L V+A + G    +      V + I D ND  P   +S      +    SVG  +  V A D D         + I+ GN    FS N     +++ S L ++    + L + A D G+PP 
Sbjct:  487 IHPSTGEITVSRRLNRE----DRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARV----SASDADDGANGQVFFFMRS---QTEN--FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERY-STPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSI-FSVTVEARDRGRPPLSSRAT----AIISVTEENQYAPRF-----AHPPL--ELSLPENHPAGSS-LARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGD--VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENA--PSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG----------FSVNEHT-GEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND--PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPA 1156          

HSP 3 Score: 147.517 bits (371), Expect = 6.794e-36
Identity = 148/579 (25.56%), Postives = 247/579 (42.66%), Query Frame = 2
Query:  872 KVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETE---------KFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKG 2569
            + +D E    YEL++ A D+G P  +  L+L + +LD NDN P F  ++++A K+ EN     + + ++A D D   NG++ Y I D      F +  N+G I     +D +  V  ++ +V A D G+P ++      +V+I V DEND  P      +          + E+  +   VL  +   D D G    ++ SL   D      + PS  E  I      +RE++S   V +   D A+ T S  +   + D NDN+P+F +  ++      S     V  V A D D   N ++ F +    E+F     SG++++ + L   +           K++  + A D G PP +    VTI +V  N   P F    Y   ++     GT +  ++A+D D   N ++ Y ++    S+   F   +           G +  +  L  +  S + +TV A D G P   +S  T  I++ + N   P F        S+      G  +  V A D D G N  IVY I  G+  G F  +  +  ++L   L  + +  + L + A D G
Sbjct:  292 RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWA-KVPENTPPRTI-VVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRE-NVASYELTVKATDRGSPTQHCTV---KVLISVTDENDNSPRFTQIFSAH--------VREDAAVGFPVL-RVSTLDADEGPNAAITFSLL--DPSLPFSIHPSTGE--ITVSRRLNREDRSGYAVKVRASDPAW-TVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRR--FDVDAG----------GFLHLRASLAGDAGSIFSVTVEARDRGRP-PLSSRATAIISVTEENQYAPRFAHP-PLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGG 836          

HSP 4 Score: 142.895 bits (359), Expect = 1.941e-34
Identity = 146/567 (25.75%), Postives = 247/567 (43.56%), Query Frame = 2
Query:  932 GSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEP--AIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT---RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII--GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTE--SVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLW 2599
            G P+ TG+  + + + D+NDN P F  A+  A  + E+A IG     V+A DAD   N  I+YR+  +    +F++  + G I+   ++D + G + +   V A+DG P     +    +V+ V D ND  P  +          N P  A   +   + + +  +  +D D G    +  SLS +       V P              R++ ++  V +        +A  ++  +  D  +  P+F    R F FR       P   +  V A  + + R   + + +   GN    F +D  SG++   + LD E    + + + A+D G PP +    + ++V+DIND  PEFS S +   + EN    T V  +TA+D+D   N ++ Y II         F+         +  + GEI +   LDRE  + Y LTV A D G P  +  T  V I++ D NDN P F      +FS    E  +VG+ +  V  +D D G N+ I + + +  P   FS +    ++ ++  L+++D     +         + S+P W
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRA-AVPEDAPIGSDVALVNATDADAGLNAIISYRL--RGGDGHFSVNPSTGQIITTASLDRE-GRESYVLEVTALDGGPTPGLSS-SATLVVAVTDVNDHTPRFL----------NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGF-SVDPRRGVIHAARALQGPRDDLTL-TVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFR---EDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSIIDGNIGN--VFR---------VNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHC-TVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD--PSLPFSIHPSTGEITVSRRLNREDRSGYAVKV-------RASDPAW 519          

HSP 5 Score: 136.346 bits (342), Expect = 2.043e-32
Identity = 162/639 (25.35%), Postives = 281/639 (43.97%), Query Frame = 2
Query:  620 VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKD----QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII--GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPAN-TKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGE--NSEIVYQIEEGNPYGYFSFNTQNKKLI 2506
            + + + N  AP +      +S  E   N     ++    A D D   N  I Y +   +G   +G++ I   S      +++ +  +D E   +Y L + A D G   +T    + I + D NDN P+ + + YY   + ENA  G   L + A DAD  +N    Y ++D +A  +      G +  +  +DY+   + ++ +V A +  P+ +  +   +V + +   N+  P  +    + + + +E A +   V   SV A     D D G    V   L    + R +  S ++   +I+  +  DRE ++   + ++ K+    + ++     +   I D ND     + ++H RV E ASV    VG V A D D+    +    +I  GN    F I++ +G +     LDRE    +N+T++A D G+PP TGT +V + + D+ND  P    S  +  ++EN   G +V  + A D DLP N     ++++    +   YF  SSS          G + T   +DRE++  + L V   D G P   TST T+ ++++D NDN P+     +   +   +   G  IG V   D D  +  N ++        P+  FSF     +LI
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPE---NHPAGSSLARVTATDTDAGVNGAIVYSIASGDG---SGLFDISRASG-----DVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYP-VIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYET-KQTYELTVRAFN-YPDTFHYS-TAQVHVQITGVNEYFPRFVQR--EYNFVVSESAPVGAPV--GSVFA----TDRDAGIDGTVFYMLFG--ESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVG-VSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK--VTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSS----------GLLKTARPIDREQKPEFHLPVAIADAGSP-PLTSTVTLHLSVLDQNDN-PSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDLTS-----GPFNVFSFQPNTCRLI 1336          

HSP 6 Score: 121.324 bits (303), Expect = 7.322e-28
Identity = 174/723 (24.07%), Postives = 291/723 (40.25%), Query Frame = 2
Query:  605 SKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAF----DPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-SPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGV-----KGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKR----------DPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMR-LEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQI--LDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE--IGTVEAVDLDFGENSEIVY----------------QIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPN 2641
            + ++ V + D NDN P +          E      E   I  D A     D D   N+ I Y L+  +G           + ST    +++    +DRE  + Y L + A D G +P  + S  L++ + D ND+ P F              N  +VA   S+  A     G   + +  + A    + G NG++    +    AG      +G   +  A+ G  ++   T      + V D        +  VT R           P     +  E++    ++   +  +     G   VS  L++   +  +  V P   E  +      D E +   ++ +  +D  +   S  +  ++  LD NDN+P+F+   F  +V EN   P   +  + AVDKD+  N ++++ II GN  + F+++ +SG++ +   LDRE    + +T+ A D G P +  T  V I V D ND  P F+  ++   + E+A +G  V  V+ +D D   N  + + ++              SLPF  I    GEI     L+RE +S Y + V A D     ++T +T V I + DVNDN P F    +T + I+  E    E  +  V A D D G N ++ +                +I    P  Y           LN        +  V++A D+G+PP  S+        V  +I++PN
Sbjct:    9 TGTVTVLVEDENDNLPRF-------GAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGH-------FSVNPSTG---QIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF-------------LNAPYVAYAPSSAPA-----GTAVFAVTARDA----DAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLT------VRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITV-VAARSSRRAG--PVSYHLASGGNLGDVFAVDPQSGEVSVHRA--LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPEN--TPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT-QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD------------PSLPFS-IHPSTGEITVSRRLNREDRSGYAVKVRASDP----AWTVSTDVTIVVDDVNDNAPRF---GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNK-------YSFVVTAMDRGRPPLSSD------ATVTINIVVPN 645          

HSP 7 Score: 102.834 bits (255), Expect = 3.158e-22
Identity = 74/258 (28.68%), Postives = 121/258 (46.90%), Query Frame = 2
Query: 1904 GDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ---DDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFS 2668
            G+P  TGTG VT+ V D ND  P F  +    ++ E+A IG+ V  V A D D   N  + YR+       + +F  + S          G+I+T   LDRE +  Y+L V A+D G     +S+ T+ + + DVND+ P F  +    ++  ++   G  +  V A D D G N ++ + +      G   F+   ++ ++++  + Q   DD  L +   D G PP+ S    VT++  +     P   P P +FS
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL----RGGDGHFSVNPST---------GQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYA-PSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG---FSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPR-SAVTTVTVR-FRDAGEFPRFAPGPRSFS 240          
BLAST of Protocadherin 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.193 bits (474), Expect = 4.598e-48
Identity = 187/712 (26.26%), Postives = 316/712 (44.38%), Query Frame = 2
Query:  368 EEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKP---EIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL-SNNDKMRLEQVSPSDKEFQIL---------AIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG 2458
            E+   GT I V+    +++  +   SY +  G  L +   +DP++  V+V   +D E     ++  +     F  P      L V++LDINDNAP +          E        RTI +  A D D   N Q+DY + D N      V+++  +S      E+  +  +DRE V  YEL + A D GSP +  +++++I + D+NDN P F   + ++  + E+A +GF  L VS  DAD   N  IT+ + D   S  F+I  + G I V + ++ +    G+   V A D A      T   +V I+V D ND  P   +   ++   +P   E           +++A +   D D G    V   + S  +  R+ + S      + L         + AN ++    +  +D   + +   ++  ++   I+  N N+P+F R  +   +         + ++ AVD D + N +I + ++ GN    F +D+ G ++ +  L  +    F+VT+ A+D G PP +      I V + N + P F+    E S+ EN   G+S+  VTA D D   N  + Y I S   S    F  S +          G+++    LD E +  Y L+V A D G   + T  + V I++ DVNDN P    S+      +   S G  +  ++AVD D   N+  +Y +++G
Sbjct:  243 EDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGF-PPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPE----NTPPRTIVVLTAVDKDSGINGQVDYSIIDGN---IGNVFRVNPNSG-----EIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF--TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDP--SLPFSIHPSTGEITVSRRLNRE-DRSGYAVKVRASDPA-----WTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGE-----------ALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMD---RGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGS--GLFDISRA---------SGDVLLVGELDYETEKLYNLSVCAADGGW-QAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPS-GTTVLVMDAVDADSPSNAVTMYSLDDG 902          

HSP 2 Score: 185.652 bits (470), Expect = 1.364e-47
Identity = 187/714 (26.19%), Postives = 310/714 (43.42%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTE-FEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELM----PIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGA--PEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVL-ENASVPNMFVGEVM-AVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSY-TSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGEN-SEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPK 2581
            I P T  +TV  R++RE    ++    + +R       VS  + + + D+NDNAP + Q +  + F E  EG  L +R      A D D   N Q+ +F++    +T+N  +++  DS     +  +    P        ++ Y  ++ A D G P  +    + I I+  N N P F R +Y +  ++     G   L +SA D D   NG+I Y +    AS  F++   G + +R ++  DAG   F  +V A D    P   R T     +I V +EN   P          PL  E ++ EN    +S LA +   D D G    +  S+++ D   L  +S +  +  +L +   D E + +  + +   D  +   T    +   + D NDN P      ++ V+ ENA  P+     VM AVD D+  N+   + +   E   F ++  +G + T+  LD E  + + +T+ A +  D     T  V +++  +N++ P F    Y F +SE+A +G  VG+V A DRD   +  + Y +  +  SK           F +  H  GEI+    LDRE+++   L V+A + G    +      V + I D ND  P   +S      +    SVG  +  V A D D         + I+ GN    FS N     +++ S L ++    + L + A D G+PP 
Sbjct:  487 IHPSTGEITVSRRLNRE----DRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARV----SASDADDGANGQVFFFMRS---QTEN--FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERY-STPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSI-FSVTVEARDRGRPPLSSRAT----AIISVTEENQYAPRF-----AHPPL--ELSLPENHPAGSS-LARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGD--VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENA--PSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG----------FSVNEHT-GEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND--PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPA 1156          

HSP 3 Score: 147.517 bits (371), Expect = 7.441e-36
Identity = 148/579 (25.56%), Postives = 247/579 (42.66%), Query Frame = 2
Query:  872 KVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETE---------KFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKG 2569
            + +D E    YEL++ A D+G P  +  L+L + +LD NDN P F  ++++A K+ EN     + + ++A D D   NG++ Y I D      F +  N+G I     +D +  V  ++ +V A D G+P ++      +V+I V DEND  P      +          + E+  +   VL  +   D D G    ++ SL   D      + PS  E  I      +RE++S   V +   D A+ T S  +   + D NDN+P+F +  ++      S     V  V A D D   N ++ F +    E+F     SG++++ + L   +           K++  + A D G PP +    VTI +V  N   P F    Y   ++     GT +  ++A+D D   N ++ Y ++    S+   F   +           G +  +  L  +  S + +TV A D G P   +S  T  I++ + N   P F        S+      G  +  V A D D G N  IVY I  G+  G F  +  +  ++L   L  + +  + L + A D G
Sbjct:  292 RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWA-KVPENTPPRTI-VVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRE-NVASYELTVKATDRGSPTQHCTV---KVLISVTDENDNSPRFTQIFSAH--------VREDAAVGFPVL-RVSTLDADEGPNAAITFSLL--DPSLPFSIHPSTGE--ITVSRRLNREDRSGYAVKVRASDPAW-TVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRR--FDVDAG----------GFLHLRASLAGDAGSIFSVTVEARDRGRP-PLSSRATAIISVTEENQYAPRF-AHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGG 836          

HSP 4 Score: 142.895 bits (359), Expect = 2.073e-34
Identity = 146/567 (25.75%), Postives = 247/567 (43.56%), Query Frame = 2
Query:  932 GSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEP--AIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT---RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII--GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTE--SVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLW 2599
            G P+ TG+  + + + D+NDN P F  A+  A  + E+A IG     V+A DAD   N  I+YR+  +    +F++  + G I+   ++D + G + +   V A+DG P     +    +V+ V D ND  P  +          N P  A   +   + + +  +  +D D G    +  SLS +       V P              R++ ++  V +        +A  ++  +  D  +  P+F    R F FR       P   +  V A  + + R   + + +   GN    F +D  SG++   + LD E    + + + A+D G PP +    + ++V+DIND  PEFS S +   + EN    T V  +TA+D+D   N ++ Y II         F+         +  + GEI +   LDRE  + Y LTV A D G P  +  T  V I++ D NDN P F      +FS    E  +VG+ +  V  +D D G N+ I + + +  P   FS +    ++ ++  L+++D     +         + S+P W
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRA-AVPEDAPIGSDVALVNATDADAGLNAIISYRL--RGGDGHFSVNPSTGQIITTASLDRE-GRESYVLEVTALDGGPTPGLSS-SATLVVAVTDVNDHTPRFL----------NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGF-SVDPRRGVIHAARALQGPRDDLTL-TVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFR---EDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSIIDGNIGN--VFR---------VNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHC-TVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD--PSLPFSIHPSTGEITVSRRLNREDRSGYAVKV-------RASDPAW 519          

HSP 5 Score: 135.961 bits (341), Expect = 2.498e-32
Identity = 162/639 (25.35%), Postives = 281/639 (43.97%), Query Frame = 2
Query:  620 VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKD----QAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII--GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPAN-TKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGE--NSEIVYQIEEGNPYGYFSFNTQNKKLI 2506
            + + + N  AP +      +S  E   N     ++    A D D   N  I Y +   +G   +G++ I   S      +++ +  +D E   +Y L + A D G   +T    + I + D NDN P+ + + YY   + ENA  G   L + A DAD  +N    Y ++D +A  +      G +  +  +DY+   + ++ +V A +  P+ +  +   +V + +   N+  P  +    + + + +E A +   V   SV A     D D G    V   L    + R +  S ++   +I+  +  DRE ++   + ++ K+    + ++     +   I D ND     + ++H RV E ASV    VG V A D D+    +    +I  GN    F I++ +G +     LDRE    +N+T++A D G+PP TGT +V + + D+ND  P    S  +  ++EN   G +V  + A D DLP N     ++++    +   YF  SSS          G + T   +DRE++  + L V   D G P   TST T+ ++++D NDN P+     +   +   +   G  IG V   D D  +  N ++        P+  FSF     +LI
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPE---NHPAGSSLARVTATDTDAGVNGAIVYSIASGDG---SGLFDISRASG-----DVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYP-VIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYET-KQTYELTVRAFN-YPDTFHYS-TAQVHVQITGVNEYFPRFVQR--EYNFVVSESAPVGAPV--GSVFA----TDRDAGIDGTVFYMLFG--ESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVG-VSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK--VTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSS----------GLLKTARPIDREQKPEFHLPVAIADAGSP-PLTSTVTLHLSVLDQNDN-PSEARDVRVHVNYFGSPFPGGFIGDVRPRDPDISDRFNCDLTS-----GPFNVFSFQPNTCRLI 1336          

HSP 6 Score: 121.324 bits (303), Expect = 8.439e-28
Identity = 174/723 (24.07%), Postives = 291/723 (40.25%), Query Frame = 2
Query:  605 SKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAF----DPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNG-SPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGV-----KGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKR----------DPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMR-LEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQI--LDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYE--IGTVEAVDLDFGENSEIVY----------------QIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPN 2641
            + ++ V + D NDN P +          E      E   I  D A     D D   N+ I Y L+  +G           + ST    +++    +DRE  + Y L + A D G +P  + S  L++ + D ND+ P F              N  +VA   S+  A     G   + +  + A    + G NG++    +    AG      +G   +  A+ G  ++   T      + V D        +  VT R           P     +  E++    ++   +  +     G   VS  L++   +  +  V P   E  +      D E +   ++ +  +D  +   S  +  ++  LD NDN+P+F+   F  +V EN   P   +  + AVDKD+  N ++++ II GN  + F+++ +SG++ +   LDRE    + +T+ A D G P +  T  V I V D ND  P F+  ++   + E+A +G  V  V+ +D D   N  + + ++              SLPF  I    GEI     L+RE +S Y + V A D     ++T +T V I + DVNDN P F    +T + I+  E    E  +  V A D D G N ++ +                +I    P  Y           LN        +  V++A D+G+PP  S+        V  +I++PN
Sbjct:    9 TGTVTVLVEDENDNLPRF-------GAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGH-------FSVNPSTG---QIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF-------------LNAPYVAYAPSSAPA-----GTAVFAVTARDA----DAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLT------VRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITV-VAARSSRRAG--PVSYHLASGGNLGDVFAVDPQSGEVSVHRA--LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPEN--TPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT-QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD------------PSLPFS-IHPSTGEITVSRRLNREDRSGYAVKVRASDP----AWTVSTDVTIVVDDVNDNAPRF---GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNK-------YSFVVTAMDRGRPPLSSD------ATVTINIVVPN 645          

HSP 7 Score: 102.834 bits (255), Expect = 3.153e-22
Identity = 74/258 (28.68%), Postives = 121/258 (46.90%), Query Frame = 2
Query: 1904 GDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ---DDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFS 2668
            G+P  TGTG VT+ V D ND  P F  +    ++ E+A IG+ V  V A D D   N  + YR+       + +F  + S          G+I+T   LDRE +  Y+L V A+D G     +S+ T+ + + DVND+ P F  +    ++  ++   G  +  V A D D G N ++ + +      G   F+   ++ ++++  + Q   DD  L +   D G PP+ S    VT++  +     P   P P +FS
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL----RGGDGHFSVNPST---------GQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYA-PSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAG---FSVDPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPR-SAVTTVTVR-FRDAGEFPRFAPGPRSFS 240          
BLAST of Protocadherin 1b vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 241.506 bits (615), Expect = 6.094e-65
Identity = 218/703 (31.01%), Postives = 333/703 (47.37%), Query Frame = 2
Query:  500 THVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIH-IDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIE--DQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKS--IVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDH-----KLVISACDKG 2569
            T V++   RIDRE+    QI+  + LR  ++PS    S+ V++ DINDN P +P     +   E     ++  T + I+ A DPD   N  +DY +   +      +        T   + ++  K +DRE  D Y+L + A D G+P   G   + I ILD+ND+ P+F +  Y  + ++EN   G   L VSA D D  +NG I Y I+    +++  F++  + G I  ++N+D++     + F+V+A DG      K     V I V+D ND  P++   +T   P   + AI     + N+ +A+I V D D          ++N D     +V      F I      DRE      + +   D+   + S    ++  + D NDNSP FT   +   +   +    +V ++ A D D   N  + + I G N+  +FQ+D  SG + T + LDRE+     +TI A+D G  PKTG+  VT+ ++D ND KP F  S Y+ +ISE A IG +V  V+A D D   N ++ Y I S        F+         +    G + TK  LDRE +S Y  TV+A D+G P    S+  V++ I D+NDN P F    +   SI   E  G ++  V A D D G N+ I Y I  GN  G FS ++    +   S L+  D        L+ISA D G
Sbjct:   48 TGVISTTARIDRETTT--QIS--LQLRT-LNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRE----SMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTA--CPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGS-IAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVK-NSYTFNVIASDGGVPS--KNDLATVTINVLDTNDNSPQL--KITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYF-IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFE---------LNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQ-LMSSVKVELTISDINDNAPVFYPV-EYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVI---STLASLDHEVEEFFSLIISAKDGG 717          

HSP 2 Score: 211.46 bits (537), Expect = 1.860e-55
Identity = 222/738 (30.08%), Postives = 331/738 (44.85%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVS-KSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKL---ESRTIHIDKAF----DPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID--GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQIDSS-GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVIS--ACDKGKPPKCSNPLWVTIKVVKQHILIPNEPP 2650
            +D  T V+  K  +D E    N    +++      PS     ++ + +LD NDN+P    Q K+       G+K    E+  I+ + A+    D D N NSQ +  LK  NG  D G +K+++      +++    K +DRE V  Y L L   D G P R+    ++I + D NDN P F    Y AN +SE A  G   L ++A D D   NG ++Y I       +F +   +G +   K +D +  V     ++ A D   AP    KTG   V + +ID ND KP  +    K         I E   I  +VL  +   D D G    ++  +S++D         + +   +   +  DRE KS+    +L KD       +S  +   I D NDN+P F  V +F  +     P   + +V A D D   N+ I + IIG N    F IDSS G + T   LD E  E F++ I AKDGG+     T +V + V++  D  P F   +Y F++ EN   GT VG V A  +D   N  + Y I+S      + F   S+     I  D         +DRE+++ YLL V+A   G     ++  TV I ++D NDN P F TS+  +  I  T  VG  +    AVDLD G+N  + YQ+   N  G    N+ +  + L   L+  D+ +  +   A D G PP+ S    +TI +     L  N PP
Sbjct:  258 LDSSTGVIRTKQNLDFE--VKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSP----QLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTE--LKITNGD-DEGCFKVEFLGFYFIQLQ----KPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTAN-ISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQ-VSSVTITITAQDHGSAP----KTGSTTVTVTIIDGNDNKPRFMKSSYKG-------TISEGASIGATVL-QVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSG--DPTNLFLVDSTGGIIKINGD---------MDREEKAQYLLAVIA-RVGTVKPLSAQATVNIEVLDRNDNAPQFSTSS-VIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS-NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHST---MTIHIT----LSINHPP 944          

HSP 3 Score: 198.749 bits (504), Expect = 1.832e-51
Identity = 198/749 (26.44%), Postives = 340/749 (45.39%), Query Frame = 2
Query:  437 STSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRF-FISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLT--NEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREE---KSMEKVDILCKDQAYNTAS----KSIVF-QILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLI------LNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            S SY I  G+   N   +D    ++ +   +DRE     Q    ++ R   + P     ++N+E+LD NDNAP +   S +V   + +G  L  + ++   A D D  +N  + Y L       +  +W     +STS  I+L   K+ D ++   Y + ++A D+GSP +  ++   I I    ++ P F  + Y  + L+    + +    V A D D   NG++ Y I        F I   G + +RK++   A    +   V A DG    +  +    V I + D ND +  + V+ T R  +   + P  +   +++++ L H   KD       IV   +S+     ++      +  QI      DREE    +   V I+  +  YN  +    K+IV   + D NDN+P F+R  +   +   S+P   V  + A+D D   N+K  + ++     + FF   S+G+++  + LDRE T  +N+ + A D  +     T  + I V D ND +P F  S Y  +I+E+A IG+ V  + A D+D+  N  +KY I +   +  + F   S+          G ++    LD E    Y LT+ A D+G     +ST  V +N++DVNDN P F T   T  +++   + G+ +G   A D D G N+ I + +    P   FS N+   ++       L ++ + +D  +LV+ A D+G  PK S    +T++V  ++
Sbjct:  773 SISYAIVSGDPT-NLFLVDSTGGIIKINGDMDREEKA--QYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIV---DIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS---NAEGLLWI----NSTSGVIKLAR-KLTDGDETQ-YTVQVLASDSGSPPQHSTMT--IHITLSINHPPKFTLSSYVTHVLASQP-LSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSL-LQALKGSYDLIVRATDGGVPSF--SASVPVTIYIQDSNDHR-SLFVNNTFRFAVAENSSPGTLVGTLVAHA-LDHSRTKD-------IVYSLISSESHFAVDV-----RSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLA--AMFDVESA---------TGRLIVAKSLDFETTQLYELTITAQDHGLI-PLSSTVNVTVNVLDVNDNAPLFPTQPVT-LTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGS-PKLSTRKSITVQVTDEN 1472          

HSP 4 Score: 147.902 bits (372), Expect = 8.314e-36
Identity = 163/621 (26.25%), Postives = 279/621 (44.93%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQ-INCDIM-LRFFISPSYVSKS---LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSME--KVDILCKDQAYNTAS--KSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDSSGKM-YTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQ-SHYLLTVVAIDNGHPNSYTSTTTVKINIIDVN 2311
            +D  +  +T + R+DRE L  N   N  IM      + + + +    + V + D+NDNAP + +    ++ +E     L    +   KA D D  +N++  Y L      +  G+ K   +SST    EL   K +DRE    Y L++ A D  +     + ++ I + D ND  P+F  + Y  N ++E+A IG + + ++A D D   NG I Y I +   +  F++    G ++V K++D++   + ++ ++ A D        T    V + V+D ND  P     +    P+T     +   V +   +      D D G    ++ S+ +    +   V+ +  E   +A  + +      +  ++ ++  DQ     S  KSI  Q+ D NDNSP F           A+  ++ V  + A D D   N K+ + II GN  +F    S+G++    Q+ D      + +TI A DGG P +    +V++         P FS + Y+ S++EN   GTSV TV A       N  ++Y + SD          SS   F++++   G + T   +DRE   + + L V A+D   P++ TS+ TV I + DVN
Sbjct: 1098 VDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSEL---SLPGSPVFRIKAMDADEGDNAKFFYSLV-----SGTGMDKFFINSSTG---ELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVN-ITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFET-TQLYELTITAQDHGLIPLSST--VNVTVNVLDVNDNAP-----LFPTQPVT---LTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-----VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTI--YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSD----------SSKGGFEVVKS-TGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 5 Score: 73.9442 bits (180), Expect = 3.284e-13
Identity = 85/336 (25.30%), Postives = 143/336 (42.56%), Query Frame = 2
Query:  446 YRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQV----DVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEP---------AIIENEVISNSVL 1411
            Y I +GN L     ++  T  + V   +D E+    ++         I P   + ++ V +LD+NDNAP +P Q   ++  E   N      +    A D D   N+ I + +  +           K  S  S   E+  I  ID E +    D ++L+++A D GSPK +    + +Q+ D+NDN P F      A   S N       +T++A+D D  +NGK+TY I     + YFN+  + G + +   I  +  +  +Q ++ A DG  +  R+T                 + +V V K  P+   P         ++ EN+V   SV+
Sbjct: 1301 YSISNGN-LAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLI-PLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRE---NVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPS--------KTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN------VMTITAEDPDRNSNGKVTYSIISGN-NGYFNLHPSTGQLQMIHQIPDNPTI--YQLTIQASDGG-QPSRQT-----------------QTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVV 1596          
BLAST of Protocadherin 1b vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 230.335 bits (586), Expect = 2.414e-61
Identity = 218/753 (28.95%), Postives = 345/753 (45.82%), Query Frame = 2
Query:  338 SITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKS-LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKS--IVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKP 2575
            +++  K  ++E+   G+ +  LT    +  ++   SY +  G+   +   +D +  V+  K   DRE+    Q+   +  +   SPS   ++ + +EILD+NDN P +       S  E         T+    A D D   N+ + Y     +G T++       D+ T     +   + +D EQ   Y L L   D GSP  T +  L+I + D NDN P+F  + Y + ++ EN   G     VSA D D   NG + + I        F I G+ G I + K+ DY+   + +  +V A D G P +Y      +V I + D ND  P          P      I E+ VI ++V+  +   D D G R  +   L + +      +  +    ++ +    DRE      + +  +D    + S S  +   + D NDNSP F   + FRV E++S P   +G+V A D D   N  + + +  N + F    S+G +  K  LD E+  ++ VT+ AKDGG P ++   +V + V D+ND  P+F+ SLY  ++ EN   G +V  VTA D D  AN K+ Y I+S           + ++ F M R   GEI T+  LDRE  + Y LT+ A D+G    + + TTV I+I D NDN PTF   ++  F+I      G  +G + A D D G N  + Y I  GN    F  + ++  L + S L ++    + LV+ A D G P
Sbjct:  169 ALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDT--SYFTVDSQ-GVIRTKGAFDRETKASYQVA--LRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTV---TASDKDNGNNADLRYSFT--SGNTNHA---FTLDAVTG---VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQS-RVKENTPAG---TQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTR-YDLTVQARDRGVPVKYDT---AQVTIFIEDVNDHSPVF-------SPSNYSKQIPESTVIGSTVVT-VTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSS--ELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSS-PGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSG----------NENMAFAMDRF-TGEITTRVPLDRETIASYSLTINA-DDGSLVRFMAATTVNISIADENDNQPTFTGPSR--FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSP 872          

HSP 2 Score: 228.409 bits (581), Expect = 9.925e-61
Identity = 199/735 (27.07%), Postives = 348/735 (47.35%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQ--INCD--IMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIK-VIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEII--VHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGR--DIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQA------YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSN 2590
            SY I  GN+ +    +D  T  +T +  +DRE++      IN D   ++RF       + ++N+ I D NDN P++   S+   F   E +   +R   +  A D D+  N  + Y +   N          + D     R  ++ ++  +DRE +  Y L++ A D GSP+++ +  + + +LD NDN P F+++  ++ ++ E+A++    L V  +D D  +NG IT  +  +  S+ F I + G ++ +  +DY+     +Q +V A DG      K+   +V I +I+ ND  P  +    VT           I  +V  N+ +  +   D D      DIV  +  ++ K+        D+   ++++A   DRE  +   + +   +        YN A+     ++LD NDN+P F    + + L         V +V A D+D   N+K+ +++ +G+   F    ++G + TK+ LDRE+   +++ + A D G P ++    +T+ + D+ND  P+FS S Y  +++EN   G+++  V A D D  AN ++ Y IIS        F+  S+          G I    ++DRE  + Y LT+ A D+G P  + ST  V I + D NDN P F  SN+T + I    S+G  +  V A D D G N+++ Y I  G+    F+ N  N  L +   ++++    + L I A D+G P   S+
Sbjct:  721 SYSILSGNENM-AFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFM-----AATTVNISIADENDNQPTFTGPSR---FNISEDSPTGTRVGQL-TATDRDIGPNGAVTYAIISGNQGN-----SFQLDP----RSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKS-LFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGE-GSDNFTIDSTGFVLSKTPLDYET-TAAYQLTVTARDGGSPS--KSATAQVKITIINVNDNVPSFVSPAQVTS----------IPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKI--------DQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNAT----IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA--FRIDSTT---------GRITVVGVVDREALASYNLTISAKDSGVP-PWVSTAFVAITVADENDNSPIFA-SNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA-FAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSD 1395          

HSP 3 Score: 199.134 bits (505), Expect = 1.387e-51
Identity = 203/674 (30.12%), Postives = 312/674 (46.29%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKS-LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTD-------NGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPD-FGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQAYNTASKS--IVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLD 2416
            +Y I  GN   N   ID  T  +TV   +DRE+L     N  I  +    P +VS + + + + D NDN+P +   S   S+   EG  + SR + +  A D D   N+Q+ Y +    G T        NGV  +K              K I+RE V  Y L + A D GSP  T   EL + + D NDN P+F+ ++ Y   + EN+      LTV+A D+D  AN  + Y I      + F I   +G IM    +D++   + +   V A D      + T +  V I VI+ ND  P                ++ EN   S SV+  +   D D FG          ++DK  ++Q S       I++ A+  DRE  S+  + +   D      S    +  +ILD NDNSPKF +  +   +LEN S P+ F  ++ A D D   N++I + +  N+  F    SSG +   Q LDRE    +++ I A+D G PP+  +  + + V+DIND +P  + S    S+ EN    T V  + A D D   N ++ + ++S+    +S F          + +  G+I TK  LDRE+Q+ Y L +   D G+P S +S   V I++ID +DN P F+    T +++  +ES+  G  I  V A D+D
Sbjct: 1239 TYSIISGNHG-NAFRIDSTTGRITVVGVVDREALA--SYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF--ASNETSYGIDEGVSIGSR-VAVVTATDRDEGSNAQVFYSIV--RGDTSAFAINAMNGVLTVK--------------KEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFN-SQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQ-YGLEVTATDS-----KYTAKTNVTIRVINLNDITPAFTQQ-------NYTASVRENSPTSTSVV-KVSASDRDSFGSLSYSIVGGKDSDKFSIDQRS------GIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILEN-SAPSSFSFKLAATDADEGTNARITYNLSRNDA-FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNE--HKSVF---------TLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNP-SLSSVADVIIDVIDEDDNCPRFQ---PTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 4 Score: 187.578 bits (475), Expect = 5.423e-48
Identity = 194/728 (26.65%), Postives = 320/728 (43.96%), Query Frame = 2
Query:  446 YRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKV-IDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEII----VHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAI-ANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNS--YTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCS 2587
            YR+  GN +    +ID  +  + V + +DRE+     +  +       +    S  + + + DINDN+P + Q   V   +E   +      I    A D D + N  + Y L D    TD  V+ I   +       L+ +K  +D E+   Y + + A+D G+P R+    + + + D NDN P F ++  Y   + EN   G     V+A DAD  ANGKI+Y I     +  F +    G I  R  +D +  +  +  ++ A DG+    R      V I + DEND +P        ++++  P             + + +  +   D D G    V+ ++ + ++    Q+ P      IL++ +  DRE      + +   D      + + SI   +LD NDN+P+F + +F   + E+ASV +  + +V   DKD   N  I   + G     F IDS+G + +K  LD E T  + +T+ A+DGG P K+ T  V I ++++ND  P F       SI E+  I T V  + A D D    T + + I+    +  S F+         I    G I     LDRE  ++Y L V A + G      Y + T   I ++DVNDN P F   +    S+     +G  +  V A D D GEN+++ Y++  G+    F  N     +     L ++D   + L ++A D GKP + +
Sbjct:  515 YRLISGN-VKGAFNIDANSGSIRVSSELDRETTPSYSLQVEAR-DGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSE---SSSPGHQIGQVAATDADDSSNGDVRYALSD---NTD--VFSINTSTG------LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKS-LYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRET-IASYSLTINADDGS--LVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSP-------------TGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDP---RSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVL-QVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIV--EGNAGSSFK---------IDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNAT---IRVLDVNDNAPVFNPGSY-AKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDT-SKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSA 1185          

HSP 5 Score: 182.185 bits (461), Expect = 2.166e-46
Identity = 194/719 (26.98%), Postives = 329/719 (45.76%), Query Frame = 2
Query:  500 THVVTVKNRIDRESLCPNQINCDIMLRFFISPS-YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPI-KVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLD-FGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ--DDHKLVISACDKGKPPKCSNPLWVTIKVVKQH 2626
            T  V  K  +D E+    Q+   +  R   SPS   +  + + I+++NDN PS+   ++V S  E     + +  + ++ A D D    + + + + + N  +       K D S+     L+ + K +DRE    Y L++ A + GS   +      I++LD NDN P+F+   Y A  L EN  IG     V+A D D   N K+TY +     S++      G +  ++ +D +     +   V A+D G P +   +    + + + D ND  P+       +  LT    + EN    +++L  +   DPD G    V+ S+ + +     ++  +     ++ +   DRE  +   + I  KD       ++  +   + D NDNSP F +    + + E  S+ +  V  V A D+D   N+++ + I+  +   F I++ +G +  K+ ++RE    + +TI A D G P  T    +T+ V D+ND  P F+   Y  S+ EN+   TSV TV A D D+ AN  ++Y IIS   + E  F+ +S+          G I+T   LD E++S Y L V A D    + YT+ T V I +I++ND  P F   N T  S++        +  V A D D FG    + Y I  G     FS + ++  +    VL ++    + + +   D G PP  SN  WVTIK++ ++
Sbjct:  946 TGFVLSKTPLDYETTAAYQLT--VTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPE--DVAINTHVVKLN-ATDSD---GTPLTFDIVEGNAGS-----SFKIDQSSG----LISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSY-AKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQAS-YSLRVTAMDHGKPSQ---SAVAAITLTINDLNDNSPQF---SQSKYTLT----VTENTANGSNIL-RVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGV--VDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSR-VAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISG--NDEKRFKINST---------SGVIMTTTPLDFEEKSQYGLEVTATD----SKYTAKTNVTIRVINLNDITPAFTQQNYTA-SVRENSPTSTSVVKVSASDRDSFG---SLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPP-LSNLTWVTIKILDEN 1611          

HSP 6 Score: 158.688 bits (400), Expect = 4.241e-39
Identity = 174/592 (29.39%), Postives = 258/592 (43.58%), Query Frame = 2
Query:  776 YFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTAS--KSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES--VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQ 2530
            Y + D N   D G++ I  DSST         +  DRE    Y L ++A+D  +    G   ++I + D+NDN P F    Y  N + EN     VA+ V+A D D   N  ITY +   +     N    G I     +D++     +   + A DG    +        +I V D ND  P   + V K          +  +V   S++  +   D D G    +S SL + D          D +  I     FDRE K+  +V +  +D    + S   ++  +ILD NDN P F+   +   V E+ ++    V  V A DKD   N+ + +    GN  H F +D+ +G +   + LD E+   + + +   D G PP T T  + I V DIND  P FS S Y+  + EN   GT    V+A DRD   N  + + II  + + +  F    S          G I      D E ++ Y LTV A D G P  Y  T  V I I DVND+ P F  SN   +S Q  ES  +G  + TV A DLD G    + Y++  GN  G F+ +  +  + ++S L ++
Sbjct:    1 YSIMDGN---DQGMFTI--DSSTGSITTTG--RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFN-IRENTPAAQVAI-VTATDRDSGTNAAITYSLFSGENKFMMN-SKTGEIRTVTPLDHETK-DSYTMRISAFDGKHTTFVP------LITVDDVNDNAPFFALSVYKTG--------VYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTV----DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMV-TVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQ---VSATDRDSSTNGALVFGII--KGNDDGVFTIDGST---------GIISIAKSPDYENKTRYDLTVQARDRGVPVKY-DTAQVTIFIEDVNDHSPVFSPSN---YSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRE 544          

HSP 7 Score: 154.066 bits (388), Expect = 1.292e-37
Identity = 135/463 (29.16%), Postives = 216/463 (46.65%), Query Frame = 2
Query: 1220 FQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSL-SNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGT-VEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHK------LVISACDKGKPPK 2581
            ++ +VLA D A   ++  G   VVI V DEND  PE  ++    +   N PA         + +A +   D D G    ++ SL S  +K  +       K  +I  +   D E K    + I   D  + T    I     D NDN+P F   V+   V E+ +V ++ V ++ AVD D   N+++ + ++  +  +F +DS G + TK   DRE    + V + A+DGG P ++G   V IE++D+ND +P FS + Y  S+ E+  IG ++ TVTA D+D   N  ++Y          S+   +++  F +     G +     LD E++S Y L +   D G P   T T+ + IN+ D+NDN P F  S     + Q+        GT V A D D   N  +V+ I +GN  G F+ +     +     ++K  D++      L + A D+G P K
Sbjct:   36 YRLTVLAQDAANRCHK--GRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA---------AQVAIVTATDRDSGTNAAITYSLFSGENKFMMNS-----KTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPLITVD--DVNDNAPFFALSVYKTGVYEDVAVGSI-VRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRY----------SFTSGNTNHAFTL-DAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSP-PLTDTSHLLINVNDINDNPPVFSPS-----AYQSRVKENTPAGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGII----SIAKSPDYENKTRYDLTVQARDRGVPVK 458          
BLAST of Protocadherin 1b vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 207.223 bits (526), Expect = 5.953e-54
Identity = 218/733 (29.74%), Postives = 333/733 (45.43%), Query Frame = 2
Query:  506 VVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNK-LESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKI--KYDSSTSRRIELMPIKV---IDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASE-YFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEE-----HFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSK--QDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPP 2650
            V+T K  +DRE +    +    ++ F   P   S ++ V + D+NDN+PS+ + +       FE +K    + I    A D D   NS   Y +   +G   N V+K+  K D+      +L+       +DRE++D Y L + A D G+P   G L L I + D NDN P F     Y+  + EN ++G   L VSA D D   N +I Y IE     +  F I     ++V  N+  D   K     V+  +     ++ +    V I V+D ND  P  ++HV+    L     + EN  I   V A + V D D G    V+ +L   D     +    + E  I    + DRE      +  +C D+     T  KS    + D ND +PKF R  +  RV ENA+V N  V  V AVD+D   NS++ + I    E     H+F ID SSG + T   LDRE+  +  +T+L  D G PP +    V + + D ND  P F+ S Y  S+ EN+  G+ V  + A D D+  N+ + Y I+            + + PF  +   +G +     LD E QS Y   V A D G     +   TV +++ D+NDN P F  S+ +V   + T  +G  I  ++A+D D  + +   + IE+GN    FS +  +  + L  +L +  QD++ L + A D G      N   V I V+     + +EPP
Sbjct:   13 VITTKTVLDREKVSAYNLT---IVEFSTPPK--SYTVLVYVQDLNDNSPSFVRGTSA-KLVVFENDKDFRQKLI----AVDSDFGSNSTQSYTIV--SGNVGN-VFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVS-YSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIV-NNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNP--VIHVSYT--LGGSYQVTENATIGTQV-ARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATV-NTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSIL------------TPNTPF-FLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG---GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTR-IGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSV-NKAIVNITVLD----VNDEPP 701          

HSP 2 Score: 194.897 bits (494), Expect = 3.661e-50
Identity = 188/687 (27.37%), Postives = 307/687 (44.69%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISN-SVLAHI-EVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN---------FDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPA-NTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVF-SIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLV--ISACDKGKPPKCSNPLWVTIKV 2614
            +N+ +LD+ND  P + +     +FT  E ++  S   H+  A   D   N+++ Y +    G TDN V     +S+ +  ++      +D E++    L + A+D G+P   G   + I ++D NDN P F+ +     +L E+  IG    TVS  DAD    G++++ +     + +    N G + + K IDY    + +   V A DG       T   E  + V+D ND  P                      V  N S  AH+ E   PD    ++V+  + + +  R+     S  +     + N          DRE+     + ++  D      S S   +++  D NDN+P F +  + F V EN  V   ++G V A D D   N  + ++       F     +GK+ T QVLDRE    +  +I+A DGG  P+     VT+ V D+ND  P+FS + Y  +++E+  +G+S+ T+ A D D    N+ + Y I++    FS               +    G +     LDRE    ++L VVA D G   S  + T ++IN++DVNDN+P F   N+T F ++     +G  +  V AVD D G+N ++ Y+I  GN  G F  N     +     L  +  ++ V  +SA D GK  + ++   VTI V
Sbjct:  689 VNITVLDVNDEPPIFSKAE--YNFTIQEHSQALSVIGHV-HAISRDKGTNAEVVYSIS--KGNTDNIVL---INSTGTLYLQ----SEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILV-RLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLE--LKVVDVNDYSP----------------------VFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVA-TYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFS---------------LNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFI--NETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYV 1320          

HSP 3 Score: 176.407 bits (446), Expect = 1.595e-44
Identity = 205/713 (28.75%), Postives = 320/713 (44.88%), Query Frame = 2
Query:  488 IDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELI-IQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA-------YNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIIS----DRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTE-SVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKP 2575
            +D +T  +T    +DRE+   + +   +      SP      + V + D+ND +P + +     S T  E   + S  + +    D     NS I Y +          V   K  S       L  +  +DRE    + L ++A D G  +   ++  I I +LD NDN P+F     +   + E   IG V   V A D+D   NGK+ Y+I +      F I    G I   + +D++   + +   V A D   ++ +KT    V I V D ND +P        ++P+     I EN  I N+ +  I+  D D G    +  ++ +       +++      Q       DREE S   + +   DQA       YNTA+  I+ Q  D NDN+PKF       V+E+    N  V  + A+D D  +   +E++I+  +   F +D  +G +     LD E+  ++ + I A D G PP T   L  + VVD+ND  PEF+  L+  ++SEN   GTSV  VTA DRD  +N ++ Y I S    D+FS               I    G IVT  +LDREK+  Y LTV A    +P    S+T+V+IN++D NDN P F +    V +++  E S    I T+   DLD+G N++++Y I  GN  G F+      +L   + L ++    ++L + A D   P
Sbjct: 1064 VDKQTGKITTSQVLDREAKA-SYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNK--YSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI----------VAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTF-KTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNR-YVLRVSATDMGKKQ-QKTSYQLVTIYVEDANDNRPTF-----DKNPIIT--WIYENVPI-NTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQ--TTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFVSRNLTYVMEDEPF-NFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFS---------------IDKHSGLIVTNSILDREKKDTYFLTVHATGVSYP-FRVSSTSVRINVMDRNDNPPKFISP---VVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPP 1728          

HSP 4 Score: 175.252 bits (443), Expect = 3.744e-44
Identity = 189/723 (26.14%), Postives = 310/723 (42.88%), Query Frame = 2
Query:  473 LNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSK-SLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDY---------FLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFG--GRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNT--ASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEK-FNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVIS--ACDKGKPPKC 2584
            L+   IDP + ++T    +DRE +   Q+   +++    SP      S+ V + D NDN P + Q S   S   FE +   S  + +  A DPD+ ENS I Y         FL  R G   N                    + +D E    Y   + A D G   R+ +  + + + D NDN P+FD + Y      EN  IG     + A D D        + IE   A E F++  +G I + K +D +     +  +V A+DG  ++     +  V I V+D NDE P   +        T     I+    + SV+ H+     D G     + S S  N D + L   + +     +   +  D E+     + +  KD+         ++   ++D NDNSP+F +     R+ E+  + + F   V   D D+    ++ F ++ N    F +DS +G +   +++D   + + + + + A+DGG PP++ T ++ ++VVD+ND+ P F    Y   + E     +++  V A D D   N ++ Y    D     S F             + G+I  K  LDRE    Y L V+AID+G P   +S+  VK+ + DVNDN P F+ ++   F ++  E V   +G V A D D G N  + Y+ +       F  + Q  K+  + VL ++     V S  A D G  P+ 
Sbjct:  438 LHWFAIDPSSGMITTATDLDREQIP--QVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASL--FENSPSGSPVVQL-LAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNS-------------------RTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFDPSSYSVEYF-ENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQ-DNYLLTVKAVDGGGQD--SVNKAIVNITVLDVNDEPP---IFSKAEYNFT-----IQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGT-----LYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFY-TVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAF--DSKVDTSKFGL----------RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRR-SSSADVKVIVDDVNDNNPHFQQASYAFF-VKENEPVATYLGAVSASDSDEGSNGHVTYRFD--TQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRV 1100          

HSP 5 Score: 169.859 bits (429), Expect = 2.152e-42
Identity = 174/683 (25.48%), Postives = 298/683 (43.63%), Query Frame = 2
Query:  605 SKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS----EYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCS-LSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVL---SKQDDHKLVISACDKGKPPKCSNPLWVTIKVV 2617
            S  + +E+LD+NDN P       +    +   N      +      D D  +N +++  L+       +G + +K+D      I +   + +DRE  D + L  +  D G P RT      I + D ND  P FDR   Y  ++ ENA +  +   V+A D D+ +N ++ Y I +   S     +F I  ++G I    ++D +  +     +VL  D G+P     +  C V++ + D ND  P             N P        S S +  +  +DPD G   ++  S L+ N    L+      ++  +      D E +S     +   D    + + ++   + D NDN P F    +     EN  +    + ++ A+D+D+ + +   F I  GN +  F +D SG +   ++LDRE  + + +T+ A DGG        +V I V+D+ND  P FS + Y F+I E++   + +G V AI RD   N ++ Y I   + + ++    +S+          G +  +  +D EK     LTV A D G P  +     V I +ID+NDN P F +S+  V   + T  +G+   TV   D D G    + + +   NP   F+ ++    L L  ++   +    + L + A D G PP+ S  + + +KVV
Sbjct:  262 SAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEG-----GDGYFSMKFDVLNDESI-IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDR-HTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQ-IPQVVLTVLVHDRGSPP---LSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSP--------SGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDP-----RKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRI-GQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSI--SKGNTDNIVLINST----------GTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLF-GYANVTIAVIDINDNSPQFNSSSILVRLPEDTP-IGHTFYTVSVFDADSGVLGRVSFSLLS-NPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAM-LELKVV 903          

HSP 6 Score: 162.155 bits (409), Expect = 3.916e-40
Identity = 173/670 (25.82%), Postives = 291/670 (43.43%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVID-REQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSE---NANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKD-GGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKG 2569
            P +   ++ + ++DINDN+P +   S +V   E   +     T +    FD D     ++ + L    G   N       DS+T     L   K+ID       Y L + A+D GSP R+ +  L ++++D ND  P+F    Y A+ L     ++NI    + V A D D   NG+I+Y  + +  +  F + N G I ++  +D +  ++ +   V+AID G P   R++   +V ++V D ND  P            +    + ENE ++ + L  +   D D G    V+         ++ Q     +  +I      DRE K+     I+  D   +       +   + D ND SPKF++  +   V E+  V +  +  +   D     NS I + I+   + F     +G +     LDRE T +  + ++A D GG+        + I V+D+ND  P F       ++ E   IG+ V  V A+D D   N K++Y+I++   + +  F+         I    G I T   LD E  + Y+L V A D G     TS   V I + D NDN PTF   N  +  I     +   + T++A D D G NS I Y I+  +P  +F  N++   +     + +++  ++ L + A D+ 
Sbjct:  786 PLFGYANVTIAVIDINDNSPQFNSSSILVRLPE---DTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFN------LDSNTG---ALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNI----IEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDRE-DIEEYNLKVIAIDHGTP---RRSSSADVKVIVDDVNDNNPHF-------QQASYAFFVKENEPVA-TYLGAVSASDSDEGSNGHVTYRF----DTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNG--NTDGTFK---------INETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFD-KNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQA 1411          

HSP 7 Score: 147.132 bits (370), Expect = 1.926e-35
Identity = 122/385 (31.69%), Postives = 186/385 (48.31%), Query Frame = 2
Query: 1508 PSDKEFQILAIAN---FDREEKSMEKVDILCKDQAYNTASKS--IVFQILDRNDNSPKFTRVFHFR--VLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQI----DSSGKMYTKQVL-------DREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTE--SVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLIL---NSVLSKQDDHKLVISAC-DKGKPPKCS 2587
            P+D E+    I      DRE+ S   + I+     ++T  KS  ++  + D NDNSP F R    +  V EN      F  +++AVD D   NS   + I+ GN  + F++    D+ G +Y   V+       DRE  + + + I A DGG+P   G   ++I V D ND KPEFS   Y  +I EN  +GTS+  V+A D+D+  N +++Y I +          +S       I    G IV    LD E +  YL+ V A D G  +  +S+  V+I ++DVNDN P    S     S Q TE  ++G ++  V   D D G+N E+   +E G+ Y    F+  N + I+    S+  +  DH  + + C DKG PP+ +
Sbjct:    4 PADLEYNAGVITTKTVLDREKVSAYNLTIV----EFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFEND---KDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIET----------HSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTT 371          

HSP 8 Score: 144.821 bits (364), Expect = 8.083e-35
Identity = 154/588 (26.19%), Postives = 253/588 (43.03%), Query Frame = 2
Query:  875 VIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAER--NSKIEFQI--IGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEF-SLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGY----EIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSN 2590
            ++DRE+ D Y L + A     P R  S  + I ++D+NDN P F  +     K+ EN+    +  T++ +D DY  N K+ Y I        F IG + G +     +D +     +Q SV A D  P  Y  T    + I + D+ND  P     +          + I       + + ++   D D G    +  +LSN+        S   +   + + A F+   K       + KDQ  +   A   +  +I D+N+++P+FT+  +   +  N S  +  V  V A D D ++  N K+ +++    N    F ++S +G + T          +  + I+A+D G PP  G G+V I + +I D  P F + +    SI EN+ +G+ + TV A      ++ ++ Y IIS    +  Y       PF  +      + +   LD E   ++ L +VA   G   S      + IN+ID NDN P F  SN      Q  E  G      +  V A D+D G N ++ Y I  GN  G F+ ++   ++    +L ++      LVI   D G PPK +N
Sbjct: 1603 ILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKF-ISPVVTLKVPENSPARLI-YTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKAS-YQLSVQAKDITPPYY--TAFANITIFIEDQNDNPPVFQQSLYS--------STISELTPPGTSILNLTASDKDSGSNGNIVYTLSND---TYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSA-SALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRA---RASSDAQVTYSIISGNKGRAFYVD-----PFTGVI----SVASADALDYESTKNFRLHLVATPQGWV-SLNGYMILDINVIDRNDNSPAFHPSNMLA---QLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTN 2157          

HSP 9 Score: 127.872 bits (320), Expect = 1.452e-29
Identity = 160/580 (27.59%), Postives = 252/580 (43.45%), Query Frame = 2
Query:  443 SYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFF---ISPSYVSKSLNVEILDINDNAPSWPQQSKV------------VSFTEFEGNKLESRTIHIDKAFDP------------DVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKD-ADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN-FDREEKSMEKVDILCKDQAYNTASK--SIVFQILDRNDNSPKFTRV---FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE-EHFFQIDS-SGKMYTKQVLDREETE--KFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRD 2062
            +Y I+ GN+      ID  T  +T    +DRE+      + D+++R     I P   +  + V + D+NDN P +   S+V             S    + +K    T ++  A  P            D   N+QI Y     N  +D   +KI  D+        + +++ D       ++ + A D G P +   + + I I  +    P F+   Y+  K+ ENA +G   LTV   D A  L  G+I+Y IE+   S YF IG  +G I V K +DY+   + F   V AID  AP    K     V I V D NDEKP            +   A     +   +++ ++   D D G    V  ++ + D      +   D++  ++      D E      V +   D+         S+  ++LD NDN P F RV      +VLEN  + N  + E+ A D+D+  N+++ F +IG   +  F ID  SG + T    D E T   ++++TI A D G+PP +    + + V D +++ P F+   Y+F +  NA IG  VG VTA DRD
Sbjct: 2105 TYSIWTGNEA-GVFTIDSTTGEITTAKLLDRETTA----SFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITN--SDQIDYKIDADTGVISARRTIDVRIRDS----FIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFG-KVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIEN---SNYFRIGQRSGVISVNKPLDYETK-RRFLLVVSAIDDTAPS---KPVRVPVYINVSDVNDEKPVF--------GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAI---DRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVF-RVPGPNDVQVLENLPL-NSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRD 2648          

HSP 10 Score: 124.405 bits (311), Expect = 1.609e-28
Identity = 160/619 (25.85%), Postives = 258/619 (41.68%), Query Frame = 2
Query:  854 IELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANI---GFVALTVSAKDADYLANGKITYRIEDQKASEYFNI-GNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKE----FQI---LAIANFDREEKSMEK----------VDILCKD-------QAYNTA---SKSIVFQ--ILDRNDNSPKFTRVFHF-RVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD----DHKLVISACDKGKPPKCSN 2590
            I +     +D E    + L L+A   G     G + L I ++D+NDN P F  +   A +L+E+       FV + V+A D D   NGK+TY I     +  F I    G I   K +D +     F   +   D G P    K+  C+V ++V D ND  P         DPL+     I  +  + +V+  +   D D   R   +   ++   + + +VS +D++     QI     I N D+ +  ++           +D+  +D       QA +      +++V+   I+ R    PKF    +F +V ENA +    +   +  +       +I + I     ++F+I   SG +   + LD E   +F + + A D   P K     V I V D+ND KP F  S Y    SE   +GT V  V+A D+D  AN ++ + I S    K S+           I    G I T+  LD E    + ++V A D G P  +T   +V I ++D+NDN P F+        +     +   +  + A D D G N+ + + +  G   G F  +  +  L  N     ++     + L I A D G PP  SN
Sbjct: 2017 ISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLA-QLAEDTGAFKPRFV-VKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRET-TASFDLVIRGTDSGIPP---KSTNCQVKVVVTDLNDNPPLF-------DPLSE--VNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITR---EPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNI--ENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD-DKGSF----------AIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTD-VSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSN 2603          

HSP 11 Score: 122.865 bits (307), Expect = 4.520e-28
Identity = 177/671 (26.38%), Postives = 297/671 (44.26%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKR-----TGSLELIIQILDKNDNGPIF-DRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKF-TRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF-KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEG-NPYGYFSFNTQNKKLILNSVLSK--QDDHKLVISACDKGKPP 2578
            + + + D NDN P++  ++ ++++  +E   + +    I KA D D   NS+I Y +  ++ +        K +S T       PI   DRE++  Y L + A D    ++     T +L++IIQ  D NDN P F  R   Y   + E+    F   +++A D D    G + YRI      ++      G + +  ++DY+  V  +   + A D G+P     T      ++V+D ND  PE       RD       + EN+    SV+  +   D D G    ++ S+ +   + +++ S       I+  +  DRE+K    + +     +Y    +S S+   ++DRNDN PKF + V   +V EN+  P   +  +   D D   N+K+ + I+ GN +  F I  S+G++ T   LDRE    + +++ AKD   P  T    +TI + D ND  P F  SLY  +ISE    GTS+  +TA D+D  +N  + Y +     S ++Y  YS       I    G + +    +   +  Y    +A D G  +   +   V+I I D N++ P F KT  +      T+ S    + T    D D   N ++ Y++++  N    F   +    +  ++  S   Q  H L I A D G PP
Sbjct: 1316 VTIYVEDANDNRPTF-DKNPIITWI-YENVPINTNVTTI-KAHDDDSGLNSRIWYTIDSQSPRA-----HFKINSETGLIQTTHPI---DREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFVSRNLTY---VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYE-DVPQYTLHISATDLGSPP---LTSYQLFNVVVVDVNDNPPEF-----TRDLFIG--TVSENKPTGTSVV-KVTAYDRDSGSNAELTYSIPSG--VEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENS--PARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTL-----SNDTYGVYS-------IDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQ-DPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPP 1941          

HSP 12 Score: 82.8037 bits (203), Expect = 8.385e-16
Identity = 85/312 (27.24%), Postives = 146/312 (46.79%), Query Frame = 2
Query:  872 KVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIAN--FDREEKSMEKVDILCK-DQAYN---TASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEF 1780
            K +D E    + L++ A D+ +P +   + + I + D ND  P+F ++ Y A + SE   +G + + VSA D D  ANG++ + I+       F I    G I  ++ +D++  +K    SV A D G+P  +    +  V I V+D ND  P        R P  N+  ++EN  + NS L  I   D D G    +S ++       L  +     +F      N  FD E  ++ +  +  K   A N   +++ +I+  + D ++  P F R+ + F V  NA + + FVG+V A D+D+    ++ F
Sbjct: 2363 KPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMA-QWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHET-IKTHHVSVRATDEGSPPMHT---DVSVTIRVLDLNDNPPVF------RVPGPNDVQVLENLPL-NSRLYEINATDRDSGANARLSFTVIGGTGQGLFLI----DKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGD-FVGQVTATDRDSGDQGRVFF 2657          
BLAST of Protocadherin 1b vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 196.438 bits (498), Expect = 1.110e-50
Identity = 206/745 (27.65%), Postives = 331/745 (44.43%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFI--------SPSYVS-KSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEII-VHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQA--YNTASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEH--FFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEE-GNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPP 2650
              ID  T V+T K  +DRE           + R F          PS      L + +LD+NDN P + +        E   +K     +   +A D D   N ++ Y + + +G  DN  + I      S  + +M  K +DRE+V  Y L + A+D G+P R+ ++ + I +LD ND  P F + K Y+  + E+  +  +  TV A D D  +NG++ + I       +F+I   NG + V++ +DY+  +  F   V A D G P  Y +T    V I +ID ND  P+ +  H     P        EN  +       ++  D D G    ++ S   ND       S ++    I      DRE+       I  +D+   +   +  I   +LD NDN PKF++  +H  + EN S     V +V A+D D+   + + + I+ +  H   F+I+  G +     L+      +  ++ A DG     + T LV + V D N   PEF    Y   + E+A +GTSV TV A DRD  +N K+ Y I             ++ +P   +    G I T   LDREK   Y   V A D+G P    + + V I+I DVNDN P F    K  +  +  E +  G  +  V A D D G+N++I+Y     G+  G F+ ++    +     L ++   +++L + A D+G PP  ++   V +KV+ +   + + PP
Sbjct:   71 FSIDQITGVITTKRGLDRE----------FLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPE---DKSIGDFVLAVRASDADSGSNGEVKYCILNSDG--DNSAFSI---GEVSGAVTVM--KKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSK-KVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEM-IGVFNLLVTAQDKGQPFLYNQT---TVDIALIDVNDNAPQFVSSHFQTMIP--------ENYAVGQE-FYRVQAYDKDHGTNGEITFSFMQNDL----PFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAEN-SRWGTSVLQVKAIDPDSG-PTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI-------------ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQ-LKAKSFVYIHIADVNDNDPVFL---KPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQAS---VKVKVILED--VKDSPP 750          

HSP 2 Score: 191.815 bits (486), Expect = 2.776e-49
Identity = 193/645 (29.92%), Postives = 291/645 (45.12%), Query Frame = 2
Query:  737 AFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSS--TSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKA-SEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVD----------ILCKDQA----YNTASKSIVFQILDRNDNSPKFTRVFHFRVL--ENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDR-------GEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLS----KQDDHKLVISACDKGKP 2575
            A DPD   N  I Y +           + I   +   T++R        +DRE +D +   + AED G P   G ++L I +LD NDNGPIF+R   YA  + E+ +IG   L V A DAD  +NG++ Y I +    +  F+IG  +G + V K +D +  V  +   V A D G P    ++    V I ++D ND  P+    V          A I  +V  N ++  +   D D G          +N ++  E VS +D  F   +I   + E +  +K+D          +  +D+     YN  +  I   ++D NDN+P+F    HF+ +  EN +V   F   V A DKD   N +I F  + N+  F   +++G +  K+ LDRE+  KF   I A+D G P K GT  +TI ++DIND  P+FS   Y  SI+EN+  GTSV  V AID D    T + Y I+S                     HDR       G I     L+   +  Y+ +V A D       +ST  V +N+ D N + P FK  + +   ++   S+G  + TV A D D G N++I Y I    P     F+      ++ +  S    K D ++  ++A D G P
Sbjct:   44 ASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKR-------GLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFER-NIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREK-VPTYTLQVQAQDQGNPP---RSATVTVKITLLDVNDCTPQFSKKVYS--------ATIREDVPVNQLVTTVRATDCDQG----------SNGEVFFEIVSGNDMNF--FSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIA--LIDVNDNAPQFVSS-HFQTMIPENYAVGQEFY-RVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPD-SGPTNVVYSIVSSS------------------GHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASD----GMLSSTALVYVNVTDSNTHAPEFKRRSYSA-EVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVP----EFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIP 624          

HSP 3 Score: 154.836 bits (390), Expect = 6.840e-38
Identity = 170/662 (25.68%), Postives = 291/662 (43.96%), Query Frame = 2
Query:  593 PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVF-QILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESV--GYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSF--NTQNKKLILNSVLSKQDDHKLVISA 2557
            P   + ++ + +LD+ND  P   Q SK V       +   ++ +   +A D D   N ++ + +   N      + +I  +    +++        D E + V+ L++ A+D G P       + I ++D NDN P F  + ++   + EN  +G     V A D D+  NG+IT+           N  N G I +++ +D +  V  F F + A D G P    K G  ++ I ++D ND  P+     ++ +  T   +I EN     SVL  ++  DPD G  ++V   +S++   R  +++P   +  I      +   K +    +   D     +S ++V+  + D N ++P+F R  +   V E+AS+    V  V+A D+D   N+KI + I      F   +++G + T   LDRE+ + +   + A D G P       V I + D+ND  P F    YE  + E+   G  V  V+A D D+  N ++ Y   S+   + ++           I   +G I T   LDRE    Y LTVVA D G P    S   VK+ + DV D+ P F+   K ++ +   E       + TV+A   D    + ++Y I  GN    F    NT   + ++      Q +++L + A
Sbjct:  213 PRSATVTVKITLLDVNDCTP---QFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKL--------DYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF-VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSIN-ENTGGISIKEELDREK-VPKFTFGIKARDKGVP---FKEGTAQITITLLDINDNPPKF----SQEEYHT---SIAENSRWGTSVL-QVKAIDPDSGPTNVVYSIVSSSGHDRCFRINP---QGLITLSCTLNYNTKHVYVFSVSASDGML--SSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASL-GTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTF----------TIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQAS-VKVKVILEDVKDSPPLFE---KPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRA 829          

HSP 4 Score: 151.754 bits (382), Expect = 6.788e-37
Identity = 175/665 (26.32%), Postives = 295/665 (44.36%), Query Frame = 2
Query:  599 YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDY-FLKDR---NGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY-NTASKSIVF-QILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKI--EFQIIGNEEHFFQIDSS-GKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVL---SKQDDHKLVIS 2554
            Y   ++++ ++D+NDNAP +          E   N    +  +  +A+D D   N +I + F+++    +   + G   IK +              +DRE+V  +   + A D G P + G+ ++ I +LD NDN P F + +Y+ + ++EN+  G   L V A D D      +   +        F I   G I +   ++Y+     + FSV A DG       +    V + V D N   PE      KR   + E  + E+  +  SVL  +   D D G    +S S++      + + S  +    I    + DRE+    + ++   D       +KS V+  I D NDN P F +  +  +V E+   P   V EV A D D  +N++I   F   G+ +  F IDS+ G + T + LDRE   ++ +T++A D G PP   +  V + + D+ D  P F   LYE ++ E+    + V TV A  +DL   T M Y I+  R +    F          I  + G I T   LD E QS Y LTV A      + + + TTV + + D+NDN P  +  +  + ++Q  +        + A D D  +  ++ +++ EGN   + + N  + +L +N  L   SK  + K+ ++
Sbjct:  320 YNQTTVDIALIDVNDNAPQFVSSHFQTMIPE---NYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEE--------------LDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTS-IAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTK-HVYVFSVSASDGM-----LSSTALVYVNVTDSNTHAPEF-----KRRSYSAE--VKEDASLGTSVLT-VLATDRDTGSNAKISYSIAT----LVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIR-PGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIV--RGNSPQVFD---------INPNTGAIQTLMKLDYETQSEYRLTVRAT----LSPFFTETTVMVYLKDINDNTPVLEAFHMNI-NVQEGKVPPEARYKIPAYDPDVSD--KLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASKPANIKIAVT 929          

HSP 5 Score: 151.369 bits (381), Expect = 7.978e-37
Identity = 158/536 (29.48%), Postives = 251/536 (46.83%), Query Frame = 2
Query:  989 DNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRI---EDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNND----KMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYG-YFSFNTQNKKLILNSVLSKQDDHKLVIS 2554
            +N P F R +  A+ +SE+A +G V  TVSA D D  +NG I Y +   ++  ++ YF+I    G I  ++ +D +   + F F V A DG   E    G  ++ I V+D ND  P    ++   D       I E++ I + VLA +   D D G    V   + N+D       + +VS +     +  +   DRE+     + +  +DQ     +A+ ++   +LD ND +P+F+ +V+   + E+  V N  V  V A D D   N ++ F+I+ GN+ +FF I+  +G++  KQ LD E    FN+ + A+D G P       V I ++D+ND  P+F  S ++  I EN  +G     V A D+D   N ++ +          S+ Q  + LPF  I  + G I  K  LDREK   +   + A D G P     T  + I ++D+NDN P F        SI      G  +  V+A+D D G  + +VY I   + +   F  N Q   + L+  L+    H  V S
Sbjct:   15 NNPPQFSRLQEDAS-VSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHF-FRVKAEDGG--EPSLEGYMDLTINVLDVNDNGPIFERNIYAAD-------IPEDKSIGDFVLA-VRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGA-----VTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPV-NQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITF----------SFMQ--NDLPFS-INENTGGISIKEELDREKVPKFTFGIKARDKGVPFK-EGTAQITITLLDINDNPPKFSQEEYHT-SIAENSRWGTSVLQVKAIDPDSGP-TNVVYSIVSSSGHDRCFRINPQG-LITLSCTLNYNTKHVYVFS 515          

HSP 6 Score: 77.0258 bits (188), Expect = 4.612e-14
Identity = 70/220 (31.82%), Postives = 104/220 (47.27%), Query Frame = 2
Query: 1970 PEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRII-SDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQI--EEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWVTIKV 2614
            P+FS    + S+SE+A +GT V TV+A D D  +N  ++Y +  S      +YF          I    G I TK  LDRE    +   V A D G P S      + IN++DVNDN P F+  N     I   +S+G  +  V A D D G N E+ Y I   +G+    FS    +  + +   L ++    + L + A D+G PP+ +    VT+K+
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFS---------IDQITGVITTKRGLDREFLDRHFFRVKAEDGGEP-SLEGYMDLTINVLDVNDNGPIFE-RNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSA-FSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSAT---VTVKI 222          
BLAST of Protocadherin 1b vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 196.052 bits (497), Expect = 1.135e-50
Identity = 189/693 (27.27%), Postives = 315/693 (45.45%), Query Frame = 2
Query:  614 LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSP-SDKEFQILAIA-------NFDREEKSMEKVDILCKDQAY--NTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQI-DSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVD-LDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD----HKLVISACDKGKPPKCSNPLWVTIKVVKQHILIP 2638
            + + + D+NDNAP +      VS  E   N  +  T+    A DPD  +N+++ Y      G   N   K   D+S+ R   +      DRE  D Y + + A D+G+P ++ +  +++ + D NDN P F  A +Y   ++E+A +G    TVSA DAD   N ++TY I   + + +      G I V + +D +     +   V A D G P     +   E+ ++V D ND +P  + H+       +E A    E+I+      ++  D D G           N ++R   V+  S+  F I +I        N DRE      +++L  D       +  ++   + D NDN P FT   +   +    V +  V  V+A D+D   +  + + I  G E   F I +++G +     LDRE   K+ + + A DGG P  +    V + V+D ND  P F+ +     + E+ G GT+V  V+A+D D+ +N  + Y       ++   F+  S+LP   I                    Y LTV A  N +P  Y +   ++I ++D ND+ P F  S   +F++Q   S G  IG VEAVD  D+G N+ + Y+   GN  G F    +  ++++ S L  +DD    + + + A D G+ PK S+   V ++V ++++  P
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAE---NVDDGTTVITVTATDPDAGDNAKVSY--ATYGGSHGN---KFAIDASSGR---IYTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFP-ALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKATFSMNPVTGEITVGQRLDREG--ANYSIRVTATDLGTPP---LSASMEITVIVDDYNDHRPVFLSHIGTV--FIDENASPGTEIIT------LQAVDGDSG----------VNAEIRYAFVTGNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESNIV-TVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYSTGMITLNRAIAFKPFSALPNPNI--------------------YNLTVRA-RNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGS-GVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSL--RDDVNKTYYIRVRASDMGQ-PKMSDTAGVYVEVTERNLHPP 632          

HSP 2 Score: 162.925 bits (411), Expect = 2.164e-40
Identity = 197/771 (25.55%), Postives = 330/771 (42.80%), Query Frame = 2
Query:  356 IQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLN-VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKS--IVFQILDRNDNSPKFT-RVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDR-DLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTE----SVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVL--SKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHI 2629
            + I E   +GT +  +T    +   +   SY  + G+   N   ID  +  +      DRE+     IN  +      +PS  S  +  V + D NDN+P +P    V    E   +     +I    A D D+ EN+++ Y +      T         +  T    E+   + +DRE  + Y + + A D G+P  + S+E+ + + D ND+ P+F  +      + ENA+ G   +T+ A D D   N +I Y      ++  F I +  G +   +N+D +   + F   VLA D G P   RK     V +++ D ND +P   +         +E A   +E +  S +  +  +D D G    V+  ++   +  L  ++ +     I   A  DRE KS   + +   D      S    ++  +LD+ND++P FT      +V E+       + +V AVD D   N+ + +           I  +  +  K          +N+T+ A++   P       + IEV+D ND  P F  S+Y     ++AG G S+G V A+D+ D   N  ++Y  IS   +            F+ +  + GE++    L  +    Y + V A D G P   + T  V + + + N + P F   +K V+  QT+E    +VG  + TV A D DFG N EI Y I  GN   YF     N  L ++  L    Q+++ L +SA D GK PK S   + T+++  + +
Sbjct:   22 VSIAENVDDGTTVITVTATDPDAGDNAKVSYATYGGSHG-NKFAIDASSGRIYTTGTFDRETKDDYSIN--VTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAE---DAAVGASIGTVSASDADIGENARLTYSIVSPEKAT------FSMNPVTG---EITVGQRLDREGAN-YSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVF-LSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTINSITGRLRTARNLDRETTPR-FTLEVLAYDLGVP---RKDSVTNVTVVLRDVNDNQPVFTM---------SEYAAEVSEGVVESNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGI--TAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVI-KVSAVDGDVGSNADVTYST-------GMITLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGR----------FR-VAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPK-MSDTAGVYVEVTERNLHPPVF---SKAVY--QTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNSQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTS---YATVRITLRDV 732          

HSP 3 Score: 149.443 bits (376), Expect = 2.552e-36
Identity = 177/670 (26.42%), Postives = 289/670 (43.13%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLR---FFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSEN---ANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDK-DAERNSKIEFQII-GNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGN 2461
              ++P T  +TV  R+DRE       N  I +        P   S  + V + D ND+ P +      V   E      E  T+   +A D D   N++I Y      G ++N       +S T R   L   + +DRE    + L ++A D G P++     + + + D NDN P+F  ++Y A ++SE    +NI    +TV A+D D  ++G +TY I   +    F I  N G I +   +D +   K +   V A DG       + E +V++ V+D+ND  P     V     LT +   ++ +  S + +  +   D D G    V+ S       R     P        A+ N +    ++   +I      +  A  +I  ++LD ND++P F +  +       +   + +G V AVDK D   N+ + ++ I GN    F++   +G++     L  +  + + + + A D G P  + T  V +EV + N   P FS ++Y+ S +E+  +G+++ TVTA DRD   N ++ Y II+   + + YF          I    G +     LD E Q +Y L V A D G     TS  TV+I + DVNDN P F          + T      + +V A D D      + Y I  G+
Sbjct:  167 FSMNPVTGEITVGQRLDREGA-----NYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITL---QAVDGDSGVNAEIRYAFV--TGNSNN---SFTINSITGR---LRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAA-EVSEGVVESNI----VTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSK-YTLRVQATDGGSPAL--SSEADVIVNVLDQNDHAP-----VFTPATLTVK---VQEDTGSGTTVIKVSAVDGDVGSNADVTYSTGMITLNRAIAFKP------FSALPNPNIYNLTVRARNIY---PPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAG--NSQEYFG---------IGLTNGSLYVSKPLDYEHQENYSLNVSATDGGK-EPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGS 783          

HSP 4 Score: 120.553 bits (301), Expect = 2.386e-27
Identity = 178/769 (23.15%), Postives = 314/769 (40.83%), Query Frame = 2
Query:  395 EVLTKYLKNNIVSV-----------STSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKS-LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDA-DYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVIS-NSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRV-FHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN--EEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGG-------DPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVA---IDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTES--VGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQD--DHKLVISACDKGKPPKCSNPLWV 2602
            EV    +++NIV+V           S +Y I  G +      I+  T  + +  ++DRE+   ++    +      SP+  S++ + V +LD ND+AP +   +  V   E  G+     T+    A D DV  N+ + Y           G+  +      +R I   P   +     ++Y L + A +   P       + I++LD ND+ P+F ++ Y    + ++A  G     V A D  DY  N  + Y       +  F +    G +++  ++  D   K +   V A D G P+     G   V + V + N   P     V +           ENE I+  S L  +   D DFG    +S  +   +      +  ++    +    +++ +E     V      +   T+  ++   + D NDN+P F+ + +   + EN +  ++ V  V A D+D      + + I+G   ++ F   + +G++      D E T    + I AKD G       DPP +    V I +  +N++ P F  S++  +++ENA IG SV  V+A D+D   +  + Y ++      +  F   S+     +  D         LD E+     L V+A     N    S  +  T+ + + D ND  P F    K+V+S   TE   +G+ +  V AVD D  +   I Y I  GN    F  +     +   + L ++   +++L ++A D G PP   N   V
Sbjct:  336 EVSEGVVESNIVTVVAEDRDIGSDGSVTYCITQGREG-GLFVINENTGTIGITAKLDRET--KSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGS---GTTVIKVSAVDGDVGSNADVTY---------STGMITL------NRAIAFKPFSALPNP--NIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAV-QDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVN-KTYYIRVRASDMGQPKMSDTAG---VYVEVTERNLHPPVFSKAVYQTS---------ENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNSQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPAS----VHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGS--DNQQGFDLDSNTGTLSVSGD---------LDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDP-PRFL---KSVYSAHVTEGSRIGHVVTNVTAVD-DDSDIRSIRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLV 1047          

HSP 5 Score: 110.923 bits (276), Expect = 1.704e-24
Identity = 135/507 (26.63%), Postives = 216/507 (42.60%), Query Frame = 2
Query:  872 KVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANI-GFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIA-NFDREEKSMEKVDILCKDQAYNT------ASKSIVFQILDRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQI-IGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDL-PANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVF 2353
            K +D E  + Y L + A D G   +T    + I + D NDN P+F   +Y   +L+EN      V  +V A D D      + Y I      + F I    G I      D++  +  F       +G   +        V I++   N+  P  +  V           + EN  I +SVL  +   D D G   +V   L  +D    +Q    D     L+++ + D E   +  + ++ K+   N+      A  +IV  + D ND  P+F + V+   V E + + ++ V  V AVD D++  S I + I  GN  + F +D+ +G + T   LDRE   ++ +T+ A D G PP TG   + + + DIND  P  +       ++EN   GT V T+ A D DL P     KY I    +     F+ + S          G + T   LDREKQ  Y +++   D       ++     I++ D NDN P  K +++ V+
Sbjct:  695 KPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRC-ELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFT-------ATVAENAPIGHSVL-RVSATDKDKGPDGVVLYHLLGSDN---QQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSRIGHV-VTNVTAVDDDSDIRS-IRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGS---FRLNVS---------SGVVSTVKSLDREKQDAYNISIKVTD---ARGLSAVNFCMIHVEDQNDNRP--KATSRDVY 1169          
BLAST of Protocadherin 1b vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 256.529 bits (654), Expect = 1.978e-70
Identity = 214/738 (29.00%), Postives = 349/738 (47.29%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFIS-------PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQ--KASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI----IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPS----DKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF-KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRE+L  C + +      L F +S       PS       +E+ DINDN P +P     +S  E   N +      I  A D D   N   DY L    G     ++ ++  D    +  +L+ +  +DRE  D Y+L + A D G+P+R     L + + D NDN P F+   Y A ++SEN+ +G   L V A D+D   NG+I Y +        +   I    G I V+  +D +  +    F V+A D  P+   K+ +  V I V D+ND  P +    I  VT  + + N    I  ++   + +A ++V D D G   +V+C ++ +   +L   S S     +++ +      D E     +V+I+  D      +++ S+  Q+ D NDNSP F+           + P   + +V A D D+  N+++ + I+G+   +  F+ID ++G++  +  LDRE  E++   + A D G P   GT  V I+V+D ND  P+F LS Y FS+ EN    + VG VT +D D   N  +   +  D  +F               ++++  G I++    DREK+S Y   + A+D G P   +S   V IN++D NDN P   K SN +   +    S    +  VEA DLD G N+++V+ I  GNPY  F  +  + ++ L   ++++    H+LV+   D+GKPP+ +  L
Sbjct:   63 LRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPE---NTIMGALFSIPLATDRDSERNGVADYALT--AGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEA-EVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREE-INSLSFYVVARDKGPQP--KSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIAN----ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKF---------------VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATAL 771          

HSP 2 Score: 115.931 bits (289), Expect = 9.386e-26
Identity = 138/509 (27.11%), Postives = 225/509 (44.20%), Query Frame = 2
Query:  479 CLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKS-LNVEILDINDNAPSWPQQS-KVVSFTEFEGNKLESRTIHIDKAF----DPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTS----RRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRI-EDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK--SIVFQILDRNDNSPKFTRVFH--FRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEV 1948
             L ID  T ++ VK  +DRE +  N ++  ++ R        SK+ + +E+ D NDNAP+   +   +V+ +E   N  E   +    A     D D  EN+ +   +        +  ++++  S ++    R+  L     +D E+V  Y + ++A D+G+P  + +  L +Q+ D NDN P+F    +  +   EN   G   L V+A DAD   N ++ Y I  D      F I  N G +  R  +D +   + ++F V A D G+P      G   VVI V+D ND  P+ ++       L N P +        S +  + V D D G    V  S+  +    + Q    +    IL+  +FDRE++S     +   D      S    +   +LD NDN P  T+  +  FR L   + P+  V  V A D D+  N+ + F I G N    F+I  SSG++   + + R+      + +   D G PP+  T LV I V
Sbjct:  293 LLRIDRTTGIIYVKGPLDREEI--NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVV------AGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEEN-QPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKER-YEFRVTAADKGSPVH---KGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPL--------SPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ----NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 3 Score: 54.299 bits (129), Expect = 8.836e-7
Identity = 73/296 (24.66%), Postives = 120/296 (40.54%), Query Frame = 2
Query:  338 SITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSY-VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGK--TDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYA-NKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAG 1210
            S T  ++   EE + G  I  +T    ++  +    Y I   + +     IDP T  V  +  +DRE     +       +   SP +  + ++ +++LD NDN P +       SF+  E N      + +    D D  EN+ +   ++   GK    NG   I   SS S           DRE+   Y   L A D G P R+  + + I +LD+NDN P+  +    +  +LS  A+       V A+D D   N  + + I      + F I  ++G I + K +    G
Sbjct:  471 SPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKG--SPVHKGTATVVIKVLDCNDNDPKF--MLSGYSFSVLE-NMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTIL--SSIS----------FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHG 749          
BLAST of Protocadherin 1b vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 256.914 bits (655), Expect = 1.005e-69
Identity = 214/738 (29.00%), Postives = 349/738 (47.29%), Query Frame = 2
Query:  482 LHIDPETH-VVTVKNRIDRESL--CPNQINCD-IMLRFFIS-------PSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKY-DSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQ--KASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI----IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPS----DKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE--EHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTF-KTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRE+L  C + +      L F +S       PS       +E+ DINDN P +P     +S  E   N +      I  A D D   N   DY L    G     ++ ++  D    +  +L+ +  +DRE  D Y+L + A D G+P+R     L + + D NDN P F+   Y A ++SEN+ +G   L V A D+D   NG+I Y +        +   I    G I V+  +D +  +    F V+A D  P+   K+ +  V I V D+ND  P +    I  VT  + + N    I  ++   + +A ++V D D G   +V+C ++ +   +L   S S     +++ +      D E     +V+I+  D      +++ S+  Q+ D NDNSP F+           + P   + +V A D D+  N+++ + I+G+   +  F+ID ++G++  +  LDRE  E++   + A D G P   GT  V I+V+D ND  P+F LS Y FS+ EN    + VG VT +D D   N  +   +  D  +F               ++++  G I++    DREK+S Y   + A+D G P   +S   V IN++D NDN P   K SN +   +    S    +  VEA DLD G N+++V+ I  GNPY  F  +  + ++ L   ++++    H+LV+   D+GKPP+ +  L
Sbjct:  140 LRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPE---NTIMGALFSIPLATDRDSERNGVADYALT--AGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEA-EVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREE-INSLSFYVVARDKGPQP--KSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIAN----ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKF---------------VVQNGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATAL 848          

HSP 2 Score: 117.087 bits (292), Expect = 5.998e-26
Identity = 138/508 (27.17%), Postives = 225/508 (44.29%), Query Frame = 2
Query:  482 LHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKS-LNVEILDINDNAPSWPQQS-KVVSFTEFEGNKLESRTIHIDKAF----DPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTS----RRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRI-EDQKASEYFNIG-NNGNIMVRKNIDYDAGVKGFQFSVLAID-GAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASK--SIVFQILDRNDNSPKFTRVFH--FRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG-NEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEV 1948
            L ID  T ++ VK  +DRE +  N ++  ++ R        SK+ + +E+ D NDNAP+   +   +V+ +E   N  E   +    A     D D  EN+ +   +        +  ++++  S ++    R+  L     +D E+V  Y + ++A D+G+P  + +  L +Q+ D NDN P+F    +  +   EN   G   L V+A DAD   N ++ Y I  D      F I  N G +  R  +D +   + ++F V A D G+P      G   VVI V+D ND  P+ ++       L N P +        S +  + V D D G    V  S+  +    + Q    +    IL+  +FDRE++S     +   D      S    +   +LD NDN P  T+  +  FR L   + P+  V  V A D D+  N+ + F I G N    F+I  SSG++   + + R+      + +   D G PP+  T LV I V
Sbjct:  371 LRIDRTTGIIYVKGPLDREEI--NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVV------AGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEEN-QPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKER-YEFRVTAADKGSPVH---KGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPL--------SPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ----NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 3 Score: 55.0694 bits (131), Expect = 5.676e-7
Identity = 73/296 (24.66%), Postives = 120/296 (40.54%), Query Frame = 2
Query:  338 SITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSY-VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGK--TDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYA-NKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIG-NNGNIMVRKNIDYDAG 1210
            S T  ++   EE + G  I  +T    ++  +    Y I   + +     IDP T  V  +  +DRE     +    +      SP +  + ++ +++LD NDN P +       SF+  E N      + +    D D  EN+ +   ++   GK    NG   I   SS S           DRE+   Y   L A D G P R+  + + I +LD+NDN P+  +    +  +LS  A+       V A+D D   N  + + I      + F I  ++G I + K +    G
Sbjct:  548 SPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHK--ERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKF--MLSGYSFSVLE-NMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTIL--SSIS----------FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHG 826          
BLAST of Protocadherin 1b vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 248.825 bits (634), Expect = 8.925e-68
Identity = 217/734 (29.56%), Postives = 345/734 (47.00%), Query Frame = 2
Query:  482 LHIDPET-HVVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN---------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRI-ELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQK--ASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPS----DKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYF--SFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRE+L  C N    D   L F +S + + K +          +E+LDINDN P +      +S  E   N        I  A D D   N   +Y L    G   N ++ ++       +I +++ I  +DRE+ D Y+L +   D G P R  S  L I + D+NDN P F++ +Y A +L EN+  G   L V A DAD  ANG I Y +            I  +  I+  K +         +F V+A D  P    K+ + +V I + D+ND  P I +         N  A I  ++   + +A ++V D D G   +V+C ++ +   +L   S S     +++ +      D E     +++I+  D      +++ S+  Q+ D NDN+P F+           + P   V +V+A D D+  N+++ + II  +    F+I+S +G++  +  LDRE+ E++   + A D G P KTGT +V I V D ND  P+F LS Y FS++EN      VG VT  D D   N+++   +  D  +F               +I++  G I++    DREK+S Y   + A+D G P   +S   V IN++D NDN P   K +N +   ++ +      +  V+A D+D G N+E+ Y I  GNP+G F  S N+   KL        +  H+LV+   DKGKPP+ +  L
Sbjct:   80 LRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPE---NTHTGTLFSIPVAVDRDSGSNGVAEYALS--AGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEA-ELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNS--KSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKF---------------IIQNGTGTILSSISFDREKESTYTFRLKAVDAGDP-PRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTAL 789          
BLAST of Protocadherin 1b vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 249.595 bits (636), Expect = 1.879e-67
Identity = 217/734 (29.56%), Postives = 345/734 (47.00%), Query Frame = 2
Query:  482 LHIDPET-HVVTVKNRIDRESL--CPNQINCD-IMLRFFISPSYVSKSLN---------VEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRI-ELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQK--ASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPS----DKEFQILAIANFDREEKSMEKVDILCKDQAYN--TASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQII-GNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISD--RFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP-TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYF--SFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPL 2596
            L +D +T  + T +  IDRE+L  C N    D   L F +S + + K +          +E+LDINDN P +      +S  E   N        I  A D D   N   +Y L    G   N ++ ++       +I +++ I  +DRE+ D Y+L +   D G P R  S  L I + D+NDN P F++ +Y A +L EN+  G   L V A DAD  ANG I Y +            I  +  I+  K +         +F V+A D  P    K+ + +V I + D+ND  P I +         N  A I  ++   + +A ++V D D G   +V+C ++ +   +L   S S     +++ +      D E     +++I+  D      +++ S+  Q+ D NDN+P F+           + P   V +V+A D D+  N+++ + II  +    F+I+S +G++  +  LDRE+ E++   + A D G P KTGT +V I V D ND  P+F LS Y FS++EN      VG VT  D D   N+++   +  D  +F               +I++  G I++    DREK+S Y   + A+D G P   +S   V IN++D NDN P   K +N +   ++ +      +  V+A D+D G N+E+ Y I  GNP+G F  S N+   KL        +  H+LV+   DKGKPP+ +  L
Sbjct:   80 LRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPE---NTHTGTLFSIPVAVDRDSGSNGVAEYALS--AGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEA-ELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNS--KSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKF---------------IIQNGTGTILSSISFDREKESTYTFRLKAVDAGDP-PRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTAL 789          
BLAST of Protocadherin 1b vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 244.588 bits (623), Expect = 2.553e-66
Identity = 216/719 (30.04%), Postives = 341/719 (47.43%), Query Frame = 2
Query:  506 VVTVKNRIDRESLCPNQ----INCDIMLRFFISPSYVSKSLNVEIL--DINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQ---KASEYFNIGN-NGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEI-----------IVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFP--TFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDD--HKLVISACDKGKP 2575
            + T  NRIDRE LCP        C   +   + P+   + + ++I+  D NDNAP +P  S V++ +  E   + SR   I  A DPD   NS   Y L   NG++  G+  I       +  +L+  + +DREQ D Y + +  ED GSP+++ +  L + + D NDN P+F R       + EN+ IG   + + A DAD   N +I Y    Q        F + + +G I V++ +D +      + SVLA DG+    R T    V+I V D ND  P I            V ++++DP+  + A+I            +  KD D  G+  V C +  +    L+ V   D ++ +   A  D E        I+  D    + +++ + ++   D NDN P FT+ V    V+EN    ++F+  + A D+D+ +N++I +Q+ G    FF +D  +G +   +V DRE+ ++F  T+ A+D G PP      V + V+D ND  P+F+ + ++F +SEN    ++VG +T  D D   N  +   I++D    E++       PF       G I +    DRE+QS Y   V AID+G P   +S   V IN+IDVNDN P   +  SN +   +  +   G  +  V AVD D G N+E+ Y I  GN  G F  +     + L    +  D   H+LV++  D G P
Sbjct:   85 IFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFP--SPVINISIPENTLINSR-FAIPSATDPDTGPNSVHKYELI--NGQSAFGL-DIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVF-RENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAI-HKLSVLASDGSSSPARAT----VIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALIT-----------VSDKDTDINGK--VICFIEKDVPFHLKAVY--DNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKR-DLFLTTLSATDEDSGKNAEIVYQL-GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILND---NENFILD----PFS------GVIKSNVSFDREQQSSYTFDVRAIDSGRP-PCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          
BLAST of Protocadherin 1b vs. Planmine SMEST
Match: SMESG000043679.1 (SMESG000043679.1)

HSP 1 Score: 2076.21 bits (5378), Expect = 0.000e+0
Identity = 1025/1028 (99.71%), Postives = 1027/1028 (99.90%), Query Frame = 2
Query:  299 MITFAAWILLLISSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVFXXXXXXXXXXXXXXXXXCAIVFKNRICTQLNQNGNHVLTDSNTLEITNRKINIPNDIQRNPTMHSLSYVDPVMMSQQRNANNQQQIYVHSRERQISSDYQSIEERSPSYKQSTQFAWDSASLLQVPLNDQTDQIMYGQNRSTCGKEYYYPEHSQYRSPPIAYGFHGNPPTSYVIRNNQAPKDPQFQQDTFPRNAPHKLYSSLLNVQTINSQPEPTYMYKSLRKGKNNASFV 3382
            MITFAAWILLLISSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPK+TGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVFIISVLVILLLIIIILIICAIVFKNRICTQLNQN NHVLTDSNTLEITNRKINIPNDIQRNPTMHSLSYVDPVMMSQQRNANNQQQIYVHSRERQISSDYQSIEERSPSYKQSTQFAWDSASLLQVPLNDQTDQIMYGQNRSTCGKEYYYPEHSQYRSPPIAYGFHGNPPTSYVIRN+QAPKDPQFQQDTFPRNAPHKLYSSLLNVQTINSQPEPTYMYKSLRKGKNNASFV
Sbjct:    1 MITFAAWILLLISSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPSYVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKKTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVFIISVLVILLLIIIILIICAIVFKNRICTQLNQNSNHVLTDSNTLEITNRKINIPNDIQRNPTMHSLSYVDPVMMSQQRNANNQQQIYVHSRERQISSDYQSIEERSPSYKQSTQFAWDSASLLQVPLNDQTDQIMYGQNRSTCGKEYYYPEHSQYRSPPIAYGFHGNPPTSYVIRNSQAPKDPQFQQDTFPRNAPHKLYSSLLNVQTINSQPEPTYMYKSLRKGKNNASFV 1028          
BLAST of Protocadherin 1b vs. Planmine SMEST
Match: SMESG000034072.1 (SMESG000034072.1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.123e-118
Identity = 266/792 (33.59%), Postives = 410/792 (51.77%), Query Frame = 2
Query:  302 ITFAAWILLLISSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQIN--CDIMLRFFISPSYVSKS--LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANK-LSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS----EYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH-----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG---NEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTS-NKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVK 2620
            I    +IL+  S       +I EE   GT++  ++K+L++ I S      I D N    C+ I  +T +  +K RIDRE+LC +  +  C   +R     +Y  +   L  EILDINDN P WP     + + E      E ++I +  A+D D+ EN+ I Y+L+      DN  + ++   ++  R+ L P   +D E    + + ++AED G P  + +L + + ++D NDN P F +  ++ N+ + E  ++  + L V+A D D   NG+I Y I+         ++F   + G + ++K +DYD G K ++F V+A D AP  Y  +    V I V D NDE P+I ++     V+ R   T    I EN     S LAHI+++D D   +  + CSL N +  RL       K F + A  +FDRE +  E V I C+D   N  SK+I+  + D+NDN PKF   F+F V EN S  N  +G+V A+DKD  +N+++ + II      +  F+IDS +GKMY    LDREE + +N+T++A D G+P  TGTG + I V DIND  P F    Y F I E+A + + VG V A DRD+  N ++ Y  +SD F   S  + ++   FQ I+ D GEI+    LDRE +  Y + + AI+  +P  +++T +  I ++D NDN P F    N ++ SI T +S+G EI    A D D  +N+E+ Y I        F+ +  +  L L   +      +L +  CD G P KCS  L + +   K
Sbjct:    4 IGLLLFILIKYSQTMKNYFRITEEEPIGTDLFEVSKFLRDKIKSEYRFTVIGDPN-FSECISIQDKTGMTKIKKRIDRETLCADNQDGKCVKSIRLIFKNTYRKEGVDLEFEILDINDNRPMWPTNVVELLYPE----STEKQSIKLAIAYDKDIGENAMIKYYLQP--IYHDNLNFNLE---NSENRLILTPKFDVDYETKRFFNITIVAEDRGRPVLSSTLNVKVTVIDINDNRPQFIQNVFHPNQAVYETTSVEAIILKVTAIDKDSEQNGRINYYIDPSMPQFIRDQFFLDSDTGELKLKKPLDYDRGHKSYKFIVIAKDSAPAPYELSSSATVEIQVADVNDEIPQINMYFTTPFVSDRYNGTVHINIPENMNPQQSDLAHIQIEDTDEDDKSFIDCSLDNKESFRLISDINKVKSFILSASKSFDRENQQTEHVRITCRDNGKNENSKNIIINVTDKNDNPPKFAHKFNFNVNENTSYRNRDIGQVEAIDKDLGKNAELRYTIINVQPRSDARFRIDSFTGKMYIDAPLDREEQDHYNITVIAVDQGEPSLTGTGNILILVEDINDMPPVFETVEYRFQIPEDASVNSKVGVVQATDRDIGKNARISYHFLSDAFPY-SLHRTNAFEKFQ-IKKDSGEIMITSKLDRETKPSYSIIIEAINVVNPRKFSATVSATITVLDCNDNAPKFTAPINNSLISIDTEKSIGTEIALFRATDADENKNAELTYSIVRATDPYVFNLDYTSGILFLAKKIEGFRKLRLTVRVCDSGLPQKCSEDLMIIVTTTK 783          
BLAST of Protocadherin 1b vs. Planmine SMEST
Match: SMESG000034072.1 (SMESG000034072.1)

HSP 1 Score: 394.43 bits (1012), Expect = 2.239e-118
Identity = 265/792 (33.46%), Postives = 412/792 (52.02%), Query Frame = 2
Query:  302 ITFAAWILLLISSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQIN--CDIMLRFFISPSYVSKSLNVE--ILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANK-LSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS----EYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH-----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG---NEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTS-NKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVK 2620
            I    +IL+  S       +I EE   GT++  ++K+L++ I S      I D N    C+ I  +T +  +K RIDRE+LC +  +  C   +R     +Y  + +++E  ILDINDN P WP     + + E      E ++I +  A+D D+ EN+ I Y+L+      DN  + ++   ++  R+ L P   +D E    + + ++AED G P  + +L + + ++D NDN P F +  ++ N+ + E  ++  + L V+A D D   NG+I Y I+         ++F   + G + ++K +DYD G K ++F V+A D AP  Y  +    V I V D NDE P+I ++     V+ R   T    I EN     S LAHI+++D D   +  + CSL N +  RL       K F + A  +FDRE +  E V I C+D   N  SK+I+  + D+NDN PKF   F+F V EN S  N  +G+V A+DKD  +N+++ + II      +  F+IDS +GKMY    LDREE + +N+T++A D G+P  TGTG + I V DIND  P F    Y F I E+A + + VG V A DRD+  N ++ Y  +SD F   S  + ++   FQ I+ D GEI+    LDRE +  Y + + AI+  +P  +++T +  I ++D NDN P F    N ++ SI T +S+G EI    A D D  +N+E+ Y I        F+ +  +  L L   +      +L +  CD G P KCS  L + +   K
Sbjct:   43 IGLLLFILIKYSQTMKNYFRITEEEPIGTDLFEVSKFLRDKIKSEYRFTVIGDPN-FSECISIQDKTGMTKIKKRIDRETLCADNQDGKCVKSIRLIFKNTYRKEGVDLEFEILDINDNRPMWPTNVVELLYPE----STEKQSIKLAIAYDKDIGENAMIKYYLQPI--YHDNLNFNLE---NSENRLILTPKFDVDYETKRFFNITIVAEDRGRPVLSSTLNVKVTVIDINDNRPQFIQNVFHPNQAVYETTSVEAIILKVTAIDKDSEQNGRINYYIDPSMPQFIRDQFFLDSDTGELKLKKPLDYDRGHKSYKFIVIAKDSAPAPYELSSSATVEIQVADVNDEIPQINMYFTTPFVSDRYNGTVHINIPENMNPQQSDLAHIQIEDTDEDDKSFIDCSLDNKESFRLISDINKVKSFILSASKSFDRENQQTEHVRITCRDNGKNENSKNIIINVTDKNDNPPKFAHKFNFNVNENTSYRNRDIGQVEAIDKDLGKNAELRYTIINVQPRSDARFRIDSFTGKMYIDAPLDREEQDHYNITVIAVDQGEPSLTGTGNILILVEDINDMPPVFETVEYRFQIPEDASVNSKVGVVQATDRDIGKNARISYHFLSDAFPY-SLHRTNAFEKFQ-IKKDSGEIMITSKLDRETKPSYSIIIEAINVVNPRKFSATVSATITVLDCNDNAPKFTAPINNSLISIDTEKSIGTEIALFRATDADENKNAELTYSIVRATDPYVFNLDYTSGILFLAKKIEGFRKLRLTVRVCDSGLPQKCSEDLMIIVTTTK 822          
BLAST of Protocadherin 1b vs. Planmine SMEST
Match: SMESG000034072.1 (SMESG000034072.1)

HSP 1 Score: 392.119 bits (1006), Expect = 4.744e-118
Identity = 262/773 (33.89%), Postives = 404/773 (52.26%), Query Frame = 2
Query:  359 QIFEEPKNGTEIEVLTKYLKNNIVSVSTSYRIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQIN--CDIMLRFFISPSYVSKS--LNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANK-LSENANIGFVALTVSAKDADYLANGKITYRIEDQKAS----EYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVH-----VTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIG---NEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTSTTTVKINIIDVNDNFPTFKTS-NKTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLVISACDKGKPPKCSNPLWVTIKVVK 2620
            +I EE   GT++  ++K+L++ I S      I D N    C+ I  +T +  +K RIDRE+LC +  +  C   +R     +Y  +   L  EILDINDN P WP     + + E      E ++I +  A+D D+ EN+ I Y+L+      DN  + ++   ++  R+ L P   +D E    + + ++AED G P  + +L + + ++D NDN P F +  ++ N+ + E  ++  + L V+A D D   NG+I Y I+         ++F   + G + ++K +DYD G K ++F V+A D AP  Y  +    V I V D NDE P+I ++     V+ R   T    I EN     S LAHI+++D D   +  + CSL N +  RL       K F + A  +FDRE +  E V I C+D   N  SK+I+  + D+NDN PKF   F+F V EN S  N  +G+V A+DKD  +N+++ + II      +  F+IDS +GKMY    LDREE + +N+T++A D G+P  TGTG + I V DIND  P F    Y F I E+A + + VG V A DRD+  N ++ Y  +SD F   S  + ++   FQ I+ D GEI+    LDRE +  Y + + AI+  +P  +++T +  I ++D NDN P F    N ++ SI T +S+G EI    A D D  +N+E+ Y I        F+ +  +  L L   +      +L +  CD G P KCS  L + +   K
Sbjct:    6 RITEEEPIGTDLFEVSKFLRDKIKSEYRFTVIGDPN-FSECISIQDKTGMTKIKKRIDRETLCADNQDGKCVKSIRLIFKNTYRKEGVDLEFEILDINDNRPMWPTNVVELLYPE----STEKQSIKLAIAYDKDIGENAMIKYYLQP--IYHDNLNFNLE---NSENRLILTPKFDVDYETKRFFNITIVAEDRGRPVLSSTLNVKVTVIDINDNRPQFIQNVFHPNQAVYETTSVEAIILKVTAIDKDSEQNGRINYYIDPSMPQFIRDQFFLDSDTGELKLKKPLDYDRGHKSYKFIVIAKDSAPAPYELSSSATVEIQVADVNDEIPQINMYFTTPFVSDRYNGTVHINIPENMNPQQSDLAHIQIEDTDEDDKSFIDCSLDNKESFRLISDINKVKSFILSASKSFDRENQQTEHVRITCRDNGKNENSKNIIINVTDKNDNPPKFAHKFNFNVNENTSYRNRDIGQVEAIDKDLGKNAELRYTIINVQPRSDARFRIDSFTGKMYIDAPLDREEQDHYNITVIAVDQGEPSLTGTGNILILVEDINDMPPVFETVEYRFQIPEDASVNSKVGVVQATDRDIGKNARISYHFLSDAFPY-SLHRTNAFEKFQ-IKKDSGEIMITSKLDRETKPSYSIIIEAINVVNPRKFSATVSATITVLDCNDNAPKFTAPINNSLISIDTEKSIGTEIALFRATDADENKNAELTYSIVRATDPYVFNLDYTSGILFLAKKIEGFRKLRLTVRVCDSGLPQKCSEDLMIIVTTTK 766          
BLAST of Protocadherin 1b vs. Planmine SMEST
Match: SMESG000027424.1 (SMESG000027424.1)

HSP 1 Score: 311.997 bits (798), Expect = 2.155e-89
Identity = 242/738 (32.79%), Postives = 372/738 (50.41%), Query Frame = 2
Query:  464 NKLLNCLHIDPETHVVTVKNRIDRESLCP-----------NQINCDIMLRFFI---SPSY-VSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDPDVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVDVYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENANIGFVALTVSAKDADYLANGKITYRIED---QKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDRNDNSPKFTRVFH-FRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNEEHFFQID-SSGKMYTKQVLDREETEKFNVTILAKDG-GDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRD-LPANTKMKYRIISDRFSKESYFQYSS-SLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAID-NGHP---NSYTSTTTVKINIIDVNDNFPTFKTSN--KTVFSIQTTESVGYEIGTVEAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSK-----QDDHKLVISACDKGKP 2575
            ++ + C  I+    +V V  RIDR+ +C            ++I  +   + FI   SPS  +   + + I DINDN PSW  Q   V F   +G K E   + +  AFD D+ +N+QI+Y  K+R+         + +   T     L  ++ +DREQ + Y   LIA D G+P +TG +E+ + I D NDN PIF +  Y    +SE++ +G +   + A DAD   NGK  ++  +   +    YF I ++G ++V   +D D G    +F V+  D A   Y K+ +  V + + D NDEKPE+ +     D  TN+P ++E+  I  +++  +EV D D+  +D VSC++ N+    + +  P   +++I    +FDRE+ +   + I C+D   N AS +    I D NDN P FT+ F+  ++ EN  V  M   +++A D D+E  S I++ I       F ID  +G + T    DRE    + + ++AKD   +P  TGT  V + ++D ND KP F+   Y F I EN    T+VG V A D D   + + + YR+           +YSS + PF+ I    G I     LDREK++ Y   V   D N +P   N+ TS+ TV I+  DVNDN P F   N  K+ F I   ++VG++I  V A D D  +NS I Y I  GN    FS ++    L+L+  L       Q  + L ++ACD GKP
Sbjct:   51 DRFVKCFKINMNGQLV-VARRIDRDQMCEKSTSQPIYTKNSRITPEEECKIFINVASPSLNIMTKVVITIEDINDNIPSWNLQRIEVKF--IDGCK-ERTKVSLPPAFDKDIGQNAQIEYSFKERD---------LPFRLDTEDGFYLQTLQTLDREQKESYTFTLIASDKGNPVQTGEIEVHVVIEDLNDNSPIFSKPIYRFKAVSEDSAVGTIIGKLEASDADSGVNGKFNFKFAEAVPEIVKHYFQIQSDGTVIVAAPLDSDRGNNELKFKVVVEDEALRPYSKSSDATVYVYINDVNDEKPELKLIFMNHDSRTNKPFVVEHTKIG-TLIGILEVTDRDYNNKDTVSCNVDNSQFALISEDRPV--KYKITTNMDFDREKMTTADLRIFCRDSVGNLASSNHSINIKDINDNPPNFTKSFYVMKIKENQPVHTMLPSKLVATDPDSE--STIQYFISPEYSSNFSIDRETGIISTLVSFDREICASYTIKVIAKDSIKEPINTGTCTVQVIILDENDNKPVFTHEFYTFHIPENNFPNTAVGIVKATDLDEQDSQSSLSYRL-----------EYSSKTRPFK-INSRSGAITAIITLDREKETFYSFIVYVEDGNDYPMKRNTVTSSVTVVID--DVNDNSPKFIIPNATKSSFDISIKDTVGHKIINVYAEDADVSDNSRIYYNITAGNDENIFSIDSATGLLLLSDSLQSNQQKPQPHYTLSVTACDYGKP 756          

HSP 2 Score: 82.8037 bits (203), Expect = 1.128e-15
Identity = 79/269 (29.37%), Postives = 132/269 (49.07%), Query Frame = 2
Query: 1514 DKEFQILA-IANFDREEKSMEKVDILCKD---QAYNTASKSIVFQILDRNDNSPKFTRVFH-FRVLENASVPNMFVGEVMAVDKDAE-RNSKIEFQI-IGNEEHFFQIDS-SGKMYTKQVLDREETEKFNVTILAKDGGDPP---KTGTGLVTIEVVDINDWKPEF---SLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAIDNGHPNSYTST 2278
            D+E  I++ + +FDRE  +   + ++ KD   +  NT + ++   ILD NDN P FT  F+ F + EN + PN  VG V A D D +   S + +++   ++   F+I+S SG +     LDRE+   ++  +  +DG D P    T T  VT+ + D+ND  P+F   + +   F IS    +G  +  V A D D+  N+++ Y I +   + E+ F   S+    +         +     ++ Q HY L+V A D G P    +T
Sbjct:  503 DRETGIISTLVSFDREICASYTIKVIAKDSIKEPINTGTCTVQVIILDENDNKPVFTHEFYTFHIPEN-NFPNTAVGIVKATDLDEQDSQSSLSYRLEYSSKTRPFKINSRSGAITAIITLDREKETFYSFIVYVEDGNDYPMKRNTVTSSVTVVIDDVNDNSPKFIIPNATKSSFDISIKDTVGHKIINVYAEDADVSDNSRIYYNITAG--NDENIFSIDSATGLLL------LSDSLQSNQQKPQPHYTLSVTACDYGKPKQLCTT 762          

HSP 3 Score: 77.411 bits (189), Expect = 5.716e-14
Identity = 109/457 (23.85%), Postives = 181/457 (39.61%), Query Frame = 2
Query: 1100 ANGKITYRIEDQKASEYFNIGNNGNIMVRKNIDYDAGVKGFQFSVLAIDGA---PEEYRKTGECEVVIMVIDENDEKPEIIVHVTKRDPLTNEPAIIE--NEVISNSVLAHIEVK-----------------DPDFGGRDIVSCSLSNND-KMRLEQVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQIL--DRNDNSPKFTR-VFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGN----EEHFFQIDSSGKMYTKQVLDREETE---KFNVTILAKDGGDPPKTGTGLVTIEVVDINDWKPEFSLSLYEFS-------ISENAGIGTSVGTVTAIDRDLPANTKMKYRIISDRFSKESYFQYSSSLPFQMIRHDRG---EIVTKYLLDREKQSHYLLTVVAIDN-GHPNSYTSTTTVKINIIDVNDNFPTFKTS 2338
            + GK+  +  + +  + F I  NG ++V + ID D   +      +    +   PEE     EC++ I V       P + +       +T     IE  N+ I +  L  IEVK                 D D G    +  S    D   RL+    ++  F +  +   DRE+K      ++  D+     +  I   ++  D NDNSP F++ ++ F+ +   S     +G++ A D D+  N K  F+         +H+FQI S G +     LD +      KF V +  +      K+    V + + D+ND KPE  L             + E+  IGT +G +   DRD      +   + + +F+              +I  DR    +I T    DREK +   L +   D+ G+     +++   INI D+NDN P F  S
Sbjct:   40 SKGKLEIKNLNDRFVKCFKINMNGQLVVARRIDRDQMCEKSTSQPIYTKNSRITPEE-----ECKIFINV-----ASPSLNI-------MTKVVITIEDINDNIPSWNLQRIEVKFIDGCKERTKVSLPPAFDKDIGQNAQIEYSFKERDLPFRLD----TEDGFYLQTLQTLDREQKESYTFTLIASDKGNPVQTGEIEVHVVIEDLNDNSPIFSKPIYRFKAVSEDSAVGTIIGKLEASDADSGVNGKFNFKFAEAVPEIVKHYFQIQSDGTVIVAAPLDSDRGNNELKFKVVVEDEALRPYSKSSDATVYVYINDVNDEKPELKLIFMNHDSRTNKPFVVEHTKIGTLIGILEVTDRDYNNKDTVSCNVDNSQFA--------------LISEDRPVKYKITTNMDFDREKMTTADLRIFCRDSVGN----LASSNHSINIKDINDNPPNFTKS 457          
The following BLAST results are available for this feature:
BLAST of Protocadherin 1b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH14.480e-7529.81protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH16.704e-7529.81protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH98.138e-6229.36protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.766e-6129.36protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.899e-6129.36protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.223e-4128.06FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.458e-3828.01FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-15.774e-3827.34CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-13.057e-3425.37Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-13.057e-3425.37Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft1.350e-6229.20gene:FBgn0001075 transcript:FBtr0077478[more]
stan1.422e-5728.70gene:FBgn0024836 transcript:FBtr0330601[more]
stan1.462e-5728.70gene:FBgn0024836 transcript:FBtr0303223[more]
stan1.462e-5728.70gene:FBgn0024836 transcript:FBtr0088214[more]
stan1.626e-5728.70gene:FBgn0024836 transcript:FBtr0339463[more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT030123.15.764e-7129.51protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.797e-7029.08protocadherin 1b [Source:NCBI gene;Acc:572016][more]
pcdh1b2.814e-7029.36protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
CT030123.12.934e-7029.36protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.13.151e-7029.28protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh174.744e-6730.30protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.579e-6730.30protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh178.872e-6730.22protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.153e-6630.30protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.613e-6630.22protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11.848e-7429.71protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.848e-7429.71protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.943e-6929.88protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh91.519e-6129.18protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Fat42.413e-6128.29FAT atypical cadherin 4 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Protocadherin 1b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN2.152e-7429.81Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|P33450|FAT_DROME1.354e-6129.20Cadherin-related tumor suppressor OS=Drosophila me... [more]
sp|Q9HC56|PCDH9_HUMAN1.268e-6029.36Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q2PZL6|FAT4_MOUSE1.688e-6028.29Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fa... [more]
sp|Q5DRE1|PCDC2_PANTR6.601e-6027.62Protocadherin alpha-C2 OS=Pan troglodytes OX=9598 ... [more]
back to top
BLAST of Protocadherin 1b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3X5C42.211e-8427.97Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3SI411.574e-8329.10Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
R7VJZ41.921e-8231.31Uncharacterized protein (Fragment) OS=Capitella te... [more]
A0A2H5BFB84.266e-8032.17Pcd11x OS=Platynereis dumerilii OX=6359 PE=2 SV=1[more]
A0A210PLD87.963e-8031.24Protocadherin-11 X-linked OS=Mizuhopecten yessoens... [more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.058e-7229.30protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.060e-7229.38protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b5.249e-7128.86protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
ENSAMXT00000036470.12.965e-6528.10pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh93.018e-6429.58protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.16.945e-6327.10pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh113.656e-5827.85protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.16.728e-5827.33pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004042.13.854e-4826.26pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.14.598e-4826.26pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin 1b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354126.094e-6531.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461892.414e-6128.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404705.953e-5429.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.110e-5027.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354131.135e-5027.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin 1b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.978e-7029.00protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a1.005e-6929.00protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1b8.925e-6829.56protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b1.879e-6729.56protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh92.553e-6630.04protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
back to top
BLAST of Protocadherin 1b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043679.10.000e+099.71SMESG000043679.1[more]
SMESG000034072.11.123e-11833.59SMESG000034072.1[more]
SMESG000034072.12.239e-11833.46SMESG000034072.1[more]
SMESG000034072.14.744e-11833.89SMESG000034072.1[more]
SMESG000027424.12.155e-8932.79SMESG000027424.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000690 ID=SMED30000690|Name=Protocadherin 1b|organism=Schmidtea mediterranea sexual|type=transcript|length=3515bp
AGAGTAATTGAAAGATTTTAACAGTCATCTACACAATCCATCATCATCAC
ACAGGATGCACACAAACATTAGCACACAAGCTCTGAAAGCTTGTAGTCAA
TTGGTCGGTTTTATTTACTGTGTGTGTGTTGTGGTGTTGCCACAATGAAA
TTGAACTGTACAGTTTTTGGAAGTTTTTCAATGTTTGAGTACTCGTTTTG
ATTCTCTACGACAATGATTTTCTACGATTCCATTTACTGATTTTGTTGAT
TTCGACAATTGACTTGTTTTTCATTCCAATTTCAATTCGAATTTTTTAAT
GATTACTTTTGCCGCCTGGATTTTATTATTAATATCTTCTATTACTTGCG
AAAAAATCCAAATCTTTGAAGAACCAAAAAATGGTACAGAAATAGAAGTT
TTGACAAAATATTTAAAAAATAATATCGTCTCTGTTTCAACGTCTTATAG
GATTTTTGATGGTAACAAATTATTGAATTGCCTTCACATTGATCCGGAAA
CGCACGTAGTCACTGTGAAAAATCGAATTGACCGCGAATCTCTATGTCCC
AATCAAATCAATTGTGATATTATGCTTAGATTTTTTATCAGTCCCAGTTA
CGTTTCCAAATCACTGAATGTGGAAATATTGGACATCAATGACAATGCAC
CGTCTTGGCCGCAACAGTCTAAAGTTGTGTCTTTCACTGAATTCGAAGGA
AATAAATTAGAATCGAGAACTATACACATTGACAAAGCCTTTGATCCGGA
TGTGAATGAAAACAGTCAAATAGATTATTTTCTCAAAGATCGAAATGGCA
AAACCGATAATGGCGTTTGGAAGATCAAATATGACAGTTCAACTAGTCGA
AGAATTGAGTTGATGCCGATTAAGGTAATAGATCGAGAACAAGTCGACGT
CTATGAATTAATACTGATTGCAGAGGATAATGGATCTCCTAAAAGAACTG
GCAGCTTGGAGCTGATAATCCAGATATTGGATAAAAATGATAACGGCCCG
ATTTTTGATCGCGCGAAATATTACGCTAACAAACTTTCAGAGAACGCAAA
CATTGGATTTGTTGCTTTAACCGTGTCCGCGAAAGACGCAGATTATCTCG
CCAATGGGAAAATCACTTATAGAATCGAAGATCAAAAAGCATCGGAATAC
TTTAACATTGGAAACAATGGAAATATTATGGTTCGAAAGAATATTGATTA
TGATGCAGGAGTAAAAGGTTTTCAGTTTTCTGTTTTGGCTATCGACGGCG
CACCAGAAGAATACCGAAAGACCGGAGAATGTGAAGTTGTGATAATGGTT
ATTGATGAAAACGATGAAAAACCGGAAATAATAGTCCATGTAACTAAACG
AGATCCTCTCACAAATGAGCCGGCGATTATTGAAAATGAAGTCATTTCGA
ATTCGGTGTTGGCTCACATTGAAGTGAAAGATCCGGATTTCGGTGGCCGA
GACATAGTTAGTTGTTCATTATCCAACAATGACAAAATGCGACTTGAACA
AGTCAGTCCGAGCGATAAAGAATTTCAAATTCTCGCCATTGCCAATTTTG
ATCGAGAAGAAAAATCCATGGAAAAAGTCGATATTTTGTGTAAAGATCAA
GCTTACAACACCGCTTCAAAGTCGATTGTCTTTCAAATCCTCGATCGCAA
TGACAACTCTCCAAAATTCACGAGAGTCTTTCATTTTAGAGTATTAGAGA
ATGCCTCTGTTCCGAATATGTTTGTTGGTGAAGTGATGGCGGTTGATAAA
GATGCTGAAAGGAATTCGAAAATAGAATTTCAAATTATCGGAAATGAAGA
GCACTTCTTTCAAATTGATTCATCCGGAAAGATGTACACAAAACAGGTTT
TAGATCGAGAGGAAACAGAGAAATTCAACGTGACTATTTTAGCGAAAGAC
GGAGGAGACCCACCGAAAACTGGAACCGGTTTAGTCACTATTGAAGTCGT
CGACATCAATGATTGGAAACCGGAGTTTTCATTATCTCTATACGAGTTCA
GTATAAGTGAAAATGCTGGCATCGGAACGAGTGTCGGAACCGTAACTGCA
ATCGACAGAGATCTACCAGCAAACACTAAAATGAAATATCGAATAATTTC
TGATCGGTTTTCCAAAGAATCATACTTTCAGTATTCATCATCTTTACCAT
TTCAAATGATTCGGCATGACCGAGGAGAAATCGTAACAAAATATCTCCTC
GACCGTGAAAAGCAGAGCCATTATTTGCTGACAGTCGTCGCTATTGATAA
TGGCCATCCAAATTCGTATACATCGACAACAACAGTGAAAATCAACATCA
TAGATGTCAACGACAACTTTCCAACTTTCAAAACAAGCAACAAAACCGTA
TTTTCAATTCAAACTACCGAATCTGTCGGCTACGAAATCGGAACCGTAGA
GGCTGTGGATTTAGATTTCGGAGAAAATTCCGAAATCGTCTATCAAATCG
AAGAAGGAAACCCGTACGGATATTTTTCGTTTAACACGCAAAACAAGAAA
TTAATCCTTAACAGTGTGTTAAGTAAACAAGACGACCATAAATTGGTAAT
TAGTGCTTGTGACAAAGGAAAACCTCCGAAGTGCTCAAACCCCTTGTGGG
TCACAATAAAGGTTGTTAAACAACACATTCTTATACCTAATGAGCCACCA
AATCCAGATACATTTTCCGATTCGAAAACCTACGTCTTCATTATTTCGGT
CCTTGTCATATTATTATTGATTATTATTATTCTCATTATATGTGCAATTG
TATTCAAAAATCGAATATGTACCCAACTAAATCAAAATGGTAATCATGTC
CTCACTGACTCAAATACTTTGGAAATCACCAATAGAAAAATCAATATTCC
AAATGATATTCAAAGAAACCCAACTATGCACTCTTTGAGTTATGTTGATC
CGGTGATGATGAGCCAGCAGAGAAATGCTAATAATCAACAACAAATCTAT
GTGCACTCGAGAGAAAGACAAATATCATCAGATTATCAAAGCATTGAAGA
AAGAAGCCCGTCATATAAACAAAGTACTCAATTTGCATGGGATAGCGCTA
GTCTGTTGCAAGTGCCACTGAACGATCAAACCGATCAAATTATGTATGGG
CAAAACAGAAGTACTTGTGGAAAAGAGTATTATTATCCGGAACATAGCCA
ATATCGGTCACCTCCGATTGCTTATGGCTTTCATGGAAATCCCCCAACGA
GCTATGTAATACGAAATAACCAAGCTCCGAAAGATCCACAGTTTCAACAG
GACACCTTTCCAAGAAATGCACCTCATAAACTTTACAGTTCATTGTTAAA
CGTTCAGACAATCAATTCTCAACCGGAACCTACCTATATGTACAAATCGT
TAAGAAAAGGGAAGAACAATGCCTCTTTTGTTTAACTTTACTCATTCAGT
TACTGCCGCTCATGCATATAAATATGATATATGTAGAATTTTATAGATGG
TATATTTGTATTTTTTATATAAAACTTTGTCTCAATAAATGATTTGTCAT
TCTACTGATAATTAT
back to top

protein sequence of SMED30000690-orf-1

>SMED30000690-orf-1 ID=SMED30000690-orf-1|Name=SMED30000690-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1029bp
MITFAAWILLLISSITCEKIQIFEEPKNGTEIEVLTKYLKNNIVSVSTSY
RIFDGNKLLNCLHIDPETHVVTVKNRIDRESLCPNQINCDIMLRFFISPS
YVSKSLNVEILDINDNAPSWPQQSKVVSFTEFEGNKLESRTIHIDKAFDP
DVNENSQIDYFLKDRNGKTDNGVWKIKYDSSTSRRIELMPIKVIDREQVD
VYELILIAEDNGSPKRTGSLELIIQILDKNDNGPIFDRAKYYANKLSENA
NIGFVALTVSAKDADYLANGKITYRIEDQKASEYFNIGNNGNIMVRKNID
YDAGVKGFQFSVLAIDGAPEEYRKTGECEVVIMVIDENDEKPEIIVHVTK
RDPLTNEPAIIENEVISNSVLAHIEVKDPDFGGRDIVSCSLSNNDKMRLE
QVSPSDKEFQILAIANFDREEKSMEKVDILCKDQAYNTASKSIVFQILDR
NDNSPKFTRVFHFRVLENASVPNMFVGEVMAVDKDAERNSKIEFQIIGNE
EHFFQIDSSGKMYTKQVLDREETEKFNVTILAKDGGDPPKTGTGLVTIEV
VDINDWKPEFSLSLYEFSISENAGIGTSVGTVTAIDRDLPANTKMKYRII
SDRFSKESYFQYSSSLPFQMIRHDRGEIVTKYLLDREKQSHYLLTVVAID
NGHPNSYTSTTTVKINIIDVNDNFPTFKTSNKTVFSIQTTESVGYEIGTV
EAVDLDFGENSEIVYQIEEGNPYGYFSFNTQNKKLILNSVLSKQDDHKLV
ISACDKGKPPKCSNPLWVTIKVVKQHILIPNEPPNPDTFSDSKTYVFIIS
VLVILLLIIIILIICAIVFKNRICTQLNQNGNHVLTDSNTLEITNRKINI
PNDIQRNPTMHSLSYVDPVMMSQQRNANNQQQIYVHSRERQISSDYQSIE
ERSPSYKQSTQFAWDSASLLQVPLNDQTDQIMYGQNRSTCGKEYYYPEHS
QYRSPPIAYGFHGNPPTSYVIRNNQAPKDPQFQQDTFPRNAPHKLYSSLL
NVQTINSQPEPTYMYKSLRKGKNNASFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 539..558
score: 36.85
coord: 558..571
score: 35.68
coord: 659..676
score: 41.03
coord: 60..79
score: 27.39
coord: 237..266
score: 29.17
coord: 525..537
score: 33.06
coord: 624..650
score: 29.5
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 700..780
e-value: 0.0036
score: 26.5
coord: 35..118
e-value: 0.15
score: 12.2
coord: 145..234
e-value: 3.7E-14
score: 63.0
coord: 582..675
e-value: 1.2E-21
score: 87.9
coord: 479..558
e-value: 6.2E-22
score: 88.9
coord: 374..455
e-value: 0.0017
score: 27.7
coord: 259..342
e-value: 7.4E-14
score: 62.0
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 135..227
e-value: 2.5E-10
score: 40.7
coord: 245..334
e-value: 1.2E-9
score: 38.5
coord: 565..667
e-value: 1.7E-16
score: 60.4
coord: 461..550
e-value: 3.5E-19
score: 69.0
coord: 685..772
e-value: 1.2E-10
score: 41.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 453..555
e-value: 3.2E-26
score: 94.0
coord: 348..452
e-value: 2.1E-9
score: 39.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 114..231
e-value: 1.0E-17
score: 66.6
coord: 556..672
e-value: 4.9E-30
score: 106.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 19..113
e-value: 3.1E-10
score: 42.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 232..347
e-value: 2.8E-21
score: 78.0
coord: 673..778
e-value: 9.5E-19
score: 69.9
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 12..526
coord: 465..899
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 457..560
score: 24.537
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 238..344
score: 19.494
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 561..677
score: 27.869
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 14..120
score: 11.339
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 147..236
score: 19.999
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 679..786
score: 12.084
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 352..457
score: 12.545
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 146..232
e-value: 5.01086E-15
score: 69.6497
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 246..339
e-value: 1.05811E-17
score: 77.3537
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 684..773
e-value: 3.11005E-15
score: 70.0349
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 565..673
e-value: 4.47323E-30
score: 112.407
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 460..555
e-value: 1.88327E-27
score: 105.088
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 49..116
e-value: 7.65774E-5
score: 40.7598
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.89
NoneNo IPR availableTMHMMTMhelixcoord: 797..819
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 21..95
e-value: 1.6E-6
score: 27.8
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 224..234
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 665..675
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 108..243
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 670..772
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 447..550
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 224..348
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 363..457
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 548..684