DUF4209 domain-containing protein

Overview
NameDUF4209 domain-containing protein
Smed IDSMED30000673
Length (bp)1894
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF4209 domain-containing protein (SMED30000673) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF4209 domain-containing protein (SMED30000673) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF4209 domain-containing protein (SMED30000673) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF4209 domain-containing protein (SMED30000673) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000673

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000673h1SMcG0018048 SmedASXL_000920SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF4209 domain-containing protein vs. Ensembl Human
Match: ERMARD (ER membrane associated RNA degradation [Source:HGNC Symbol;Acc:HGNC:21056])

HSP 1 Score: 75.485 bits (184), Expect = 1.717e-13
Identity = 68/266 (25.56%), Postives = 136/266 (51.13%), Query Frame = 2
Query:  416 LCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIAN---NSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKD--LEPSFI-PVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLS 1180
            L L+++TS  E +L ++   +  + P +L DL+ S+     + + S++N+L +F+G P  LNLRN+ WHG+       I  KYC  ++++   +G ++ +   N++  L   +   +T L +     D+ YE    L++  ++ +FI  + L + E+   KF + +F     L+L   E  +R ++  +N  P  L  A S   + T D ++++ ++     N+   ++G      + +   +  GPR++D +SHGE+ +  H+ S
Sbjct:  124 LSLMKLTSCLERALGDVFLLIGKECPFLLRDLLSSE-ELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGF--ASPEEIPPKYCSMMILLTAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKI-NQLPLFLGEPAMEFLWDFLNHQEGPRIRDHLSHGEINL--HEFS 383          
BLAST of DUF4209 domain-containing protein vs. Ensembl Human
Match: ERMARD (ER membrane associated RNA degradation [Source:HGNC Symbol;Acc:HGNC:21056])

HSP 1 Score: 75.485 bits (184), Expect = 1.717e-13
Identity = 68/266 (25.56%), Postives = 136/266 (51.13%), Query Frame = 2
Query:  416 LCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIAN---NSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKD--LEPSFI-PVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLS 1180
            L L+++TS  E +L ++   +  + P +L DL+ S+     + + S++N+L +F+G P  LNLRN+ WHG+       I  KYC  ++++   +G ++ +   N++  L   +   +T L +     D+ YE    L++  ++ +FI  + L + E+   KF + +F     L+L   E  +R ++  +N  P  L  A S   + T D ++++ ++     N+   ++G      + +   +  GPR++D +SHGE+ +  H+ S
Sbjct:  124 LSLMKLTSCLERALGDVFLLIGKECPFLLRDLLSSE-ELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGF--ASPEEIPPKYCSMMILLTAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKI-NQLPLFLGEPAMEFLWDFLNHQEGPRIRDHLSHGEINL--HEFS 383          
BLAST of DUF4209 domain-containing protein vs. Ensembl Human
Match: ERMARD (ER membrane associated RNA degradation [Source:HGNC Symbol;Acc:HGNC:21056])

HSP 1 Score: 75.0998 bits (183), Expect = 1.755e-13
Identity = 68/266 (25.56%), Postives = 137/266 (51.50%), Query Frame = 2
Query:  416 LCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIAN---NSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKD--LEPSFI-PVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLS 1180
            L L+++TS  E +L ++   +  + P +L DL+ S+     + + S++N+L +F+G P  LNLRN+ WHG+    +  I  KYC  ++++   +G ++ +   N++  L   +   +T L +     D+ YE    L++  ++ +FI  + L + E+   KF + +F     L+L   E  +R ++  +N  P  L  A S   + T D ++++ ++     N+   ++G      + +   +  GPR++D +SHGE+ +  H+ S
Sbjct:  124 LSLMKLTSCLERALGDVFLLIGKECPFLLRDLLSSE-ELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGFASPEE--IPPKYCSMMILLTAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKI-NQLPLFLGEPAMEFLWDFLNHQEGPRIRDHLSHGEINL--HEFS 383          
BLAST of DUF4209 domain-containing protein vs. Ensembl Human
Match: ERMARD (ER membrane associated RNA degradation [Source:HGNC Symbol;Acc:HGNC:21056])

HSP 1 Score: 75.0998 bits (183), Expect = 1.755e-13
Identity = 68/266 (25.56%), Postives = 137/266 (51.50%), Query Frame = 2
Query:  416 LCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIAN---NSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKD--LEPSFI-PVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLS 1180
            L L+++TS  E +L ++   +  + P +L DL+ S+     + + S++N+L +F+G P  LNLRN+ WHG+    +  I  KYC  ++++   +G ++ +   N++  L   +   +T L +     D+ YE    L++  ++ +FI  + L + E+   KF + +F     L+L   E  +R ++  +N  P  L  A S   + T D ++++ ++     N+   ++G      + +   +  GPR++D +SHGE+ +  H+ S
Sbjct:  124 LSLMKLTSCLERALGDVFLLIGKECPFLLRDLLSSE-ELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGFASPEE--IPPKYCSMMILLTAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKI-NQLPLFLGEPAMEFLWDFLNHQEGPRIRDHLSHGEINL--HEFS 383          
BLAST of DUF4209 domain-containing protein vs. Ensembl Human
Match: ERMARD (ER membrane associated RNA degradation [Source:HGNC Symbol;Acc:HGNC:21056])

HSP 1 Score: 74.7146 bits (182), Expect = 2.452e-13
Identity = 68/266 (25.56%), Postives = 137/266 (51.50%), Query Frame = 2
Query:  416 LCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIAN---NSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKD--LEPSFI-PVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLS 1180
            L L+++TS  E +L ++   +  + P +L DL+ S+     + + S++N+L +F+G P  LNLRN+ WHG+    +  I  KYC  ++++   +G ++ +   N++  L   +   +T L +     D+ YE    L++  ++ +FI  + L + E+   KF + +F     L+L   E  +R ++  +N  P  L  A S   + T D ++++ ++     N+   ++G      + +   +  GPR++D +SHGE+ +  H+ S
Sbjct:  124 LSLMKLTSCLERALGDVFLLIGKECPFLLRDLLSSE-ELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGFASPEE--IPPKYCSMMILLTAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKI-NQLPLFLGEPAMEFLWDFLNHQEGPRIRDHLSHGEINL--HEFS 383          
BLAST of DUF4209 domain-containing protein vs. Ensembl Mouse
Match: Ermard (ER membrane associated RNA degradation [Source:MGI Symbol;Acc:MGI:1917317])

HSP 1 Score: 75.0998 bits (183), Expect = 1.421e-13
Identity = 72/285 (25.26%), Postives = 136/285 (47.72%), Query Frame = 2
Query:  344 WISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIA---NNSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKDLEPS---FIPVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISE-IVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTV 1162
            W +     L I++ L S+      L ++++ S  E +L ++   +  + P +L DL+ S      +   +++++L +FIG P  LNLRN+ WHG+    D  I  KYC  ++++   +G ++    ++++  L       +T L +      + YE    L+ +       + + L + E+   KF + +F     L+L   E  +R L+  VN  P  L  A S   + T D ++++ + DGS   N+   ++G      + +   Y  GPR++D ISHGE+ +
Sbjct:  100 WTTYPELFLEILDALQSSQPAAVSLGVMKLASCLERALGDVFLLVGKECPFLLRDLLAS-AELAQVFGHAVMDILKVFIGSPCGLNLRNVLWHGFASPQD--IPPKYCSAMLLLTAGLGQLLKSYLHHTKVTLAHRPFVTLTNLEDVIVFPGVTYEVLSALETVMTKSNFLLKIMLPYWEMAVSKFKSHRFADCTMLLLSQLEAGLRRLFAAVNKCPDRLLTAESTILYTTFDEILAKHMSDGS--MNQLPCFLGEPAMEFLWDFLNYQEGPRIRDRISHGEINI 379          
BLAST of DUF4209 domain-containing protein vs. Ensembl Mouse
Match: Gm3435 (predicted gene 3435 [Source:MGI Symbol;Acc:MGI:3810125])

HSP 1 Score: 74.3294 bits (181), Expect = 1.421e-13
Identity = 71/287 (24.74%), Postives = 137/287 (47.74%), Query Frame = 2
Query:  344 WISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIA---NNSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKDLEPS---FIPVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISE-IVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVID 1168
            W +     L I++ L S+      L ++++ S  E +L ++   +  + P +L DL+ S      +   +++++L +FIG P  LNLRN+ WHG+    D  I  KYC  ++++   +G ++    ++++  L       +T L +      + YE    L+ +       + + L + E+   KF + +F     L+L   E  +R L+  VN  P  L  A S   + T D ++++ + DGS   N+   ++G      + +   Y  GPR++D +SHGE+ + +
Sbjct:  100 WTTYPELFLEILDALQSSQPAAVSLGVMKLASCLERALGDVFLLVGKECPFLLRDLLAS-AELAQVFGHAVMDILKVFIGSPCGLNLRNVLWHGFASPQD--IPPKYCSAMLLLTAGLGQLLKSYLHHTKVTLAHRPFVTLTNLEDVIVFPGVTYEVLSALETVMTKSNFLLKIMLPYWEMAVSKFKSHRFADCTMLLLSQLEAGLRRLFAAVNKCPDRLLTAESTILYTTFDEILAKHMSDGS--MNQLPCFLGEPAMEFLWDFLNYQEGPRIRDHLSHGEINICE 381          
BLAST of DUF4209 domain-containing protein vs. Ensembl Mouse
Match: 9030025P20Rik (RIKEN cDNA 9030025P20 gene [Source:MGI Symbol;Acc:MGI:3583895])

HSP 1 Score: 72.7886 bits (177), Expect = 4.745e-13
Identity = 71/285 (24.91%), Postives = 136/285 (47.72%), Query Frame = 2
Query:  344 WISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIA---NNSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKDLEPS---FIPVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISE-IVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTV 1162
            W +     L I++ L S+      L ++++ S  E +L ++   +  + P +L DL+ S      +   +++++L +FIG P  LNLRN+ WHG+    D  I  KYC  ++++   +G ++    ++++  L       +T L +      + YE    L+ +       + + L + E+   KF + +F     L+L   E  +R L+  VN  P  L  A S   + T D ++++ + DGS   N+   ++G      + +   Y  GPR++D +SHGE+ +
Sbjct:  100 WTTYPELFLEILDALQSSQPAAVSLGVMKLASCLERALGDVFLLVGKECPFLLRDLLAS-AELAQVFGHAVMDILKVFIGSPCGLNLRNVLWHGFASPQD--IPPKYCSAMLLLTAGLGQLLKSYLHHTKVTLAHRPFVTLTNLEDVIVFPGVTYEVLSALETVMTKSNFLLKIMLPYWEMAVSKFKSHRFADYTMLLLSQLEAGLRRLFAAVNKCPDRLLTAESTILYTTFDEILAKHMSDGS--MNQLPCFLGEPAMEFLWDFLNYQEGPRIRDHLSHGEINI 379          
BLAST of DUF4209 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5T6L9|EMARD_HUMAN (Endoplasmic reticulum membrane-associated RNA degradation protein OS=Homo sapiens OX=9606 GN=ERMARD PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 8.245e-13
Identity = 68/266 (25.56%), Postives = 136/266 (51.13%), Query Frame = 2
Query:  416 LCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIAN---NSQQNLNFSNRFKITKLPEF----DIKYEFDIFLKD--LEPSFI-PVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLS 1180
            L L+++TS  E +L ++   +  + P +L DL+ S+     + + S++N+L +F+G P  LNLRN+ WHG+       I  KYC  ++++   +G ++ +   N++  L   +   +T L +     D+ YE    L++  ++ +FI  + L + E+   KF + +F     L+L   E  +R ++  +N  P  L  A S   + T D ++++ ++     N+   ++G      + +   +  GPR++D +SHGE+ +  H+ S
Sbjct:  124 LSLMKLTSCLERALGDVFLLIGKECPFLLRDLLSSE-ELAQVFSQSVMNVLKVFVGSPCGLNLRNVLWHGF--ASPEEIPPKYCSMMILLTAGLGQLLKSYLQNTKLTLAHRSFISLTNLEDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKI-NQLPLFLGEPAMEFLWDFLNHQEGPRIRDHLSHGEINL--HEFS 383          
BLAST of DUF4209 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R6F2|EMARD_MACFA (Endoplasmic reticulum membrane-associated RNA degradation protein (Fragment) OS=Macaca fascicularis OX=9541 GN=ERMARD PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 2.391e-11
Identity = 74/298 (24.83%), Postives = 145/298 (48.66%), Query Frame = 2
Query:  416 LCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIANNSQQN-LNFSNRFKITK--------LPEFDIKYEFDIFLKDL--EPSFI-PVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLS----------SWAILMRYLLFYLVNVFEEN 1240
            L L+++TS  E +L ++   +  + P +L DL+ S+     +   S++N+L +F+G P  LNLRN+ WHG+       +  KYC  ++++   +G ++ +  Q+  L  ++R  IT          P  D+ YE    L++   + +FI  + L + E+   KF + +F     L+L   E  +R ++  +N  P         +  +T +++   + DG    N+   ++G      + +   +  GPR++D +SHGE+ +  H+ S          S  +L+R++   L++VF+E 
Sbjct:  122 LSLMKLTSCLERALGDVFLLIGKECPFLLRDLLASE-ELAQVFGQSVMNVLKVFVGSPCGLNLRNVLWHGF--ASPEEVPPKYCSMMMLLTAGLGQLLKSYLQKTKLTLAHRSFITPTNLEDLIVFP--DVTYEVLSVLEEAMTKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGLRNVFATLNRCP---------QRLLTAEILAKHLNDGK--INQLPLFLGEPAMEFLWDFLNHQEGPRIRDHLSHGEINL--HEFSKETTNQLLAFSVVLLLRFVDEGLLSVFKEK 401          
BLAST of DUF4209 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3B8R1|EMARD_RAT (Endoplasmic reticulum membrane-associated RNA degradation protein OS=Rattus norvegicus OX=10116 GN=Ermard PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 1.394e-8
Identity = 74/285 (25.96%), Postives = 138/285 (48.42%), Query Frame = 2
Query:  344 WISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIA---NNSQQNLNFSNRFKITKLPEFDI-KYEFDIFLKDLE-----PSF-IPVRLIFEEID-CKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISE-IVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTV 1162
            W ++    L I + L S+      L ++++ S  E +L ++   + ++ P +L DL+ S      +   +++++L +FIG P  LNLRN+ WHG+    D  I  KYC  L+++   +G ++    ++++  L       +T L +  +     D  L  LE      SF + + L + E+   KF + +F     L+L   E  +R ++  VN  P  L  A S   + T D ++++ + DGS   N+   ++G      + +   Y  GPR++D +SHGE+ +
Sbjct:  100 WTTSPELFLEIYDALESSQSAAISLSVMKLASCLERALGDVFLLIGNECPFLLRDLLAS-AELAHVFGHAVMDVLKVFIGSPCGLNLRNVLWHGFASPQD--IPPKYCSALLLLTAGLGQLLKSYLHHTKVQLAHRPFVTLTNLEDVIVFPGVTDKVLSALETVMTKSSFLLKIMLPYWELAVSKFKSHRFADCTMLLLSQLEAGLRRVFATVNKCPDRLLTAESTILYTTFDEILAKHMSDGS--INQLPCFLGEPAMDFLWDFLNYQEGPRIRDRLSHGEINI 379          
BLAST of DUF4209 domain-containing protein vs. TrEMBL
Match: A0A131YZR5 (Endoplasmic reticulum membrane-associated RNA degradation protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.942e-20
Identity = 84/290 (28.97%), Postives = 148/290 (51.03%), Query Frame = 2
Query:  326 VKQNLFWISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLW--ELDYAILMKYCKFLVIILWNVGNIIANN---SQQNLNFSNRFKITK----LPEF-DIKYEFDIFLKDLEPS--FIPVRLIFEEIDCKFFNKQFYP-ALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEV 1156
            VK+   W   + +I    + +  ++ C  +L +L++T+I E+SL N+ +    +VP +L D I++           ++ LL + +G P SLNLRN++WHG++   E+D     +Y   L+ I+ ++G  +        +N+ F   F + +    L +F  + +  D FL  LE S   +P R+ + +      +K +YP  L L LP  E  +R+LY KVN+    L  A     + T D V+++ ++ S ++N   E +G     +  ++F Y  GPRL+D +SHGE 
Sbjct:   89 VKKLSSWTDVEKDIQDCFKFVKCDDPCGPVLVVLRITAILEHSLGNVLFGKGVQVPFLLKD-ILTAPQLHEAFGPELMTLLQVIVGPPQSLNLRNVTWHGFVRPEEVDS----RYAYLLICIVLSLGEQMMQRHGVDGRNMQFRECFSLERYEWVLHDFHGLDFSRDQFLSVLESSSLVLPGRMAYWQACMDLLSKGWYPECLTLALPQLECVLRVLYAKVNDCSHRLLTAEMSTLYTTMDEVLAKEME-SGSTNAVREALGDVHFEMFLDIFSYLEGPRLRDKVSHGEA 372          
BLAST of DUF4209 domain-containing protein vs. TrEMBL
Match: A0A1S3HLU3 (endoplasmic reticulum membrane-associated RNA degradation protein OS=Lingula unguis OX=7574 GN=LOC106156329 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.575e-20
Identity = 82/294 (27.89%), Postives = 151/294 (51.36%), Query Frame = 2
Query:  317 KDLVKQNLFWISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIANNSQQNLNFSNRFKIT--KLPEFDIKYEFDI----FLKDL--EPSFIPVRLI--FEEIDCKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVID 1168
            ++ V  NL W       L   E+L S       + LL  TS  E +L ++      + P+ML +L++S+     +   + I LL I IG P SLNLRN+ WHG+   +   +   Y  FLV ++ N+G ++   S +  +  +R  +T  ++ ++DI  +  I     L+DL     F+P  ++  + +I   F ++++  A+ ++LP  E  +R L+ +VN  P  +  A S   + T D ++++ + G  + N+    +G  +  ++ +V +YP GPR++D ISHGE +++ 
Sbjct:   85 RERVGNNLTWTGCPQVFLRSFEVLQSRTSTSAAVSLLMTTSALERALGDIFLLKGKQCPSMLKELLVSE-ELKNLLGGTAIKLLRILIGPPVSLNLRNVLWHGF--AVPDEVPRCYAYFLVNLIPNLGQLLQERSVEAESIPHRVDVTFPQVEDWDIFPDITIKDCAVLEDLFNTSEFVPTPMLPYWADILESFNSQRYGEAVMVLLPQLEHCLRCLFARVNQCPERILTAESTTLYTTVDEMLAKSLPGG-SENQLRYTLGDQYMDILFDVLIYPEGPRVRDRISHGEASILG 374          
BLAST of DUF4209 domain-containing protein vs. TrEMBL
Match: A0A4D5RFD1 (Putative endoplasmic reticulum membrane-associated rna degradation protein (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.209e-18
Identity = 90/334 (26.95%), Postives = 156/334 (46.71%), Query Frame = 2
Query:  257 RFSEIINAYNRSFDLIYSKNKDLVKQNLFWISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIANNSQQNLNFSNRFKIT------KLPEF-DIKYEFDIFLKDLE--PSFIPVRLIFEEIDCKFFNKQFY-PALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLSSWAILMRYLLFYLVNV 1228
            + S +I++  R F  +  +        L W   +      +  L S ++C  +LC+L++T+I E    ++ +     VP +L D I+++     I    ++ +L I +G P SLNLRN+ WHG++   +    + +  FL+    ++G  +A +  Q+     R + +       L +F  + ++   FL  LE  P  +P R+ F     + +NK  Y  +L L LP  E  +R+L+   N+ P  L  A     + T D V++E  D     N   + +G     +  ++F Y  GPRL+D ISHGE      DLS+   + + LL +L N 
Sbjct:   71 KLSPVIHSVCRVFRSLPVETFRSSSALLTWTGEEKAFEECLCRLQSPDECSAVLCILKVTAILERCFGDVLFSKHVPVPFLLKD-ILTQPELSAIFGTELMLVLQIVMGSPRSLNLRNVVWHGFVTPREVDRRLPF--FLICAAMSLGERLAESDSQHKAIVKRRRFSFVDTELALNDFLGVGFDEQSFLSVLEASPLILPGRMPFWHACVQLYNKSRYDESLILALPQVECVLRVLFTAANDCPRRLLTAEMSTLYTTLDEVLAEFTDNC-TCNALRKILGDAHFEIYLDLFAYIEGPRLRDRISHGEA-----DLST---IHKPLLIHLFNA 392          
BLAST of DUF4209 domain-containing protein vs. TrEMBL
Match: A0A023GD37 (DUF4209 domain-containing protein OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 7.208e-18
Identity = 83/286 (29.02%), Postives = 139/286 (48.60%), Query Frame = 2
Query:  338 LFWISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLW--ELDYAILMKYCKFLVIILWNVGNII-------ANNSQQNLNFSNRFKITKLPEFD-IKYEFDIFLKDLEPSF--IPVRLIFEEIDCKFFNKQFYPA-LCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEV 1156
            L W   + +I    + L+S + C  +L +L+ T+I E+SL N+ +  + +VP +L D I++      +    ++ LL + +G P SLNLRN+ WHG++   E+D     +Y   L+ I+ ++G  +        ++ +Q   F+   +   L +FD + +    FL  LE SF  +P R+ F         K  Y + L L LP  E  +R LY KVN+    L  A    ++ T D ++++ V+     N     +G     +      Y  GPRL+D +SHGEV
Sbjct:   89 LRWTGAEEDIQDCFQQLHSGDPCGPVLAVLRTTAILEHSLGNVLFGKNVQVPFLLKD-ILTAPQLHEVFGTELMLLLQVIVGPPHSLNLRNIVWHGFVRPEEVDN----RYAYLLICIILSLGEQMNYRCATEMHSRRQQKRFAMEKQTAALDDFDGLPFNEVEFLSTLETSFLVLPGRMPFWTACVDLLRKASYASCLILALPQLECMLRALYTKVNDCSHRLLTAEMATFYTTLDEILAKEVE-PGVQNALRSTLGDAHFEMYLXXXSYLDGPRLRDKMSHGEV 368          
BLAST of DUF4209 domain-containing protein vs. TrEMBL
Match: B0WGG0 (DUF4209 domain-containing protein OS=Culex quinquefasciatus OX=7176 GN=6037942 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.258e-17
Identity = 90/331 (27.19%), Postives = 155/331 (46.83%), Query Frame = 2
Query:  362 NILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKV--PNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIANNSQQNLNFSNRFKIT-----------KLPEFDIKYEFDIFLKDLEPSFIPVRLIFEEIDCKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTV--IDHDLSSWAILMRYLLFYLVNVFEENRCDRNFPLIQKWITNVEPRYHTF 1309
            N L ++  + S   C  L  LL +TSI E SL NL    +  +  P++L DL+M+  L  ++   +I  L +  +G P+ +NLRNL WHG+  E + + L  Y  FLV +L ++G  +     + L F   F+              L  FD+    +      E   I        I   +  +QFY  +C++LP  E ++R+LY ++ +      RA   EY+I  D +  E    ++A N+  +Y  ID    + ++     GPRL+D +SHGE+    ID  +++  + + Y++    + FE   C  +  ++++ I   E  +  F
Sbjct:   86 NRLGLLNNVLSQRSCT-LTNLLVLTSIVEYSLGNLFLTKTGGITPPHLLRDLLMTDALATLLGETTIFLLRV-LLGSPNGINLRNLVWHGFPSEGEVSEL--YRNFLVEMLNSIGGRL-----EELGFVVEFRSCLQDSKLLVRKMNLARFDVALLEEAVTSSSELQEIQRAGWLRSISL-YKEEQFYYCVCMVLPQLEMFLRVLYGRLYDRDF---RAKIDEYYIIMDTIFEEFETVTEARNRMHDYFRIDLLEAMYDLLSAIRGPRLRDKLSHGELQSADIDEQVANGVLRLSYVILTNDSSFEYKSCFHHNAILEQSIRECEFEFEKF 403          
BLAST of DUF4209 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004354.1 (pep scaffold:Pmarinus_7.0:GL476644:232716:238139:-1 gene:ENSPMAG00000003978.1 transcript:ENSPMAT00000004354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 7.205e-11
Identity = 61/240 (25.42%), Postives = 116/240 (48.33%), Query Frame = 2
Query:  359 FNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIAN--NSQQNLNFSNR--FKITKLPEF----DIKYEFDIFLKDL--EPSFIP--VRLIFEEIDCKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSD 1042
            F +L  +E+  +N      LCLL++T+  E +L +    +  + P +L DL+ S      I   + +++L + +G P SLNLRN+ WHG+    + A +  Y   L++I  ++G  +    + Q+ L  ++R  F +  L E     D+  E    ++ L    +F+P  +   +      + + +F+  + L+LP  E  +R  + +VN+ P  L  A S   + T D ++    +GS+
Sbjct:  111 FQLLDGLEITGTN------LCLLKVTAFLERALGDAFLLVGKECPFLLRDLLASS-ELASIFGKNKMDVLRVLLGSPQSLNLRNVLWHGFAAPGEVAPM--YGSALLLIAASLGFCLGEFLSRQRALTLTHRPFFTLPHLSEMLVFPDVGEEELCVMEKLIGSSTFVPEPMEPQWRAAVQAYRHHRFFDCVVLLLPQLEMGLRATFARVNSCPERLLTAESTVLYTTFDEILENTFNGSN 341          
BLAST of DUF4209 domain-containing protein vs. Planmine SMEST
Match: SMESG000039098.1 (SMESG000039098.1)

HSP 1 Score: 1084.71 bits (2804), Expect = 0.000e+0
Identity = 593/594 (99.83%), Postives = 594/594 (100.00%), Query Frame = 2
Query:   80 MHISNSFXXXXXXXXXXXXXXXXXYYETKIPENIILDFLILDESIQEFLNRNSGLNAPLRFSEIINAYNRSFDLIYSKNKDLVKQNLFWISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVXXXXXXXXXXXXXXXXFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIANNSQQNLNFSNRFKITKLPEFDIKYEFDIFLKDLEPSFIPVRLIFEEIDCKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLSSWAILMRYLLFYLVNVFEENRCDRNFPLIQKWITNVEPRYHTFIIVKNHIVFTDNLLDSINEKLEFPSRNFNRISSDYSLFNEKLIILFRDNQIVTDCGLTLKIIANQIIHIQEQMKVVLDNINFLLANKNLDSRHLNAXXXXXXXXXXXXXXVNEFCRKLFVVFIVRSSQSPTKSMKKPLVKLIKRTLMSCDKIRSLTLKHKWANMEIIFKKFFEDSVKIDWEIYV 1861
            MHI+NSFLSLERISTLLLLSDTSSYYETKIPENIILDFLILDESIQEFLNRNSGLNAPLRFSEIINAYNRSFDLIYSKNKDLVKQNLFWISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVLKDIINNDSIINLLMIFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIANNSQQNLNFSNRFKITKLPEFDIKYEFDIFLKDLEPSFIPVRLIFEEIDCKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLSSWAILMRYLLFYLVNVFEENRCDRNFPLIQKWITNVEPRYHTFIIVKNHIVFTDNLLDSINEKLEFPSRNFNRISSDYSLFNEKLIILFRDNQIVTDCGLTLKIIANQIIHIQEQMKVVLDNINFLLANKNLDSRHLNAFFKILLDLIKFLFDVNEFCRKLFVVFIVRSSQSPTKSMKKPLVKLIKRTLMSCDKIRSLTLKHKWANMEIIFKKFFEDSVKIDWEIYV
Sbjct:    1 MHINNSFLSLERISTLLLLSDTSSYYETKIPENIILDFLILDESIQEFLNRNSGLNAPLRFSEIINAYNRSFDLIYSKNKDLVKQNLFWISTDFNILAIIELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVLKDIINNDSIINLLMIFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLVIILWNVGNIIANNSQQNLNFSNRFKITKLPEFDIKYEFDIFLKDLEPSFIPVRLIFEEIDCKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRAVSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRLKDIISHGEVTVIDHDLSSWAILMRYLLFYLVNVFEENRCDRNFPLIQKWITNVEPRYHTFIIVKNHIVFTDNLLDSINEKLEFPSRNFNRISSDYSLFNEKLIILFRDNQIVTDCGLTLKIIANQIIHIQEQMKVVLDNINFLLANKNLDSRHLNAFFKILLDLIKFLFDVNEFCRKLFVVFIVRSSQSPTKSMKKPLVKLIKRTLMSCDKIRSLTLKHKWANMEIIFKKFFEDSVKIDWEIYV 594          
The following BLAST results are available for this feature:
BLAST of DUF4209 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERMARD1.717e-1325.56ER membrane associated RNA degradation [Source:HGN... [more]
ERMARD1.717e-1325.56ER membrane associated RNA degradation [Source:HGN... [more]
ERMARD1.755e-1325.56ER membrane associated RNA degradation [Source:HGN... [more]
ERMARD1.755e-1325.56ER membrane associated RNA degradation [Source:HGN... [more]
ERMARD2.452e-1325.56ER membrane associated RNA degradation [Source:HGN... [more]
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ermard1.421e-1325.26ER membrane associated RNA degradation [Source:MGI... [more]
Gm34351.421e-1324.74predicted gene 3435 [Source:MGI Symbol;Acc:MGI:381... [more]
9030025P20Rik4.745e-1324.91RIKEN cDNA 9030025P20 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of DUF4209 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q5T6L9|EMARD_HUMAN8.245e-1325.56Endoplasmic reticulum membrane-associated RNA degr... [more]
sp|Q4R6F2|EMARD_MACFA2.391e-1124.83Endoplasmic reticulum membrane-associated RNA degr... [more]
sp|Q3B8R1|EMARD_RAT1.394e-825.96Endoplasmic reticulum membrane-associated RNA degr... [more]
back to top
BLAST of DUF4209 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131YZR51.942e-2028.97Endoplasmic reticulum membrane-associated RNA degr... [more]
A0A1S3HLU33.575e-2027.89endoplasmic reticulum membrane-associated RNA degr... [more]
A0A4D5RFD11.209e-1826.95Putative endoplasmic reticulum membrane-associated... [more]
A0A023GD377.208e-1829.02DUF4209 domain-containing protein OS=Amblyomma tri... [more]
B0WGG01.258e-1727.19DUF4209 domain-containing protein OS=Culex quinque... [more]
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004354.17.205e-1125.42pep scaffold:Pmarinus_7.0:GL476644:232716:238139:-... [more]
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4209 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000039098.10.000e+099.83SMESG000039098.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000673 ID=SMED30000673|Name=DUF4209 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1894bp
TTGAATTGTTTTTGTATTGCATTTTATTATAAACGTTATTATATTGTAAT
TTAATTATAGAACTAAAACATTCGAATTCATGCATATCAGCAACAGTTTT
TTGTCGTTAGAAAGAATATCAACTTTATTGTTATTATCTGATACTAGCAG
TTATTACGAAACAAAAATCCCCGAAAATATTATACTAGATTTCTTAATTT
TAGACGAAAGTATTCAAGAATTTCTAAATAGAAACTCGGGTTTAAATGCA
CCACTAAGATTTTCCGAAATTATTAATGCATATAATAGAAGTTTTGATTT
GATATATTCAAAGAATAAAGACTTAGTAAAACAAAATTTATTTTGGATAT
CAACAGATTTTAATATTCTGGCAATCATTGAGTTATTGTATTCTAACAAC
CAGTGTGACTATCTTTTGTGCTTATTACAAATGACATCTATTACAGAAAA
TTCATTAGCGAATTTACATTATCAGTTGTCATCTAAAGTTCCTAACATGT
TGACAGATTTGATAATGTCAAAAGTTCTAAAAGATATTATAAATAATGAT
TCGATTATTAATTTGCTGATGATTTTTATTGGATTTCCAGATTCTTTAAA
TTTAAGAAATCTCAGTTGGCACGGTTATTTGTGGGAATTAGATTATGCCA
TTTTGATGAAATATTGCAAATTTCTTGTCATAATTCTTTGGAATGTTGGC
AACATTATTGCCAATAATTCTCAACAAAATCTCAATTTTAGTAATAGATT
TAAAATTACGAAGCTTCCAGAATTTGATATTAAATATGAATTTGATATTT
TTCTGAAAGATTTGGAGCCGTCGTTTATTCCAGTACGTTTAATTTTTGAA
GAAATCGATTGTAAATTTTTTAATAAACAATTTTATCCCGCTTTATGCTT
GATGCTACCCGTGTTTGAATTTTATATGAGAATGTTGTATATAAAAGTGA
ATAATCTTCCTCTAGATCTGTCCAGAGCTGTTTCTCATGAATATTTCATC
ACTGAAGATGTTGTCATTTCTGAAATTGTTGATGGCAGTGACGCATCAAA
TAAATTTTTAGAATATATTGGTATTGATTTTTCTACTTTAATAGCTGAAG
TTTTCATGTATCCAATGGGCCCAAGATTGAAGGATATAATCAGCCACGGT
GAAGTTACCGTTATTGATCATGATTTGTCATCTTGGGCAATTCTAATGAG
ATATTTATTGTTTTATCTTGTCAATGTCTTCGAGGAAAATCGATGCGACA
GAAATTTTCCATTAATTCAAAAATGGATTACAAATGTCGAACCGAGATAT
CATACATTTATAATTGTTAAAAATCATATTGTTTTCACCGATAATTTACT
GGATAGTATCAATGAGAAGTTAGAATTTCCTTCTCGTAATTTTAATCGTA
TTTCTTCTGATTATTCATTATTTAATGAGAAATTGATTATCTTATTTCGA
GACAATCAAATTGTTACTGATTGTGGGTTGACCTTAAAAATAATAGCCAA
TCAAATTATTCATATTCAAGAACAAATGAAAGTCGTTTTAGATAATATCA
ATTTTCTATTGGCCAATAAGAATTTGGATTCTCGGCATCTTAATGCATTT
TTTAAAATTCTCCTTGATCTTATTAAATTTCTTTTCGATGTGAATGAATT
TTGTAGAAAATTATTTGTTGTTTTTATTGTTAGAAGCAGCCAATCGCCGA
CGAAATCGATGAAGAAACCGCTTGTAAAGTTAATCAAAAGAACGTTAATG
AGTTGTGATAAAATTCGTAGTCTTACACTGAAACACAAATGGGCGAATAT
GGAAATTATTTTCAAAAAGTTTTTTGAAGATTCAGTCAAAATCGATTGGG
AAATTTATGTTTAATATATTTTACGGTTACCTACGAAAAAAAAA
back to top

protein sequence of SMED30000673-orf-1

>SMED30000673-orf-1 ID=SMED30000673-orf-1|Name=SMED30000673-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=595bp
MHISNSFLSLERISTLLLLSDTSSYYETKIPENIILDFLILDESIQEFLN
RNSGLNAPLRFSEIINAYNRSFDLIYSKNKDLVKQNLFWISTDFNILAII
ELLYSNNQCDYLLCLLQMTSITENSLANLHYQLSSKVPNMLTDLIMSKVL
KDIINNDSIINLLMIFIGFPDSLNLRNLSWHGYLWELDYAILMKYCKFLV
IILWNVGNIIANNSQQNLNFSNRFKITKLPEFDIKYEFDIFLKDLEPSFI
PVRLIFEEIDCKFFNKQFYPALCLMLPVFEFYMRMLYIKVNNLPLDLSRA
VSHEYFITEDVVISEIVDGSDASNKFLEYIGIDFSTLIAEVFMYPMGPRL
KDIISHGEVTVIDHDLSSWAILMRYLLFYLVNVFEENRCDRNFPLIQKWI
TNVEPRYHTFIIVKNHIVFTDNLLDSINEKLEFPSRNFNRISSDYSLFNE
KLIILFRDNQIVTDCGLTLKIIANQIIHIQEQMKVVLDNINFLLANKNLD
SRHLNAFFKILLDLIKFLFDVNEFCRKLFVVFIVRSSQSPTKSMKKPLVK
LIKRTLMSCDKIRSLTLKHKWANMEIIFKKFFEDSVKIDWEIYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039635ERMARD
IPR025209DUF4209
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025209Domain of unknown function DUF4209PFAMPF13910DUF4209coord: 132..203
e-value: 3.9E-10
score: 39.8
IPR039635Endoplasmic reticulum membrane-associated RNA degradation proteinPANTHERPTHR31701FAMILY NOT NAMEDcoord: 61..572