SMED30000689

Overview
NameSMED30000689
Smed IDSMED30000689
Length (bp)1143
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000689

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000689SMESG000023005.1 Contig3882GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000689SMESG000001727.1 Contig3882GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30000689SMESG000001726.1 dd_Smed_v4_2615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000689SMESG000001726.1 dd_Smed_v4_2615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30000689SMESG000001727.1 dd_Smed_v4_2615_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000689 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009091:22..13254 -4151
Homology
BLAST of SMED30000689 vs. TrEMBL
Match: A0A1S3I5M6 (G-protein coupled receptor 157 OS=Lingula unguis OX=7574 GN=LOC106161225 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 5.321e-8
Identity = 71/283 (25.09%), Postives = 126/283 (44.52%), Query Frame = 2
Query:  104 FSCIFSVFSFLILLRMKVTDCTTGIRMSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHR---NCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWI-TSC-NRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVDYSIKKIVQESSG 937
             SCI S+   ++++   +      IR +S  +L+ L   D   +  NL G+IRY+    +N T+    +C     + C  QS  + + +M      + I ++    V G  + R   +KV     +L W IP  +T      G LGED + T+ GWCWI T+C +  +    + +ML+  +A++ + +L+   ++ ++K   + +    ++  I + +I                R D KL F+  + I   RIWG +R  L I      D S   I+ +  G
Sbjct:   42 LSCILSIIGSVLIIATYIA--FREIRSTSRKLLVYLSIVDFFTALGNLIGVIRYV----YNYTNEISTDCDNPGPV-CVAQSVITTFSSMASFFWTVMIALYLHVSVVG-GDSRKADRKVWAF-HVLSWGIPAMLTFTAWQYGVLGEDGSQTSAGWCWIKTTCSDGMSPGEEIGWMLLTGKAWEIIAYLLTPAIYGHIKCHIHRTIVQVHHRYIDSDTIHAVE------------RADRKLTFVPIIFI-LLRIWGTIRFFLAIGGYQPSDMSALIIILQGFG 302          
BLAST of SMED30000689 vs. TrEMBL
Match: K1QMF9 (G_PROTEIN_RECEP_F2_4 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10001398 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.273e-7
Identity = 52/191 (27.23%), Postives = 86/191 (45.03%), Query Frame = 2
Query:  197 MLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHR---------NCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIF----AVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKI 730
            +LL L  +D L S  NL G IRY      ++ HR         +C     I C +QS  + + ++      + IG+      VYQ   C     I K   ++   + W +PF IT++ A     GED ++++  WCWI  C +    ++  +M I  + ++   +++   L+IYLKY     N    +L I
Sbjct:   63 LLLYLTIADLLTSSGNLLGAIRYSV---RHRHHRFLTDEDILEHCHHPGNI-CTVQSLITTFSSLASFSWTIIIGLHILLTLVYQSEWCMTT--ISK---VLAHCVSWGLPFIITMVGAFKNVFGEDLSISSGPWCWIRGCLKNMEIVK--WMTITGKGWEIATYIVTAFLYIYLKYYMIKRNVFGEDLSI 242          
BLAST of SMED30000689 vs. TrEMBL
Match: A0A2T7NDT5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19820 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.119e-6
Identity = 64/282 (22.70%), Postives = 124/282 (43.97%), Query Frame = 2
Query:   26 EKMSDDYSRDFKISQESTITAIVFGLFSCIFSVFSFLILLRMKVTDCTTGIRMSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHRNCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDS--KLLFLINLSICTCRIWGIVR 865
            E +SD  +    +  +  +  ++  + + + S    ++++ + V      +R +   ML+ L  +D L +  NL G++    I+     HRN       YC+  S  +I+ ++   L  L IG F++Y +A      ++ +K      ++CW IP  +T     +  LG D  +    WCWI        E+ V++  +  +A++   + + + L+  ++ IT   ++S  +              I E   ++N  ND+  KLLF + L     R+WG VR
Sbjct:    7 ENISDATAASEYVMSDMDMAYVIVVMITSVLSTVGCVLIIGLHV--AYRPLRTTGRGMLVQLSVADLLTALGNLMGVLWDSAIL-----HRNMA-----YCETHSALTIFSSIASFLWTLTIG-FSLY-LAIVHNRPHVTRKFWNPIWLVCWGIPTAVTTAALASRVLGYDLNLHQASWCWIDP----KAELNVMWNFLTGKAWELAAYFVTVFLYTVVR-ITILRHQSRTD--------------ILERHSRRNNLNDANTKLLF-VPLVFIVMRLWGTVR 254          
BLAST of SMED30000689 vs. TrEMBL
Match: A0A210PY86 (G-protein coupled receptor 157 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21810 PE=4 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.522e-6
Identity = 58/227 (25.55%), Postives = 97/227 (42.73%), Query Frame = 2
Query:  194 FMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHRNCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVA---GCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVR 865
            ++LL L  +D   ++ NL   +R+  I   N   +N T     YC  QSF +    +        I I+    +A      E R  GK ++    IL   IP  IT++   +G LGED    +  WCWI S         V++ L+  +A++ M +++ L L+I +K+  +  N+                YL   S     +R++  +  +  L +   RIWG +R
Sbjct:   51 YLLLCLTIADIFTAYGNLISTVRWFII--GNDKEKNDT-----YCVAQSFITTTSTLSAFFWTTAIAIYIFSAIALRVNIAEKR-TGKIMMSAIPIL---IPVTITVVALGSGVLGEDDYSGSGPWCWIKSDVSNN----VMWKLVTGKAWEVMTYMVTLVLYILIKFSIWRENRRRGR------------YL-RWSEADNRLRDEDAIFGISWLFLVIARIWGTLR 249          
BLAST of SMED30000689 vs. TrEMBL
Match: A0A2B4SVG1 (Putative G-protein coupled receptor 157 OS=Stylophora pistillata OX=50429 GN=Gpr157 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 2.809e-6
Identity = 42/123 (34.15%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  320 IYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKY 688
            I C+ QSF +   ++       F+ IF    VA  Q ++    K+L    I  W IP  IT I      LG D    + GWCWI S N TTRE + ++ML+  +A++   +++  T F  LKY
Sbjct:   86 IPCKAQSFVTTCASLWSFFWTTFLSIFMYTAVARRQAEK--ADKMLRYFHIFGWGIPLIITGIAFGENKLGNDYDFYSAGWCWI-SGNLTTRE-KQIWMLLTGKAWEMAAYVLISTFFWGLKY 204          
BLAST of SMED30000689 vs. Ensembl Nematostella
Match: EDO41175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S541])

HSP 1 Score: 48.521 bits (114), Expect = 1.761e-6
Identity = 45/195 (23.08%), Postives = 77/195 (39.49%), Query Frame = 2
Query:  326 CQIQSFF----SIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAI-----------AGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVR 865
            C +QSF     S+W         LF+ +  V      +    + +K + +  +  W +P  IT+  A             G LG  +   + GWCWI   +   +EI V +ML+  +A++   +++   L+  LKY  +                    +   ES+ +  +R D KL F + +     RIWG  R
Sbjct:   69 CVVQSFITTCSSLWSFFWTTFLALFLNVMIV------KRRPVLAEKAMFLFHLFAWGLPLVITITAATWKGNKINGTSYRGVLGNSKDQGSAGWCWIRH-DLPKKEI-VTWMLVTGKAWEIAAYILITLLYFILKYYIH------------------QEHFTPESYLEAAMRADRKLTF-VPVIFLLLRIWGTTR 236          
BLAST of SMED30000689 vs. Ensembl Nematostella
Match: EDO41723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G9])

HSP 1 Score: 48.521 bits (114), Expect = 2.547e-6
Identity = 49/238 (20.59%), Postives = 97/238 (40.76%), Query Frame = 2
Query:  269 TIIDFNQTHRNCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFD--AMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVDYSIKKIVQESSGLFMILQIIFDNIQ 976
             ++DF++T           C +Q+F S +F+   L  +  + ++ +  V     ++    K++    +LCW+IP  + +   +    GE     + GWCW+  C   T  +   ++L+  + ++  A I L+ L + I +      + +S   +      I   + +  + F KK        +F +       R+WG VR  L          ++++   + S L M LQ   D  Q
Sbjct:   75 AVMDFHETSS--------LCLVQAFVSTYFSASSLFWMSSLMVYVLVTVITVDPEK--AGKLIKYFHVLCWSIPALMCISALLYSGFGETDNTLSTGWCWVKYCPSDTWML--FWILVTQKLWEMSAYIGLVALCIAIKINIQIKCAARSRREI------IPKGTAVAMQKFNKK--------VFFVPFLFILLRVWGTVRAIL----------ALQQSRYQHSQLLMALQGAGDTGQ 276          
BLAST of SMED30000689 vs. Planmine SMEST
Match: SMESG000001727.1 (SMESG000001727.1)

HSP 1 Score: 512.686 bits (1319), Expect = 0.000e+0
Identity = 278/342 (81.29%), Postives = 300/342 (87.72%), Query Frame = 2
Query:   62 ISQESTITAIVFGLFSCIFSVFSFLILLRMKVTDCTTGIRMSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFN-QTHRNCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVDYSIKKIVQESSGLFMILQIIFDNIQTTXXXXXXXXXXXXXKTYLYRLICRRRLSVDRSTNF 1084
            ++++ TI +IV G+ S +F + SF+IL++M+  +   G R+SSIFML NLVA+D LR     +G +RY  I       +R       ++C+IQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAI GALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVD SI KIVQ SS +FMILQIIFDNIQTTFVFVVLLLCCNFVKTYLYRLICRRRLSVDRSTNF
Sbjct:   14 VNKDVTIISIVLGIISVVFGLISFVILVKMRFKERHIGFRVSSIFMLTNLVAADWLRGVSIFSGTVRYFIIFHTKYGPNRGDPCDADLFCRIQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAITGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVDSSIVKIVQGSSAIFMILQIIFDNIQTTFVFVVLLLCCNFVKTYLYRLICRRRLSVDRSTNF 355          
BLAST of SMED30000689 vs. Planmine SMEST
Match: SMESG000001727.1 (SMESG000001727.1)

HSP 1 Score: 500.36 bits (1287), Expect = 6.640e-179
Identity = 274/341 (80.35%), Postives = 292/341 (85.63%), Query Frame = 2
Query:   62 ISQESTITAIVFGLFSCIFSVFSFLILLRMKVTDCTTGIRMSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHRNCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVDYSIKKIVQESSGLFMILQIIFDNIQTTXXXXXXXXXXXXXKTYLYRLICRRRLSVDRSTNF 1084
            ++++ TI +IV G+ S +F + SF+IL++M+  +   G R+SSIFML NLVA+D LR     +G +R                       IQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAI GALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVD SI KIVQ SS +FMILQIIFDNIQTTFVFVVLLLCCNFVKTYLYRLICRRRLSVDRSTNF
Sbjct:   14 VNKDVTIISIVLGIISVVFGLISFVILVKMRFKERHIGFRVSSIFMLTNLVAADWLRGVSIFSGTVR-----------------------IQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCWTIPFFITLIPAITGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVDSSIVKIVQGSSAIFMILQIIFDNIQTTFVFVVLLLCCNFVKTYLYRLICRRRLSVDRSTNF 331          
BLAST of SMED30000689 vs. Planmine SMEST
Match: SMESG000001726.1 (SMESG000001726.1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.460e-143
Identity = 221/341 (64.81%), Postives = 268/341 (78.59%), Query Frame = 2
Query:   32 MSDDYSRDFKISQESTITAIVFGLFSCIFSVFSFLILLRMKVTDCTTGIRMSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHRNCTKSKYIYCQIQSFFSIWFNMIMLLCILFIGIFAVYQVAG-CQEDRYIGKKVLIVTSILCWTIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSRAFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFGKKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYS-VDYSIKKIVQESSGLFMILQIIFDNIQTTXXXXXXXXXXXXXKTYLYRLIC 1048
            MSDDYSRDFKISQESTITAIVFGLFSCIFSVFSFLILLRMKVTDCTTGIRMSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHRNCTKSKYIYCQIQSFFSIWFNMI+ +CILFIGIFA+YQ+ G     R I KK L++TSI+ W++PF +TLIPAI   LG+D T TTNGWCWI+SC +   +IR+++ML+YS+  + +IFLINLTLFI+LKYI Y   K         +SIST S + ++    ++  NDSKLLFLIN++IC CR+WG++RT +++  M+S   ++    +       + +Q IF+N+Q  FVF VL+LC NF K+Y+ RL C
Sbjct:    1 MSDDYSRDFKISQESTITAIVFGLFSCIFSVFSFLILLRMKVTDCTTGIRMSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHRNCTKSKYIYCQIQSFFSIWFNMIVSICILFIGIFAIYQITGKTGYMRNIKKKTLVITSIVAWSVPFLLTLIPAIWHKLGQDLTKTTNGWCWISSCEQP--KIRLIFMLLYSKILEILIFLINLTLFIFLKYINYKHIKMERQALRIGISISTQSDVDSDKLDIESSTNDSKLLFLINITICWCRVWGLIRTFIEVGKMFSESSWTRNDFINFIENAILFIQAIFENLQGVFVFSVLILCSNFAKSYIRRLFC 339          
The following BLAST results are available for this feature:
BLAST of SMED30000689 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I5M65.321e-825.09G-protein coupled receptor 157 OS=Lingula unguis O... [more]
K1QMF91.273e-727.23G_PROTEIN_RECEP_F2_4 domain-containing protein OS=... [more]
A0A2T7NDT51.119e-622.70Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210PY861.522e-625.55G-protein coupled receptor 157 OS=Mizuhopecten yes... [more]
A0A2B4SVG12.809e-634.15Putative G-protein coupled receptor 157 OS=Styloph... [more]
back to top
BLAST of SMED30000689 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO411751.761e-623.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417232.547e-620.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30000689 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000689 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000001727.10.000e+081.29SMESG000001727.1[more]
SMESG000001727.16.640e-17980.35SMESG000001727.1[more]
SMESG000001726.11.460e-14364.81SMESG000001726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000689 ID=SMED30000689|Name=SMED30000689|organism=Schmidtea mediterranea sexual|type=transcript|length=1143bp
ACTAAAGCTCTAAATTACATTTCGAGAAAAGATGTCTGATGATTATTCGA
GAGATTTTAAAATAAGCCAGGAATCGACAATTACAGCGATTGTCTTTGGA
TTATTTTCATGCATATTTTCTGTGTTTTCGTTTCTAATCTTGCTGAGGAT
GAAAGTCACAGATTGTACAACTGGCATTCGGATGTCTTCAATTTTTATGC
TCTTGAATTTGGTTGCCAGCGACGGCTTGAGGTCTTTTTTTAATTTGACT
GGAATGATAAGATATCTCACAATAATTGACTTCAACCAAACTCATCGGAA
TTGTACAAAATCGAAATACATCTACTGCCAAATTCAGAGCTTTTTCAGTA
TTTGGTTTAACATGATTATGCTTCTCTGTATTCTATTCATTGGGATATTT
GCTGTTTATCAAGTTGCCGGATGCCAAGAAGATCGTTATATTGGAAAAAA
AGTACTCATTGTGACGAGCATACTCTGCTGGACAATTCCATTTTTCATCA
CCTTAATCCCCGCCATTGCAGGAGCATTGGGGGAGGACCAGACGGTGACG
ACTAACGGATGGTGTTGGATCACTTCTTGCAATAGGACCACTCGAGAAAT
TCGTGTCGTATATATGCTAATTTATTCAAGGGCTTTCGATGCAATGATAT
TTCTCATAAATCTTACATTGTTCATTTATTTAAAGTATATTACTTATACC
AGTAACAAATCTACAAATAATTTAAAAATATGCAATCTGTCAATCAGTAC
AGCGTCCTACTTAATTACCGAGTCCTTCGGTAAAAAGAATATTAGAAATG
ATTCAAAATTATTATTTTTAATCAACCTTTCGATTTGTACCTGTCGAATC
TGGGGAATCGTTCGCACTGGGTTGGATATCTCACTCATGTACTCGGTTGA
CTATTCTATAAAGAAAATAGTGCAAGAATCCAGTGGATTATTCATGATTT
TGCAGATTATCTTTGATAATATACAAACAACATTTGTCTTTGTTGTGTTG
CTATTATGCTGTAACTTTGTCAAAACATATCTATACAGACTAATTTGTCG
AAGACGATTATCCGTAGACAGATCTACGAATTTTTAATTTTATGGATGGA
TCAGCTGCAACTGGACTGAAACTGATAAACAGATGAAATTAAA
back to top

protein sequence of SMED30000689-orf-1

>SMED30000689-orf-1 ID=SMED30000689-orf-1|Name=SMED30000689-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=352bp
MSDDYSRDFKISQESTITAIVFGLFSCIFSVFSFLILLRMKVTDCTTGIR
MSSIFMLLNLVASDGLRSFFNLTGMIRYLTIIDFNQTHRNCTKSKYIYCQ
IQSFFSIWFNMIMLLCILFIGIFAVYQVAGCQEDRYIGKKVLIVTSILCW
TIPFFITLIPAIAGALGEDQTVTTNGWCWITSCNRTTREIRVVYMLIYSR
AFDAMIFLINLTLFIYLKYITYTSNKSTNNLKICNLSISTASYLITESFG
KKNIRNDSKLLFLINLSICTCRIWGIVRTGLDISLMYSVDYSIKKIVQES
SGLFMILQIIFDNIQTTFVFVVLLLCCNFVKTYLYRLICRRRLSVDRSTN
F*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..27
score: 5.0
NoneNo IPR availableTMHMMTMhelixcoord: 15..37