Hsc70-interacting protein

Overview
NameHsc70-interacting protein
Smed IDSMED30000656
Uniprot Best hitCyclic nucleotide-binding domain-containing protein 2 OS=Macaca fascicularis OX=9541 GN=CNBD2 PE=2 SV=1 (E=7.42422e-17)
Length (bp)1969
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hsc70-interacting protein (SMED30000656) t-SNE clustered cells

Violin plots show distribution of expression levels for Hsc70-interacting protein (SMED30000656) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hsc70-interacting protein (SMED30000656) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hsc70-interacting protein (SMED30000656) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000656

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30000656SMESG000046966.1 dd_Smed_v4_17565_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30000656SMESG000046966.1 dd_Smed_v4_17565_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30000656SMESG000046966.1 dd_Smed_v4_17565_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 87.4261 bits (215), Expect = 1.090e-17
Identity = 69/247 (27.94%), Postives = 115/247 (46.56%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQV 1367
            +D    +++ F+   F A +E    P+  +I+   P  RTE++I  V   L  L ++  Y   L+  L  V  F +   RRVII++G     FYFI  GT  V IT ++D G    ++     L KG  FGE+ +LH S R +++V     + L ++R DFF         NK  + V         F + + +F+    ++L +    +    +    +IS +  ES ++  +  GSC VL+ L +
Sbjct:   62 WDKKMQSRVTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDED-GSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFA--------NKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDL 296          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 87.4261 bits (215), Expect = 2.144e-17
Identity = 69/247 (27.94%), Postives = 115/247 (46.56%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQV 1367
            +D    +++ F+   F A +E    P+  +I+   P  RTE++I  V   L  L ++  Y   L+  L  V  F +   RRVII++G     FYFI  GT  V IT ++D G    ++     L KG  FGE+ +LH S R +++V     + L ++R DFF         NK  + V         F + + +F+    ++L +    +    +    +IS +  ES ++  +  GSC VL+ L +
Sbjct:   62 WDKKMQSRVTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDED-GSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFA--------NKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDL 296          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 87.4261 bits (215), Expect = 2.335e-17
Identity = 69/247 (27.94%), Postives = 115/247 (46.56%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQV 1367
            +D    +++ F+   F A +E    P+  +I+   P  RTE++I  V   L  L ++  Y   L+  L  V  F +   RRVII++G     FYFI  GT  V IT ++D G    ++     L KG  FGE+ +LH S R +++V     + L ++R DFF         NK  + V         F + + +F+    ++L +    +    +    +IS +  ES ++  +  GSC VL+ L +
Sbjct:   62 WDKKMQSRVTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDED-GSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFA--------NKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDL 296          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 67.781 bits (164), Expect = 4.413e-11
Identity = 33/126 (26.19%), Postives = 69/126 (54.76%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  +   L  + AF ++  +L  ++C   Y+  ++    + RQG +   +Y +++G+  V ++    +    T+ +L  G +FGE ++L ++ R A++V++ S +LL IE+ DF
Sbjct:   19 LDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQKDF 143          
BLAST of Hsc70-interacting protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 67.781 bits (164), Expect = 5.103e-11
Identity = 33/126 (26.19%), Postives = 69/126 (54.76%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  +   L  + AF ++  +L  ++C   Y+  ++    + RQG +   +Y +++G+  V ++    +    T+ +L  G +FGE ++L ++ R A++V++ S +LL IE+ DF
Sbjct:   19 LDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQKDF 143          
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 65.0846 bits (157), Expect = 8.894e-11
Identity = 43/124 (34.68%), Postives = 57/124 (45.97%), Query Frame = 3
Query:  858 KKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFM---------------YMSEFNKYPEHV 1184
            +K+ +  Y  ++    +IIRQG +    Y I  G   V +  N      R V ++  G  FGELA+LHH  RTA+V +  S  L AIERN F  I M               Y + F  YPE V
Sbjct:   82 EKISSAMYPVEVPAGAIIIRQGDLGSIMYVIQEGKVQV-VKDN------RFVRTMEDGALFGELAILHHCERTATVRAIESCHLWAIERNVFHAIMMESAREKTMSFKRHLKYSARFGGYPEEV 198          
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Match: pkg-2 (Protein Kinase, cGMP-dependent [Source:UniProtKB/TrEMBL;Acc:Q8MQE2])

HSP 1 Score: 64.6994 bits (156), Expect = 1.277e-10
Identity = 43/124 (34.68%), Postives = 57/124 (45.97%), Query Frame = 3
Query:  858 KKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFM---------------YMSEFNKYPEHV 1184
            +K+ +  Y  ++    +IIRQG +    Y I  G   V +  N      R V ++  G  FGELA+LHH  RTA+V +  S  L AIERN F  I M               Y + F  YPE V
Sbjct:   46 EKISSAMYPVEVPAGAIIIRQGDLGSIMYVIQEGKVQV-VKDN------RFVRTMEDGALFGELAILHHCERTATVRAIESCHLWAIERNVFHAIMMESAREKTMSFKRHLKYSARFGGYPEEV 162          
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 60.077 bits (144), Expect = 1.743e-9
Identity = 48/150 (32.00%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEA-SLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            II QG   + FY I  GT  V +  N +Y  V T+N   +G SFGELAL++ + R A+V++K+ ++L AI+R  +  I M  S   K   +  F+  + I + LD  +     +A   C F     V+       E+ +I+  G   VL+
Sbjct:  117 IIEQGEEGDNFYVIDKGT--VDVYVNHEY--VLTIN---EGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILM-GSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEF-FIILEGEANVLQ 257          
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 59.3066 bits (142), Expect = 3.542e-9
Identity = 46/150 (30.67%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEA-SLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            II QG   + FY I  GT  V +  N +Y     V ++++G SFGELAL++ + R A+V++K+ ++L AI+R  +  I M  S   K   +  F+  + I + LD  +     +A   C F     V+       E+ +I+  G   VL+
Sbjct:  149 IIEQGEEGDNFYVIDKGT--VDVYVNHEY-----VLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILM-GSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEF-FIILEGEANVLQ 289          
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 59.3066 bits (142), Expect = 3.795e-9
Identity = 46/150 (30.67%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEA-SLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            II QG   + FY I  GT  V +  N +Y     V ++++G SFGELAL++ + R A+V++K+ ++L AI+R  +  I M  S   K   +  F+  + I + LD  +     +A   C F     V+       E+ +I+  G   VL+
Sbjct:  159 IIEQGEEGDNFYVIDKGT--VDVYVNHEY-----VLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILM-GSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEF-FIILEGEANVLQ 299          
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Match: CG12698 (gene:FBgn0030721 transcript:FBtr0074139)

HSP 1 Score: 63.5438 bits (153), Expect = 3.749e-10
Identity = 52/229 (22.71%), Postives = 111/229 (48.47%), Query Frame = 3
Query:  759 TMHPKQRTEEQ--ILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSN-----DDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFM-YMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIES-EWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDI 1418
            T H K+  +E+  + T+   ++ L+ F+++P  ++ +L  +  F  I P R+++++       YFII+G   V ++ N          V+T      G   G++ ++  + RT + ++ +  +LLAI   ++  + + +M +   + E    ++ +  F  L+ +Q+V   +      ++ L  I   D+ +  +VY V SG C VL+ L + + + + RE    L +I
Sbjct:   74 TPHAKRSVDERKKLCTI---VANLACFSKFPPKVRARLVPIVKFMAISPGRIVMKEEDFPVTIYFIIAGE--VEMSKNIYKKGSSRPTVQTEAIFGPGDCIGDIDVMEDTPRTNTYIATTYCELLAIFNTNYKIVLLPFMQKM--WQEKKDALRALDYFDFLNEEQIVNASKYGTIQQFEPLETIYTEDLGTMSYVYFVLSGECVVLQCLHMKV-NMVNREKVFQLPNI 294          
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0302639)

HSP 1 Score: 61.6178 bits (148), Expect = 4.994e-10
Identity = 43/151 (28.48%), Postives = 73/151 (48.34%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLD-FDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            II+QG   + FY I  G   V + S         V ++S+G SFGELAL++ + R A+V +K+ ++L  I+R+ +  I M  S   K   +  F+  + I   LD +++L        C F     ++       ++ YI+  G   VL++
Sbjct:   79 IIQQGDEGDNFYVIDVGEVDVFVNSE-------LVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILM-GSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDF-YIILEGCAVVLQQ 220          
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300533)

HSP 1 Score: 61.6178 bits (148), Expect = 5.229e-10
Identity = 43/151 (28.48%), Postives = 73/151 (48.34%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLD-FDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            II+QG   + FY I  G   V + S         V ++S+G SFGELAL++ + R A+V +K+ ++L  I+R+ +  I M  S   K   +  F+  + I   LD +++L        C F     ++       ++ YI+  G   VL++
Sbjct:   79 IIQQGDEGDNFYVIDVGEVDVFVNSE-------LVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILM-GSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDF-YIILEGCAVVLQQ 220          
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300529)

HSP 1 Score: 61.6178 bits (148), Expect = 5.229e-10
Identity = 43/151 (28.48%), Postives = 73/151 (48.34%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLD-FDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            II+QG   + FY I  G   V + S         V ++S+G SFGELAL++ + R A+V +K+ ++L  I+R+ +  I M  S   K   +  F+  + I   LD +++L        C F     ++       ++ YI+  G   VL++
Sbjct:   79 IIQQGDEGDNFYVIDVGEVDVFVNSE-------LVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILM-GSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDF-YIILEGCAVVLQQ 220          
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0302638)

HSP 1 Score: 62.003 bits (149), Expect = 5.452e-10
Identity = 43/151 (28.48%), Postives = 73/151 (48.34%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLD-FDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            II+QG   + FY I  G   V + S         V ++S+G SFGELAL++ + R A+V +K+ ++L  I+R+ +  I M  S   K   +  F+  + I   LD +++L        C F     ++       ++ YI+  G   VL++
Sbjct:  104 IIQQGDEGDNFYVIDVGEVDVFVNSE-------LVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILM-GSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDF-YIILEGCAVVLQQ 245          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: zgc:171558 (zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4])

HSP 1 Score: 67.3958 bits (163), Expect = 2.094e-11
Identity = 32/126 (25.40%), Postives = 72/126 (57.14%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  ++  L  + AF ++  +L +++C   ++  ++    + RQG +   +Y ++SG+  V ++   ++    T+ +L  G +FGE ++L ++ R A++VS+ + +LL IE+ +F
Sbjct:   20 LDKRPAERSGEDVDIILARLKGVKAFEKFHPNLLQQICMCGFYEYLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGVGTAFGE-SILDNTPRHATIVSRENSELLRIEQREF 144          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 68.1662 bits (165), Expect = 2.195e-11
Identity = 33/126 (26.19%), Postives = 72/126 (57.14%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P++R+ E +  +M  L ++ AF ++   L +++C   ++  ++    + RQG +   +Y ++SG+  V ++   ++    T+ +L  G +FGE ++L ++ R A++V++   +LL IE+ DF
Sbjct:   25 LDKRPEERSGEDVDIIMVRLKSVKAFEKFHPPLLQQICLCGFYECLEKGITLYRQGDIGTNWYTVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTREFSELLRIEQKDF 149          

HSP 2 Score: 50.0618 bits (118), Expect = 8.654e-6
Identity = 38/136 (27.94%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  744 MKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRK-IDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSM-QLLAIERNDFFYIF 1145
            ++ IL   P QRT + +  +   L  + A +     +K++L  V  F        V+  QG     +Y I+ G+  V I     YG+   V +L +G  FG+LAL++ + R AS+V +      L +++ DF  I 
Sbjct:  331 LRMILRKQPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGSVNVVI-----YGK-GVVCTLHEGDDFGKLALVNDAPRAASIVLREDFCHFLRVDKEDFNRIL 460          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 68.1662 bits (165), Expect = 2.506e-11
Identity = 33/126 (26.19%), Postives = 72/126 (57.14%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P++R+ E +  +M  L ++ AF ++   L +++C   ++  ++    + RQG +   +Y ++SG+  V ++   ++    T+ +L  G +FGE ++L ++ R A++V++   +LL IE+ DF
Sbjct:   25 LDKRPEERSGEDVDIIMVRLKSVKAFEKFHPPLLQQICLCGFYECLEKGITLYRQGDIGTNWYTVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTREFSELLRIEQKDF 149          

HSP 2 Score: 50.0618 bits (118), Expect = 8.873e-6
Identity = 38/136 (27.94%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  744 MKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRK-IDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSM-QLLAIERNDFFYIF 1145
            ++ IL   P QRT + +  +   L  + A +     +K++L  V  F        V+  QG     +Y I+ G+  V I     YG+   V +L +G  FG+LAL++ + R AS+V +      L +++ DF  I 
Sbjct:  331 LRMILRKQPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGSVNVVI-----YGK-GVVCTLHEGDDFGKLALVNDAPRAASIVLREDFCHFLRVDKEDFNRIL 460          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: zgc:171558 (zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4])

HSP 1 Score: 67.781 bits (164), Expect = 2.924e-11
Identity = 32/126 (25.40%), Postives = 72/126 (57.14%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  ++  L  + AF ++  +L +++C   ++  ++    + RQG +   +Y ++SG+  V ++   ++    T+ +L  G +FGE ++L ++ R A++VS+ + +LL IE+ +F
Sbjct:   20 LDKRPAERSGEDVDIILARLKGVKAFEKFHPNLLQQICMCGFYEYLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGVGTAFGE-SILDNTPRHATIVSRENSELLRIEQREF 144          
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 62.7734 bits (151), Expect = 1.107e-9
Identity = 46/186 (24.73%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  858 KKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLND 1415
            K +    Y R       +I+QG    + + +  G         D Y   + + S++   +FGELA+L++ TRTASV + S+++  A++R + F+  M M+   ++ ++ +F++ + + + L  D+L K  +     +Y     I     E    YI+ +G   V +  Q   E ++   NTL   D
Sbjct:  180 KDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKL-------DVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDR-EVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQII--NTLGKGD 355          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: bmp4 (bone morphogenetic protein 4 [Source:Xenbase;Acc:XB-GENE-483058])

HSP 1 Score: 80.8777 bits (198), Expect = 8.281e-16
Identity = 57/203 (28.08%), Postives = 97/203 (47.78%), Query Frame = 3
Query:  768 PKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFM---YMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            P+QR+E+ I  +   +  + +F  Y   ++  L  V Y+R+    RVI+R+GH  + FYF+ SG  ++ +T + D G    ++     L KG SFGE+ALL    R A+VV     + L ++R +FF   +      E     +H   +     +S    + L    +A  CH  +   V+  +  E++ +  V  G C VL+
Sbjct:   17 PEQRSEQDIRFIRSMMMGILSFRRYSSQMQLMLARVVYYRRFGRGRVIVRKGHRGDSFYFVFSG--VIAVTQDVD-GSSALLDPEPILLHKGASFGEVALLKDLRRNATVVCMEETEFLVVDRMEFFENKLDQELQKELKYRFQHFRSLDLFSSWSDKSLETLADHCKAEECHHSQ---VMVKDTHETKNIIFVTKGRCEVLR 213          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 69.707 bits (169), Expect = 1.017e-11
Identity = 41/170 (24.12%), Postives = 87/170 (51.18%), Query Frame = 3
Query:  714 ASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIF----MYMSEFNKYPEHVSFIKD-IPI 1208
            A+ E  L  +        P +R+ E +  +   L  + AF  +  +L +++C   Y+  ++    + RQG +   +Y +++G+  V ++  +++     + +L  G +FGE ++L ++ R A++V++ + +LL IE+ DF  ++     YM+ F   P     I++ IPI
Sbjct:    5 AAAECILYSKQPMCYLFRPLERSGEDVDIIFARLKEVKAFERFHPNLLQQICFCGYYENLEKGITLYRQGDIGTSWYAVLTGSLDVKVSETNNHQDAVVICTLGVGTAFGE-SILDNTPRHATIVTRENSELLRIEQKDFKTLWEKYRQYMAGFLAPPYGTPLIENQIPI 173          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 69.707 bits (169), Expect = 1.023e-11
Identity = 41/170 (24.12%), Postives = 87/170 (51.18%), Query Frame = 3
Query:  714 ASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIF----MYMSEFNKYPEHVSFIKD-IPI 1208
            A+ E  L  +        P +R+ E +  +   L  + AF  +  +L +++C   Y+  ++    + RQG +   +Y +++G+  V ++  +++     + +L  G +FGE ++L ++ R A++V++ + +LL IE+ DF  ++     YM+ F   P     I++ IPI
Sbjct:    5 AAAECILYSKQPMCYLFRPLERSGEDVDIIFARLKEVKAFERFHPNLLQQICFCGYYENLEKGITLYRQGDIGTSWYAVLTGSLDVKVSETNNHQDAVVICTLGVGTAFGE-SILDNTPRHATIVTRENSELLRIEQKDFKTLWEKYRQYMAGFLAPPYGTPLIENQIPI 173          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 67.3958 bits (163), Expect = 6.323e-11
Identity = 38/161 (23.60%), Postives = 82/161 (50.93%), Query Frame = 3
Query:  714 ASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIF----MYMSEFNKYPEHV 1184
            A+ E  L  +        P +R+ E +  +   L  + AF  +  +L +++C   Y+  ++    + RQG +   +Y +++G+  V ++  +++     + +L  G +FGE ++L ++ R A++V++ + +LL IE+ DF  ++     YM+ F   P  V
Sbjct:    5 AAAECILYSKQPMCYLFRPLERSGEDVDIIFARLKEVKAFERFHPNLLQQICFCGYYENLEKGITLYRQGDIGTSWYAVLTGSLDVKVSETNNHQDAVVICTLGVGTAFGE-SILDNTPRHATIVTRENSELLRIEQKDFKTLWEKYRQYMAGFLAPPYGV 164          
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 67.3958 bits (163), Expect = 6.839e-11
Identity = 37/154 (24.03%), Postives = 80/154 (51.95%), Query Frame = 3
Query:  735 TPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIF----MYMSEFNKYPEHV 1184
            + E    L   P +R+ E +  +   L  + AF  +  +L +++C   Y+  ++    + RQG +   +Y +++G+  V ++  +++     + +L  G +FGE ++L ++ R A++V++ + +LL IE+ DF  ++     YM+ F   P  V
Sbjct:   12 SAEWIACLDKRPLERSGEDVDIIFARLKEVKAFERFHPNLLQQICFCGYYENLEKGITLYRQGDIGTSWYAVLTGSLDVKVSETNNHQDAVVICTLGVGTAFGE-SILDNTPRHATIVTRENSELLRIEQKDFKTLWEKYRQYMAGFLAPPYGV 164          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 82.0333 bits (201), Expect = 4.662e-16
Identity = 64/243 (26.34%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            +D     ++ F    F A++E    P    I    P  RT ++I  +   L AL  +  Y   L+  L  V  F +   RRVI+++G +   FYFI  GT  V IT ++D G    ++     L +G SFGE+ LL  + R+A+VV     + L ++R DF          NK  + V        +F +++ IF     ++L K         +    ++S + + S ++  +  G+C +L+
Sbjct:   35 WDKKKQGRISFVTEDF-AAQEGHFPPRAISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGT--VAITEDED-GSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVA--------NKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILR 265          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 81.6481 bits (200), Expect = 1.509e-15
Identity = 64/243 (26.34%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            +D     ++ F    F A++E    P    I    P  RT ++I  +   L AL  +  Y   L+  L  V  F +   RRVI+++G +   FYFI  GT  V IT ++D G    ++     L +G SFGE+ LL  + R+A+VV     + L ++R DF          NK  + V        +F +++ IF     ++L K         +    ++S + + S ++  +  G+C +L+
Sbjct:  152 WDKKKQGRISFVTEDF-AAQEGHFPPRAISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGT--VAITEDED-GSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVA--------NKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILR 382          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 76.2554 bits (186), Expect = 5.187e-14
Identity = 57/208 (27.40%), Postives = 97/208 (46.63%), Query Frame = 3
Query:  768 PKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            P  RT ++I  +   L AL  +  Y   L+  L  V  F +   RRVI+++G +   FYFI  GT  V IT ++D G    ++     L +G SFGE+ LL  + R+A+VV     + L ++R DF          NK  + V        +F +++ IF     ++L K         +    ++S + + S ++  +  G+C +L+
Sbjct:   57 PSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGT--VAITEDED-GSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVA--------NKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILR 253          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:MGI Symbol;Acc:MGI:1917723])

HSP 1 Score: 70.0922 bits (170), Expect = 6.706e-12
Identity = 34/133 (25.56%), Postives = 72/133 (54.14%), Query Frame = 3
Query:  735 TPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            + E    L   P +R+ E +  +   L  + AF ++  +L +++C   Y+  ++    + RQG +   +Y +++G+  V ++    +    T+ +L  G +FGE ++L ++ R A++V++ S +LL IE+ DF
Sbjct:   12 SAEWIACLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQEDF 143          
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Match: Rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:MGI Symbol;Acc:MGI:1917723])

HSP 1 Score: 70.0922 bits (170), Expect = 7.421e-12
Identity = 33/126 (26.19%), Postives = 70/126 (55.56%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  +   L  + AF ++  +L +++C   Y+  ++    + RQG +   +Y +++G+  V ++    +    T+ +L  G +FGE ++L ++ R A++V++ S +LL IE+ DF
Sbjct:   19 LDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTRESSELLRIEQEDF 143          
BLAST of Hsc70-interacting protein vs. UniProt
Match: sp|Q95JR6|CNBD2_MACFA (Cyclic nucleotide-binding domain-containing protein 2 OS=Macaca fascicularis OX=9541 GN=CNBD2 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.424e-17
Identity = 69/247 (27.94%), Postives = 113/247 (45.75%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQV 1367
            +D    +++ F+   F A +E    P+  +I+   P  RTE++I TV   L  L ++  Y   L+  L  V  F +   RRVII++G     FYFI  GT  +T   ND+ G    ++     L KG  FGE  + H S R +++V     + L ++R DFF         NK  + V         F + + +F+    ++L +    S    +    +IS +  ES ++  +  GSC VL+ L +
Sbjct:   62 WDKKIQSRVTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQTVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAIT---NDEDGSSAFLDPHPKLLQKGSCFGETDIQHASLRRSTIVCMEETEFLVVDREDFFA--------NKLDQEVQKDAQYRFEFFRKMDLFASWSDEKLWQLVNMSKIERFSYGQLISKDFGESSFIMFISKGSCEVLRLLDL 296          
BLAST of Hsc70-interacting protein vs. UniProt
Match: sp|Q96M20|CNBD2_HUMAN (Cyclic nucleotide-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CNBD2 PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.030e-16
Identity = 69/247 (27.94%), Postives = 115/247 (46.56%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQV 1367
            +D    +++ F+   F A +E    P+  +I+   P  RTE++I  V   L  L ++  Y   L+  L  V  F +   RRVII++G     FYFI  GT  V IT ++D G    ++     L KG  FGE+ +LH S R +++V     + L ++R DFF         NK  + V         F + + +F+    ++L +    +    +    +IS +  ES ++  +  GSC VL+ L +
Sbjct:   62 WDKKMQSRVTFDTMDFIA-EEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGT--VAITKDED-GSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFA--------NKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDL 296          
BLAST of Hsc70-interacting protein vs. UniProt
Match: sp|Q9D5U8|CNBD2_MOUSE (Cyclic nucleotide-binding domain-containing protein 2 OS=Mus musculus OX=10090 GN=Cnbd2 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 1.056e-14
Identity = 64/243 (26.34%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  663 FDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHV--------SFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            +D     ++ F    F A++E    P    I    P  RT ++I  +   L AL  +  Y   L+  L  V  F +   RRVI+++G +   FYFI  GT  V IT ++D G    ++     L +G SFGE+ LL  + R+A+VV     + L ++R DF          NK  + V        +F +++ IF     ++L K         +    ++S + + S ++  +  G+C +L+
Sbjct:  152 WDKKKQGRISFVTEDF-AAQEGHFPPRAISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGT--VAITEDED-GSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVA--------NKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILR 382          
BLAST of Hsc70-interacting protein vs. UniProt
Match: sp|Q6BZG7|KAPR_DEBHA (cAMP-dependent protein kinase regulatory subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=PKAR PE=3 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.001e-13
Identity = 50/152 (32.89%), Postives = 75/152 (49.34%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKS--SMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            II+QG   +YFY I  GT    +  N        VNS  +G SFGELAL+++S R A+ V+ S   +   A++R  F  I +  + FN+   +  F+KD+ + S L   +  K  +A     Y     I     + E  Y ++SGSC V K+
Sbjct:  240 IIKQGDEGDYFYIIEKGTVDFYVNGN-------QVNSSGEGSSFGELALMYNSPRAATAVAASDTGVTCWALDRQTFRRILLERT-FNRRLMYEDFLKDVKVLSSLSSQERSKLADALSTEIYHKGDKIVKEGEQGENFYFIESGSCQVSKD 383          
BLAST of Hsc70-interacting protein vs. UniProt
Match: sp|P31320|KAPR_BLAEM (cAMP-dependent protein kinase regulatory subunit OS=Blastocladiella emersonii OX=4808 GN=PKAR PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.357e-13
Identity = 52/158 (32.91%), Postives = 88/158 (55.70%), Query Frame = 3
Query:  885 RKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNL-IVISANDIESEWVYIVKSGSCTVLK 1355
            +K+    V+IRQG V +YFY + +G   V +  N + G V+ V   S G SFGELAL++++ R A+VV+ +   L A++R  F  I M  +   K   + +F++++P+ S L+  +  K  +A     Y +  +VI   D+  E  YI+++G   V+K
Sbjct:  175 KKVAAGEVVIRQGGVGDYFYVVETGALDVFVNRNGN-GDVK-VTDYSAGGSFGELALMYNAPRAATVVATAESVLWALDRVTFRRILMDHTS-RKRRMYEAFLEEVPLLSSLEPYERHKIADALESVAYADGDVVIRQGDV-GENFYIIEAGDAEVIK 328          

HSP 2 Score: 54.6842 bits (130), Expect = 1.724e-6
Identity = 48/157 (30.57%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  747 KKILTMHP--KQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTA-IVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMS--------EFNKYP-EH 1181
            ++IL  H   K+R  E  L  +  LS+L  +  +   +   L +VAY        V+IRQG V E FY I +G A ++ I  N   G+      L KG  FGELALL    R A++ +K  ++   + +  F  +   ++        ++ KYP EH
Sbjct:  256 RRILMDHTSRKRRMYEAFLEEVPLLSSLEPYERH--KIADALESVAYADG----DVVIRQGDVGENFYIIEAGDAEVIKIDEN---GEEHHFRPLHKGNYFGELALLSDKPRVATIRAKGKLKCAKLGKKAFTRLLGPLADIMQRNTQDYEKYPGEH 403          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21111916 (tr|A0A2T7PBG8|A0A2T7PBG8_POMCA Cyclic nucleotide-binding domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_10040 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.716e-82
Identity = 174/461 (37.74%), Postives = 254/461 (55.10%), Query Frame = 3
Query:  537 RFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNK-LRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSND---DYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQK---ENSRNYISVFIKVADLIAKDIYGLSSVIFTSE-DKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYK 1895
            RF  AIK ++   +    +IK +           D     D F+    N+ L F+  +FKA KEI ++ E+K IL+M P  R++EQI T MYGL +L +F EYP+H+++KL  VA++  + P+R IIRQGH AE FYFI+SG A+VTI   D       VRT N + KG SFGELALLH S RTA+V S  ++QLL+I R+DFF IFM     +  PEH+ F+  +        D+L+++PE  L HF+K  +VI  +  +SEW+YIVKSGSC VLK+LQ       TR   +  +DI      F+      +P  G    T +  R+M    T+L P         + + K    Q         + SVF++V  L  +D +GL  + F  + D  +T    SV+LVS  AE +++SK F  + A D + K++++ +  YP E  F E+ + + +W+ YK
Sbjct:  198 RFQRAIKAVMTIRKLATLMIKKSEEPSAMLKSFNDIIELADNFNENLKNQGLSFDPSYFKAHKEISVSSEVKNILSMPPSFRSQEQIQTAMYGLQSLPSFAEYPLHMQEKLAKVAWYEVVPPKRTIIRQGHYAENFYFILSGQAVVTILIRDPKTGESHVRTANFMRKGTSFGELALLHRSRRTATVTSHDTVQLLSIGRDDFFDIFMARHGADDVPEHIRFVSQLDFLKGWPIDRLLERPEFCLLHFFKRNMVIVKDSKQSEWIYIVKSGSCQVLKQLQAVTARLDTRRYIVPEDDI------FN------LPHTG----TAARGRHM----TVLAPRASVGPPQRSRAKKVKRQQGLSLSAPPGHPSVFVQVELLKPRDAFGLQPIQFPDDLDAPQT----SVSLVSLGAECIMLSKDFFWKHATDFVKKNLQEIVRPYPDESTFQESLQRKADWDLYK 634          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23849668 (tr|V4B1D3|V4B1D3_LOTGI Cyclic nucleotide-binding domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_231021 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.227e-79
Identity = 165/442 (37.33%), Postives = 253/442 (57.24%), Query Frame = 3
Query:  654 TDVFDSTDSN----KLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDD-YGQV--RTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSR---NYIS------------------VFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYK 1895
            T V D+ + N     L F+  +FKA +EI ++ E+K IL++  +QRT EQI T M+GL +L +F EYP+H+++KLC VA +  + P+RV+IRQGH AE FYFI+SG A+VTI   D   G+   R    + KG SFGELALLHHS RTA+V S+ ++Q+L I R DFF IFM  S   + P+H+ F+  +    +   D+LV+  +  L HF+K  +VI  +   ++W+Y+VKSGSC V+K L+      +T   +L+  D+K      D +    +P    +    +  R   R   + +  +  + ++   S K   ++K+  R    Y S                  VF++V  L  +D++GL S+ F  +D  ++E   SV+LVS  AE ++VSK+F V+ AN+ + K IRQ +  YP+E+ F EN +I+ +WE YK
Sbjct:  227 TQVDDTLEENLRNQGLSFDPSYFKAKREINISSEVKHILSLEKEQRTPEQIQTAMFGLQSLRSFAEYPLHMQEKLCKVAIYEVVPPKRVLIRQGHHAENFYFILSGQAVVTILVKDPKTGESVNRVATIMRKGMSFGELALLHHSRRTATVSSQDTVQMLTIGREDFFDIFMAGSGPGQIPDHIKFVSQLDFMKNWPIDRLVENSQHCLLHFFKRNVVIVKDSRVNDWLYVVKSGSCQVMKMLK-----GVTARTSLSKKDVKMD----DSWELPNLPTAEQEAKVDT-GRKKKRKEDLTE--EQLFRRSMCKSAKEERDRKKGERMSAKYRSPRIMKSAHPNLAPTKPGNVFVQVEHLKPRDVFGLPSIQF-DDDIAKSE--TSVSLVSRGAECIMVSKEFYVKHANEQVKKLIRQQVRPYPAEETFQENLQIKTDWEYYK 653          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18296915 (tr|A0A1I8INL6|A0A1I8INL6_9PLAT Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 3.165e-77
Identity = 167/492 (33.94%), Postives = 263/492 (53.46%), Query Frame = 3
Query:  555 KMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSND-DYGQVRT--VNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSC--------------TVLKE---LQVPI-----ESKLTR--ENTLTLNDIKCKLQCFDQYHF------IPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYI-SVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYKLQRYNSTLKKI 1928
            +++I  + +++ ++K T  ++ + +   DT    +    TD + L F+  +F+A KEI+LT EMK IL M P+ R++EQ+ T+MYGL  L  FNEYP+ +++KL  VA++  +   R+IIRQGH    FY IISG A+V +   D + G+ R+  V  L +G  FGE+ALLH  TRTAS+VS++ MQLLAI R+DF  IFM  ++  + P H+ F+       H   +QL+KQP A L  FY+   ++  +   SE++ +VKSGSC              TV+KE    Q+ +     E K+      T      K + Q  +Q  F        + LN   GN   +     +             +   D +  +  Q+E       SV ++++ L   D++GLS+V+F  E  +  E  ASV+L+SN +E +L  K F VQ AN+ L K +++    YP E +F  NY  ++ W++Y+   ++STL +I
Sbjct:    3 RIVIVMINWIHAVLKRTDYKEDENIRVADTLKGFE----TDDSGLSFDLSYFRAKKEIDLTGEMKYILQMEPQDRSDEQVQTLMYGLQNLPTFNEYPLSIQEKLSRVAFYYSVPAGRLIIRQGHTGINFYIIISGKALVNVMKEDRESGETRSSIVARLGQGQPFGEIALLHQVTRTASIVSQTPMQLLAIGRDDFHDIFM-RAQPGRRPAHIEFLLSCEFMRHFPEEQLLKQPNACLLTFYRRNAIVVPDSKASEYIVVVKSGSCKVLKRLEVNDTDEPTVVKERSDFQIKLNIGRNEPKVNTGLRKTAASGSEKQQAQTPNQQLFDVSVSKKRLALNSALGNNSRVVEVTRQ-------------QTAPDFDAIAKKQQEPVEQVKKSVAVQISTLKPGDVFGLSNVVFKGEKNLEIEESASVSLISNGSECLLFQKTFFVQHANELLKKHVKELARPYPEEGVFENNYYRQMAWDRYRRGLFSSTLSEI 476          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18328583 (tr|A0A267H3W5|A0A267H3W5_9PLAT Cyclic nucleotide-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021012g2 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 5.133e-77
Identity = 171/499 (34.27%), Postives = 268/499 (53.71%), Query Frame = 3
Query:  534 SRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSND-DYGQVRT--VNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSC--------------TVLKE---LQVPI-----ESKLTR--ENTLTLNDIKCKLQCFDQYHFI------PMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYI-SVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYKLQRYNSTLKKI 1928
            +RF    +++I  + +++ ++K T  ++ + +   DT    +    TD + L F+  +F+A KEI+LT EMK IL M P+ R++EQ+ T+MYGL  L  FNEYP+ +++KL  VA++  +   R+IIRQGH    FY IISG A+V +   D + G+ R+  V  L +G  FGE+ALLH  TRTAS+VS++ MQLLAI R+DF  IFM  ++  + P H+ F+       H   +QL+KQP A L  FY+   ++  +   SE++ +VKSGSC              TV+KE    Q+ +     E K+      T      K + Q  +Q  F        + LN   GN    +R +  +     P          D +  +  Q+E       SV ++++ L   D++GLS+V+F  E  +  E  ASV+L+SN +E +L  K F VQ AN+ L K +++    YP E +F  NY  ++ W++Y+   ++STL +I
Sbjct:  120 ARFKKMSRIVIVMINWIHAVLKRTDYKEDENIRVADTLKGFE----TDDSGLSFDLSYFRAKKEIDLTGEMKYILQMEPQDRSDEQVQTLMYGLQNLPTFNEYPLSIQEKLSRVAFYYSVPAGRLIIRQGHTGINFYIIISGKALVNVMKEDRESGETRSSIVARLGQGQPFGEIALLHQVTRTASIVSQTPMQLLAIGRDDFHDIFMR-AQPGRRPAHIEFLLSCEFMRHFPEEQLLKQPNACLLTFYRRNAIVVPDSKASEYIVVVKSGSCKVLKRLEVNDTDEPTVVKERSDFQIKLNIGRNEPKVNTGLRKTAASGSEKQQAQTPNQQLFDVSVSKKRLALNSALGNN---SRVVEVTRQQTAP----------DFDAIAKKQQEPVEQVKKSVAVQISTLKPGDVFGLSNVVFKGEKNLEIEESASVSLISNGSECLLFQKTFFVQHANELLKKHVKELARPYPEEGVFENNYYRQMAWDRYRRGLFSSTLSEI 600          
BLAST of Hsc70-interacting protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23486006 (tr|A0A210R3Q8|A0A210R3Q8_MIZYE Cyclic nucleotide-binding domain-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13297 PE=4 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 3.373e-73
Identity = 170/495 (34.34%), Postives = 260/495 (52.53%), Query Frame = 3
Query:  576 RYLNHIIKITHRQQQQYLYSIDTFSET------DVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVT-ITSNDDYGQ--VRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKEL---------QVPIESKLTRENTLTLNDIKCKLQCF-----------------DQYHFIPMP--LNGGDGNTK---------------SLTRYMWR-SPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYKLQ 1901
            R++  ++KI+    ++   S+DT  +T      +   +  S+ L F+  +FKA KEI ++ E+K IL++  ++RT +QI T M+GL +L +F EYP+H+++KL  VA+F  +  +R+IIRQGH AE FYFI++G A+VT +  N   G   V+T   + +G SFGELALLHHS RTA+V S+   QLL I R DFF IFM   + N+ PEH+ F+           D L++ P+  L HF+K  +V+  +   SEWVY+VK+GSC VL+EL         +  I  K ++  TL   + K K+                    DQ +  P      G  G+T+               +L  +  R +P  L+    + +       K     KE +     VF++V  L  +D +GL ++ F   D+   EN  SV+LVS  AE+++VSK F ++ A   + + IR  +  YP E  F  N +I+ +WE YK Q
Sbjct:  253 RFVQIVLKISAAAGKEP--SVDTGMKTFTDLASEAESTAHSSGLSFDPSYFKAKKEINISTEVKTILSLPSEERTPDQIQTAMFGLQSLRSFAEYPLHMQEKLAKVAWFEVVPAKRIIIRQGHFAENFYFILAGQAVVTLLLRNPKTGASFVKTATIMRRGMSFGELALLHHSRRTATVTSQGGCQLLTIGRQDFFDIFMS-GQGNQIPEHIRFVSQCEFMKDWPIDNLLEHPQFCLLHFFKRNVVVVKDSNFSEWVYVVKAGSCQVLRELKGVKARIKYKAAISDKDSKLPTLGTKEAKPKIDTGIRKRKVKSEGEVELYIQDQENKKPKENTPPGSQGSTRQKEIFSKDNYSKFPTTLKAHFSRAAPEPLETKKKYEVPKRCQPPKPPEPIKETNGKPPPVFVQVEALKPRDSFGLETITFP--DEAEREN-TSVSLVSRGAELIMVSKAFFIKHATPTVKRLIRHQVQPYPDENTFQNNLQIKADWELYKNQ 741          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: zgc:171558 (zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4])

HSP 1 Score: 68.1662 bits (165), Expect = 9.259e-12
Identity = 33/126 (26.19%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  ++  L  + AF ++   L +++C   ++  ++    + RQG +   +Y ++SG+  V ++   +Y    T+ +L  G +FGE ++L ++ R A++VS+ + +LL IE+ +F
Sbjct:   20 LDKRPGERSGEDVDIILARLKVVKAFEKFHPSLLQQICLCGFYEYLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANYQDAVTICTLGIGTAFGE-SILDNTPRHATIVSRENSELLRIEQREF 144          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: zgc:171558 (zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4])

HSP 1 Score: 68.5514 bits (166), Expect = 1.579e-11
Identity = 32/124 (25.81%), Postives = 71/124 (57.26%), Query Frame = 3
Query:  762 MHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            + P +R+ E +  ++  L  + AF ++   L +++C   ++  ++    + RQG +   +Y ++SG+  V ++   +Y    T+ +L  G +FGE ++L ++ R A++VS+ + +LL IE+ +F
Sbjct:   20 LRPGERSGEDVDIILARLKVVKAFEKFHPSLLQQICLCGFYEYLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANYQDAVTICTLGIGTAFGE-SILDNTPRHATIVSRENSELLRIEQREF 142          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: rapgef4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:103034068])

HSP 1 Score: 63.5438 bits (153), Expect = 6.230e-10
Identity = 31/126 (24.60%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  +M  L ++ AF ++   L +++    ++ +++    + RQG +   +Y ++SG+  V ++   ++    T+ +L  G +FGE ++L ++ R A++V++   +LL IE+ +F
Sbjct:   25 LDKRPAERSAEDVDIIMARLKSVKAFEKFHPTLLQQISLCGFYERLEKGITLYRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVTREFSELLRIEQREF 149          

HSP 2 Score: 51.2174 bits (121), Expect = 3.097e-6
Identity = 39/136 (28.68%), Postives = 65/136 (47.79%), Query Frame = 3
Query:  744 MKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRK-IDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVV-SKSSMQLLAIERNDFFYIF 1145
            M+ IL   P QRT + +  +   L  + A +     +K++L  V  F        V+  QG     +Y I+ G+  V I     YG+   V +L +G  FG+LAL++ + R AS+V  + +   L +++ DF  I 
Sbjct:  331 MRMILRKQPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGSVNVVI-----YGK-GVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRIL 460          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 62.003 bits (149), Expect = 1.532e-9
Identity = 55/204 (26.96%), Postives = 86/204 (42.16%), Query Frame = 3
Query:  840 YPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTR---------ENTLTLNDIKC 1424
            YPV   K  C             II++G V    Y +  G   VT        +   + ++  G  FGELA+L++ TRTA+V + ++++L AI+R  F  I M      K+ E++ F+K +P F  L  + L K  +      Y++   I       +  +I+  G  TV +E     E+   R         E  L  N I C
Sbjct:  133 YPVEYSKDSC-------------IIKEGDVGSLVYVMEDGKVEVT-------KEGLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTG-LIKHAEYMEFLKSVPTFHGLPEEILSKLGDVLEETHYEDGDYIIRQGARGDTFFIISKGKVTVTREDAASQETVYLRSLGKGDWFGEKALQGNQISC 315          
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 61.6178 bits (148), Expect = 1.768e-9
Identity = 40/164 (24.39%), Postives = 75/164 (45.73%), Query Frame = 3
Query:  858 KKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTV 1349
            K +    Y R       +I+QG    + + +  G         D Y   + + S++   +FGELA+L++ TRTASV + S ++   ++R + F+  M M+   ++ +H SF++ + + + L  D+L K  +     +Y     +     E    YI+  G   V
Sbjct:  185 KDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNI-------DVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDR-EVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKV 340          

HSP 2 Score: 54.299 bits (129), Expect = 3.187e-7
Identity = 41/141 (29.08%), Postives = 67/141 (47.52%), Query Frame = 3
Query:  753 ILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVS-KSSMQLLAIERNDFFYIFMYMSEFNKY 1172
            I+ M  + R  EQ  + +  +S L++  E  +        V Y+ K D    +IR+G     FY I  G   VT  S  D+ + + +N+L KG  FGE AL+    R+A++++ +  ++ L I+R  F        E  KY
Sbjct:  272 IMRMTAEAR-HEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGD---YVIREGEEGNTFYIIARGKVKVT-QSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKY 407          
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005682.1 (pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1 gene:ENSPMAG00000005146.1 transcript:ENSPMAT00000005682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.639e-20
Identity = 54/200 (27.00%), Postives = 101/200 (50.50%), Query Frame = 3
Query:  768 PKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNS----LSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLK 1355
            P +R++ +++ +   L  LS+F  Y  HL+  L  V  + K   RRVI+++GH    FYF+ SG  +V +T ++D G    ++     L KG  FGE+ALL   +R A++V     +LL +++ DFF   +      ++    ++ + + +FS    + L    +      + +  V++ +  E++ +  V  G C VL+
Sbjct:   13 PSERSDTEVIFLRGLLRGLSSFRRYTAHLQLMLAGVVRYEKFGRRRVIVKKGHYGRRFYFVFSG--LVAVTKDND-GSSAFIDPEPILLRKGAGFGEIALLKDLSRNATIVCMEETELLVVDKEDFFAYKLDQELRKEFQHRYNYFRSLELFSTWSDESLETMADHCKIEEFNHGQVVTGDTSETKNIIFVIKGCCDVLR 209          
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 60.8474 bits (146), Expect = 3.242e-10
Identity = 40/143 (27.97%), Postives = 75/143 (52.45%), Query Frame = 3
Query:  909 IIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSG 1337
            +I QG   + FY I  G   + +T+ND     R V + +   SFGELAL+++++R A++++ S   L  ++R  F  I +  +   K   +  FI+ +P+   LDF + +K  +      +++   I A   +++  Y+V+SG
Sbjct:  178 VIDQGADGDNFYVIERGMYDIYVTTND---VSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRIIVKNAA-KKRKMYECFIETVPLLKSLDFSERLKVVDVIASKSFQDSERIIAQGEKADCFYLVESG 316          
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 51.6026 bits (122), Expect = 1.304e-7
Identity = 32/138 (23.19%), Postives = 70/138 (50.72%), Query Frame = 3
Query:  996 GQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTL 1409
            G  + V       SFGELAL++++ R A++V+ +   L A++R  F  I +  +   K   + +FI+ +P+   LD  + +K  +      Y++   I A   +++  +IV++G   ++ + +    ++ T+E  + +
Sbjct:   12 GAPKKVGCYDNRGSFGELALMYNTPRAATIVATTEGSLWAMDRATFRRIILKNAA-QKRKMYEAFIESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEVEI 148          
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001825.1 (pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gene:ENSPMAG00000001656.1 transcript:ENSPMAT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 1.939e-6
Identity = 28/106 (26.42%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  879 YFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIK 1196
            Y R   P + +IR+G    + Y       ++   S D   +   +  +  G  FGELA+L++  RTA+V + +++++  ++R  F  I +   E  ++ EHV F++
Sbjct:  197 YERAYSPEQAVIREGEAGNHLY-------VLAAASLDCQQRGTCLGHMHPGTVFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQAIVIR-EEQARHQEHVRFLR 294          
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 2.462e-6
Identity = 27/82 (32.93%), Postives = 45/82 (54.88%), Query Frame = 3
Query:  966 IVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIF 1211
            IV  +  + Y  V  V S+ +G SFGELAL++ + R A+V +K+ ++L  I+R+ +  I M  S   K   +  F+  + I 
Sbjct:   15 IVCDSEVEVYVNVELVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILM-GSTLRKRKMYEEFLSKVSIL 95          
BLAST of Hsc70-interacting protein vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 71.2478 bits (173), Expect = 1.373e-13
Identity = 55/200 (27.50%), Postives = 91/200 (45.50%), Query Frame = 3
Query:  765 HPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQ 1364
            H K+++E+Q+  +   +     FN+     K+ +      + +     II+QG   +YFY +  GT    +  N        VNS   G SFGELAL+++S R A+VV+ S   L A++R  F  I +  S F K   +   +K +P+   L      K  +A     Y+    I     + E  Y+++ G+  V K+ Q
Sbjct:  163 HYKEKSEQQLQRLEKSIRNNFLFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDN-------KVNSSGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILL-GSSFKKRLMYDDLLKSMPVLKSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKGQ 354          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO48124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK87])

HSP 1 Score: 171.014 bits (432), Expect = 7.087e-46
Identity = 86/243 (35.39%), Postives = 144/243 (59.26%), Query Frame = 3
Query:  666 DSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKY--PEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLT 1388
            D      L F+   +KA++++ ++ E+K IL    +QRTE+Q   V++ L ++ AF EYP  ++ KL  V ++     +R I+RQG + + FYF++SG+A+VT+    D    RTV+ L +G SFGELA+LH + R ++V+S+  ++LL I R DF  IFM          P+H  F++ +        + L   P+  L HF+++  V+  +   ++W+YI+K GSC VLK+L+  ++S+LT
Sbjct:  128 DKPMDGGLAFDASFYKANRKMRVSAEVKNILQSPQEQRTEQQCAKVLFSLRSIRAFAEYPQRIQHKLINVGWYESHSSKRAILRQGQIPQAFYFVLSGSAVVTVLGEHDTF-ARTVHFLRRGDSFGELAILHDTQRQSTVISREPIELLVISREDFIDIFMLAGGIKNITDPDHQIFLRSLEFLKGWPIELLATNPKKCLFHFFRSGSVLVKDSNHTDWIYIIKWGSCQVLKKLK-EVKSRLT 368          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO37972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE96])

HSP 1 Score: 148.673 bits (374), Expect = 1.231e-41
Identity = 79/174 (45.40%), Postives = 116/174 (66.67%), Query Frame = 3
Query:  687 LRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSA-LSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDY-GQVR--TVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIK 1196
            + F+ +++KA +EI+L+ +  +IL+M P  RT+EQ+   +  L A + AF EYP+ ++++   V ++   + +RVIIRQGH AE FYFI+SGTA+VT+   D   G+ R  TV  L KG SFGELALLHH TR+A+V+ K  + LLA+ R DF  IFM   E  K P+H+ F++
Sbjct:    2 MAFDPNYYKAVREIKLSQDAVQILSMSPGTRTDEQLQGALVALKASVPAFGEYPLKMQQQPVKVGWYESFEAKRVIIRQGHPAENFYFILSGTALVTLLFVDPVTGEQRSNTVAVLGKGSSFGELALLHHKTRSATVLCKEDVALLAVGREDFRDIFMSY-EDGKEPDHIQFLR 174          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO49748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM7])

HSP 1 Score: 142.895 bits (359), Expect = 8.060e-40
Identity = 66/158 (41.77%), Postives = 107/158 (67.72%), Query Frame = 3
Query:  726 IELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQV-RTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIK 1196
            I+++ E+K IL++ P++R  EQ+ TV+Y L  +S+F E P+H+++ +C VA+ + +   ++I++QGH+AE FYFI+SG+  V   ++   GQV  +V +L +G SFG+LA+L + TRTA+VVSK  + LL I R D+  IFM  S+    P H+ F +
Sbjct:    1 IQISKEVKSILSLRPEERNTEQLQTVLYALQTMSSFAELPLHMQESVCKVAWHQSLPANKIIVKQGHLAENFYFIMSGSVTVVSENDPTSGQVFASVATLRRGASFGDLAILKNCTRTATVVSKVPIHLLVISREDYQRIFMGRSQDGMEPSHIKFCR 158          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO32932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN2])

HSP 1 Score: 92.0485 bits (227), Expect = 6.387e-22
Identity = 45/136 (33.09%), Postives = 82/136 (60.29%), Query Frame = 3
Query:  741 EMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVT-----ITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            E+K +L      R+ E++  V+  +  +  F  YP+++K++L  V Y+   +  RVII+QGH+   FYFI+SG+ +V       T+ + + Q+  ++ ++ G SFGELAL+H   RTA+++ K   + L ++++DF
Sbjct:    1 EVKNVLKKLSYNRSVEEVDMVLQIVKRMKGFQRYPMYVKRELAKVLYYDVYEQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQI--ISEMTGGDSFGELALMHDIRRTATIICKERSEFLRVDKDDF 134          
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Match: EDO32940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN1])

HSP 1 Score: 77.7962 bits (190), Expect = 6.786e-17
Identity = 47/152 (30.92%), Postives = 77/152 (50.66%), Query Frame = 3
Query:  732 LTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVA-EYFYFIISGTAIVTITSNDD-YGQV--RTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYP 1175
            ++ + K +    P  RT E I  +   +  L AF +Y V  ++ L  V Y+ + +  RV+++QGH      YFI+SG  +V +   D   G++    V  +  G SFGELALLH   RTA+++ K   + L +++  F  +   +S    YP
Sbjct:    1 MSDKAKNLFKKPPWLRTSEDIKVIGGVVDKLKAFKKYSVLERRGLAKVVYYEQFEDGRVVVQQGHKGISSLYFILSGAVLVQVAEEDKTTGKITEHIVGEMFAGDSFGELALLHDIKRTATIICKGRAEFLRLDKPGFDEVRRQLSSTASYP 152          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: zgc:171558 (rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:101167824])

HSP 1 Score: 71.2478 bits (173), Expect = 2.133e-12
Identity = 34/126 (26.98%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  ++  L  + AF  +P  L  ++C  A++  ++    + RQG +   +Y ++SG+  V ++   ++    T+ +L  G +FGE ++L ++ R A++VS+ + +LL IE+ +F
Sbjct:   26 LDKRPSERSGEDVDIILTRLREVKAFQRFPPPLLLQICACAFYECLEKGITLFRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVSRETSELLRIEQREF 150          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: zgc:171558 (rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:101167824])

HSP 1 Score: 70.8626 bits (172), Expect = 3.038e-12
Identity = 34/126 (26.98%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF 1133
            L   P +R+ E +  ++  L  + AF  +P  L  ++C  A++  ++    + RQG +   +Y ++SG+  V ++   ++    T+ +L  G +FGE ++L ++ R A++VS+ + +LL IE+ +F
Sbjct:   21 LDKRPSERSGEDVDIILTRLREVKAFQRFPPPLLLQICACAFYECLEKGITLFRQGDIGTSWYAVLSGSLDVKVSETANHQDAVTICTLGIGTAFGE-SILDNTPRHATIVSRETSELLRIEQREF 145          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 66.6254 bits (161), Expect = 3.433e-11
Identity = 44/176 (25.00%), Postives = 85/176 (48.30%), Query Frame = 3
Query:  756 LTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDF------FYIFMYMSEFNKYP--EHVSFIKDIPIFSHLDFDQLVKQPEASL 1259
            L   P++R+ E +  ++  L  + AF  +   L +++C   ++  ++   ++ RQG +   +Y ++SG+  V ++    Y    T+ +L  G +FGE ++L ++ R A++V++   +LL IE+ +F      FY  M       Y   E       IP   ++ F  L K P  +L
Sbjct:   20 LDKRPEERSSEDVDIILARLKKVKAFKGFNPSLLQQICLCGFYEGLEKGIMLYRQGDIGTSWYTVLSGSLDVKVSETSSYQDGVTICTLGTGTAFGE-SILDNTPRHATIVTREFSELLRIEQKEFRSLWEKFYYCMAGLLVPPYGVMESTCGSDRIPDKENIPFVPLSKHPNKTL 194          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 60.077 bits (144), Expect = 6.302e-9
Identity = 48/173 (27.75%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  840 YPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            YPV   K  C             II++G V    Y +  G   VT  +         + ++  G  FGELA+L++ TRTA+V + ++++L AI+R  F  I M      K+ E++ F+K +P F  L  D L K  +      Y     I       +  +I+  G   V +E
Sbjct:  133 YPVEYGKDSC-------------IIKEGDVGSLVYVMEDGKVEVTKEN-------LKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTG-LIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTRE 284          
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 59.6918 bits (143), Expect = 8.263e-9
Identity = 48/173 (27.75%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  840 YPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            YPV   K  C             II++G V    Y +  G   VT  +         + ++  G  FGELA+L++ TRTA+V + ++++L AI+R  F  I M      K+ E++ F+K +P F  L  D L K  +      Y     I       +  +I+  G   V +E
Sbjct:  133 YPVEYGKDSC-------------IIKEGDVGSLVYVMEDGKVEVTKEN-------LKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTG-LIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTRE 284          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000046966.1 (SMESG000046966.1)

HSP 1 Score: 1264.6 bits (3271), Expect = 0.000e+0
Identity = 619/620 (99.84%), Postives = 619/620 (99.84%), Query Frame = 3
Query:   75 MQDFARPENYQGSNLMTIKKIAENIRLENNKAKHSFHFTNSKNETWLREDKSFKGLSNHGDFQNKRSQFKDIKSKKFNYQKFILSNKMTKVKRESLLIDSDLIKLNEKITQLETINTVNPIVTKSQNVAPTTKFLFGMILSKKTEXXXXXXXXSRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYKLQRYNSTLKKIIP 1934
            MQDFARPENYQGSNLMTIKKIAENIRLENNK KHSFHFTNSKNETWLREDKSFKGLSNHGDFQNKRSQFKDIKSKKFNYQKFILSNKMTKVKRESLLIDSDLIKLNEKITQLETINTVNPIVTKSQNVAPTTKFLFGMILSKKTEAAIKKKAISRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYKLQRYNSTLKKIIP
Sbjct:    1 MQDFARPENYQGSNLMTIKKIAENIRLENNKTKHSFHFTNSKNETWLREDKSFKGLSNHGDFQNKRSQFKDIKSKKFNYQKFILSNKMTKVKRESLLIDSDLIKLNEKITQLETINTVNPIVTKSQNVAPTTKFLFGMILSKKTEAAIKKKAISRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYKLQRYNSTLKKIIP 620          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 192.2 bits (487), Expect = 1.004e-52
Identity = 139/463 (30.02%), Postives = 229/463 (49.46%), Query Frame = 3
Query:  534 SRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNK-LRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLS-ALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTI-----TSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQL-VKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKEL-QVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRIEWEKYK 1895
            S+   AIK I   L+      + T + +++YL   D  S+ +      + K L FN   F+A KE  L  E  KIL  H   RT  QI +V+  L+  + AF+E+P+ +++ L    ++ K +P++VIIRQGH A+ FYFIISG  +V++     +S + YG+  TV  L KG SFGELAL++   R+ASV+  ++++LL++ R DF  IFM ++  N  PEH+ F++++ I      D L    P   L  +++   V+  +    EW+YI+ +GSC V+K L Q P   KL +                    + P+ + G                 ++K  D    KN+  S                ++I++  L +KDI+GL SV F         + +SV LVS+ AE V ++K F  Q   +  ++ +R  +  +P E++  E ++   +W  ++
Sbjct:  208 SKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGE--TVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLAT-NTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSP--GKLYK------------------LRYNPLKIEG-----------------LVKQND----KNDNGSKM--------------IYIQLNVLNSKDIFGLESVAFE-----LLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQ 607          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 180.644 bits (457), Expect = 9.477e-49
Identity = 135/437 (30.89%), Postives = 216/437 (49.43%), Query Frame = 3
Query:  534 SRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNK-LRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLS-ALSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTI-----TSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQL-VKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKEL-QVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIR 1817
            S+   AIK I   L+      + T + +++YL   D  S+ +      + K L FN   F+A KE  L  E  KIL  H   RT  QI +V+  L+  + AF+E+P+ +++ L    ++ K +P++VIIRQGH A+ FYFIISG  +V++     +S + YG+  TV  L KG SFGELAL++   R+ASV+  ++++LL++ R DF  IFM ++  N  PEH+ F++++ I      D L    P   L  +++   V+  +    EW+YI+ +GSC V+K L Q P   KL +                    + P+ + G                 ++K  D    KN+  S                ++I++  L +KDI+GL SV F         + +SV LVS+ AE V ++K F  Q   +  ++ +R
Sbjct:  208 SKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQSDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGE--TVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLAT-NTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSP--GKLYK------------------LRYNPLKIEG-----------------LVKQND----KNDNGSKM--------------IYIQLNVLNSKDIFGLESVAFE-----LLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLR 581          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000078298.1 (SMESG000078298.1)

HSP 1 Score: 170.244 bits (430), Expect = 8.472e-45
Identity = 134/480 (27.92%), Postives = 235/480 (48.96%), Query Frame = 3
Query:  537 RFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSA-LSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTIT-SNDDYGQV--RTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQL-VKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRI----EWEKYKLQRYNSTLKKIIP*KQNF 1949
            +F   I++ +  ++      + T R  +++L    TF++  V +    +   F+   FKA KE  L+ +  +I+ ++PKQR+ E + +    ++A + AF+E+P++++  L    ++ K + +R+IIRQGH A  FYFIISG   V++  +N   G+    TV  L KG SFGELAL+    R+A+V  K+ ++LLA+ R DF  IFM  S  N+ P+H+  ++ +P+ S    D+L    P   L  +++   V+  +     WVYIVKSG+C ++K +Q  + S+  +E       +K +    D + F+         +TKS +++    P  ++P   F                 N + YI + I    L    ++GL  + F             V LVS+ AE+V + + F  +  +      +R+ L  +P+    +EN K ++    +W  YK     S ++ II  K N+
Sbjct:  222 KFLHGIRIAMLLMKTCRTSSQQTERNNKKFL----TFADYQVAEVDKKSNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSS-NEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQ--LNSQEQKEK------LKHQRDSNDYFTFLTQSFT---HSTKSHSKHEI-PPPEIRPSKEF-----------------NGKYYIQLKI----LSVGSVFGLEPMAFEF-----VGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPT----IENLKGKLKNFYQWADYK----ESMIRAIIFDKLNY 650          
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Match: SMESG000006310.1 (SMESG000006310.1)

HSP 1 Score: 75.485 bits (184), Expect = 4.393e-15
Identity = 49/156 (31.41%), Postives = 83/156 (53.21%), Query Frame = 3
Query:  894 DPRRVIIRQGHVAEYFYFIISGTAIVTITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLD-FDQLVKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKE 1358
            +P  +II+QG   + FY I  G   V I  N +Y     VNS+ +G SFGELAL++ + R A+V +++ ++L  I+R+ +  I M  S   K   +  F+  +PI  +LD +++L          F  N IV+   D   ++ +I+  G+  VL++
Sbjct:    7 NPAEIIIQQGDEGDNFYIIDQGQ--VDIIMNGEY-----VNSVVEGGSFGELALIYGTPRAATVRARTEVKLWGIDRDSYRRILM-GSTIRKRRMYEEFLSKVPILENLDKWERLTVADALETVCFENNQIVVKQGDPGDDF-FIITDGTAAVLQQ 153          
The following BLAST results are available for this feature:
BLAST of Hsc70-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBD21.090e-1727.94cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD22.144e-1727.94cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD22.335e-1727.94cyclic nucleotide binding domain containing 2 [Sou... [more]
RAPGEF44.413e-1126.19Rap guanine nucleotide exchange factor 4 [Source:H... [more]
RAPGEF45.103e-1126.19Rap guanine nucleotide exchange factor 4 [Source:H... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkg-28.894e-1134.68Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
pkg-21.277e-1034.68Protein Kinase, cGMP-dependent [Source:UniProtKB/... [more]
kin-21.743e-932.00cAMP-dependent protein kinase regulatory subunit ... [more]
kin-23.542e-930.67cAMP-dependent protein kinase regulatory subunit ... [more]
kin-23.795e-930.67cAMP-dependent protein kinase regulatory subunit ... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG126983.749e-1022.71gene:FBgn0030721 transcript:FBtr0074139[more]
Pka-R14.994e-1028.48gene:FBgn0259243 transcript:FBtr0302639[more]
Pka-R15.229e-1028.48gene:FBgn0259243 transcript:FBtr0300533[more]
Pka-R15.229e-1028.48gene:FBgn0259243 transcript:FBtr0300529[more]
Pka-R15.452e-1028.48gene:FBgn0259243 transcript:FBtr0302638[more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1715582.094e-1125.40zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4][more]
rapgef42.195e-1126.19Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
rapgef42.506e-1126.19Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
zgc:1715582.924e-1125.40zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4][more]
prkg21.107e-924.73protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp48.281e-1628.08bone morphogenetic protein 4 [Source:Xenbase;Acc:X... [more]
RAPGEF41.017e-1124.12Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF41.023e-1124.12Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF46.323e-1123.60Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF46.839e-1124.03Rap guanine nucleotide exchange factor 4 [Source:N... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnbd24.662e-1626.34cyclic nucleotide binding domain containing 2 [Sou... [more]
Cnbd21.509e-1526.34cyclic nucleotide binding domain containing 2 [Sou... [more]
Cnbd25.187e-1427.40cyclic nucleotide binding domain containing 2 [Sou... [more]
Rapgef46.706e-1225.56Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
Rapgef47.421e-1226.19Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
back to top
BLAST of Hsc70-interacting protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95JR6|CNBD2_MACFA7.424e-1727.94Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q96M20|CNBD2_HUMAN1.030e-1627.94Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q9D5U8|CNBD2_MOUSE1.056e-1426.34Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q6BZG7|KAPR_DEBHA2.001e-1332.89cAMP-dependent protein kinase regulatory subunit O... [more]
sp|P31320|KAPR_BLAEM2.357e-1332.91cAMP-dependent protein kinase regulatory subunit O... [more]
back to top
BLAST of Hsc70-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|211119162.716e-8237.74tr|A0A2T7PBG8|A0A2T7PBG8_POMCA Cyclic nucleotide-b... [more]
gnl|BL_ORD_ID|238496682.227e-7937.33tr|V4B1D3|V4B1D3_LOTGI Cyclic nucleotide-binding d... [more]
gnl|BL_ORD_ID|182969153.165e-7733.94tr|A0A1I8INL6|A0A1I8INL6_9PLAT Cyclic nucleotide-b... [more]
gnl|BL_ORD_ID|183285835.133e-7734.27tr|A0A267H3W5|A0A267H3W5_9PLAT Cyclic nucleotide-b... [more]
gnl|BL_ORD_ID|234860063.373e-7334.34tr|A0A210R3Q8|A0A210R3Q8_MIZYE Cyclic nucleotide-b... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1715589.259e-1226.19zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4][more]
zgc:1715581.579e-1125.81zgc:171558 [Source:ZFIN;Acc:ZDB-GENE-080219-4][more]
rapgef46.230e-1024.60Rap guanine nucleotide exchange factor 4 [Source:N... [more]
prkg1a1.532e-926.96protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
prkg21.768e-924.39protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005682.11.639e-2027.00pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1... [more]
si:ch211-272n13.73.242e-1027.97protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa1.304e-723.19protein kinase, cAMP-dependent, regulatory, type I... [more]
ENSPMAT00000001825.11.939e-626.42pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gen... [more]
ENSPMAT00000005026.12.462e-632.93pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY11.373e-1327.50Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481247.087e-4635.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379721.231e-4145.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497488.060e-4041.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329326.387e-2233.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329406.786e-1730.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hsc70-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1715582.133e-1226.98rap guanine nucleotide exchange factor 4 [Source:N... [more]
zgc:1715583.038e-1226.98rap guanine nucleotide exchange factor 4 [Source:N... [more]
rapgef43.433e-1125.00Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
prkg16.302e-927.75protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg18.263e-927.75protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
back to top
BLAST of Hsc70-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046966.10.000e+099.84SMESG000046966.1[more]
SMESG000069771.11.004e-5230.02SMESG000069771.1[more]
SMESG000069771.19.477e-4930.89SMESG000069771.1[more]
SMESG000078298.18.472e-4527.92SMESG000078298.1[more]
SMESG000006310.14.393e-1531.41SMESG000006310.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000656 ID=SMED30000656|Name=Hsc70-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1969bp
CACTTCAATGCTATGCTAATTAGTTCATATATTTATCAGATCCACATTTC
ACAGCCGAAAAAATATATTTAAAAATGCAAGATTTCGCTAGACCAGAAAA
TTATCAAGGAAGTAATTTGATGACAATCAAGAAGATCGCAGAAAATATAA
GATTAGAGAATAATAAAGCCAAACATAGTTTCCATTTTACCAATTCGAAA
AATGAAACTTGGTTAAGGGAGGACAAATCTTTCAAAGGATTATCAAATCA
TGGAGATTTTCAAAATAAAAGAAGTCAGTTCAAAGATATTAAAAGTAAAA
AATTTAATTATCAGAAATTCATTTTGTCTAACAAAATGACGAAAGTGAAA
AGAGAAAGTTTACTAATTGATAGTGACTTGATAAAGTTAAATGAAAAAAT
TACCCAATTAGAAACAATAAACACTGTAAATCCAATAGTCACTAAGTCCC
AAAATGTAGCTCCTACAACCAAATTTCTGTTCGGAATGATTTTGAGTAAA
AAGACAGAAGCTGCTATTAAGAAAAAAGCTATAAGTCGGTTCACTTGGGC
AATAAAAATGATAATAGCTTGGTTGAGATATTTAAATCATATAATAAAAA
TAACTCACAGACAACAGCAGCAGTACCTCTATTCCATCGATACATTCAGT
GAAACCGATGTATTCGATTCTACAGACTCTAATAAACTGAGATTCAACAA
GCACCATTTCAAAGCATCAAAAGAGATCGAACTTACTCCAGAAATGAAAA
AGATTCTCACGATGCATCCGAAACAAAGAACAGAGGAACAAATATTGACA
GTGATGTATGGCTTATCTGCCCTATCAGCCTTTAACGAGTATCCTGTGCA
TTTAAAGAAAAAACTTTGTACAGTTGCTTATTTTCGGAAAATTGACCCTC
GCAGGGTGATAATCCGACAAGGACACGTTGCGGAATACTTCTATTTCATT
ATATCCGGAACTGCAATAGTGACTATTACTTCGAATGATGATTATGGTCA
AGTTCGGACTGTGAATTCATTAAGTAAAGGATGTAGTTTTGGAGAACTTG
CCCTACTGCACCACAGTACAAGGACGGCAAGTGTTGTGAGTAAATCTTCT
ATGCAGTTACTGGCTATCGAAAGAAATGATTTTTTCTATATCTTTATGTA
TATGTCTGAATTTAATAAATATCCCGAACATGTCTCATTTATCAAAGATA
TTCCAATTTTTTCCCACTTGGATTTTGATCAACTTGTTAAGCAACCAGAA
GCAAGTCTGTGTCATTTTTATAAGAATCTGATAGTGATATCAGCAAATGA
CATTGAATCTGAATGGGTTTATATTGTCAAATCGGGAAGTTGTACAGTAT
TGAAAGAGCTGCAGGTGCCTATAGAATCAAAACTGACTAGAGAGAATACC
TTAACACTTAACGACATCAAATGTAAGCTTCAGTGCTTTGACCAGTACCA
TTTCATTCCAATGCCACTCAACGGAGGTGATGGAAACACAAAATCACTGA
CTCGTTATATGTGGAGATCTCCGACCATGCTGAAACCCGGAGATTATTTT
TATTTGAAAAATGAAACAGACAGCAACAAGACTTCTTTAAATCAAAAAGA
AAATTCCAGAAATTACATAAGTGTTTTTATCAAAGTTGCTGATCTCATTG
CAAAAGATATTTACGGTCTATCAAGTGTTATTTTCACATCAGAGGACAAA
GTGAGGACGGAAAATATGGCATCAGTAGCCTTGGTATCCAATAGAGCAGA
AATGGTTCTTGTATCAAAAAAGTTTCTAGTTCAAAAAGCGAATGATGACC
TCATCAAAGACATCCGACAAGGTTTGACACAATATCCTTCAGAAAAAATC
TTTCTCGAAAATTACAAAATACGAATTGAATGGGAAAAGTACAAACTTCA
AAGATACAATTCCACATTAAAAAAAATCATTCCATGAAAACAAAATTTTT
TATTTTCCTAAATGTTGCT
back to top

protein sequence of SMED30000656-orf-1

>SMED30000656-orf-1 ID=SMED30000656-orf-1|Name=SMED30000656-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=621bp
MQDFARPENYQGSNLMTIKKIAENIRLENNKAKHSFHFTNSKNETWLRED
KSFKGLSNHGDFQNKRSQFKDIKSKKFNYQKFILSNKMTKVKRESLLIDS
DLIKLNEKITQLETINTVNPIVTKSQNVAPTTKFLFGMILSKKTEAAIKK
KAISRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDST
DSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSAL
SAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVT
ITSNDDYGQVRTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIER
NDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQLVKQPEASLCHFYK
NLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKC
KLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDS
NKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMAS
VALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIR
IEWEKYKLQRYNSTLKKIIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0000166nucleotide binding
GO:0003674molecular_function
GO:0004862cAMP-dependent protein kinase inhibitor activity
GO:0008603cAMP-dependent protein kinase regulator activity
GO:0030552cAMP binding
GO:0042802identical protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005575cellular_component
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005952cAMP-dependent protein kinase complex
Vocabulary: biological process
TermDefinition
GO:0001932regulation of protein phosphorylation
GO:0045762positive regulation of adenylate cyclase activity
GO:0045859regulation of protein kinase activity
GO:0046580negative regulation of Ras protein signal transduction
GO:0046827positive regulation of protein export from nucleus
GO:0051447negative regulation of meiotic cell cycle
GO:0071901negative regulation of protein serine/threonine kinase activity
GO:0097271protein localization to bud neck
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 252..372
e-value: 3.7E-14
score: 63.1
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 271..358
e-value: 7.1E-17
score: 61.3
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 252..358
score: 23.465
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 252..358
e-value: 7.69089E-22
score: 88.9221
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 206..370
e-value: 8.4E-33
score: 115.2
NoneNo IPR availablePANTHERPTHR23011:SF31coord: 200..612
NoneNo IPR availablePANTHERPTHR23011UNCHARACTERIZEDcoord: 200..612
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 322..339
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 228..363
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 365..427