Kaptin (actin binding protein)

Overview
NameKaptin (actin binding protein)
Smed IDSMED30000653
Length (bp)1547
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kaptin (actin binding protein) (SMED30000653) t-SNE clustered cells

Violin plots show distribution of expression levels for Kaptin (actin binding protein) (SMED30000653) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kaptin (actin binding protein) (SMED30000653) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kaptin (actin binding protein) (SMED30000653) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000653

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000653SMESG000047046.1 Contig4438GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000653SMESG000076606.1 Contig4438GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30000653SMESG000076606.1 dd_Smed_v4_8156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000653SMESG000076606.1 dd_Smed_v4_8156_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kaptin (actin binding protein) vs. Ensembl Human
Match: KPTN (kaptin, actin binding protein [Source:HGNC Symbol;Acc:HGNC:6404])

HSP 1 Score: 108.997 bits (271), Expect = 5.449e-25
Identity = 71/232 (30.60%), Postives = 122/232 (52.59%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPIT-----SLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQT--SGLMDSG-SFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F E + +   VL++D        +R+S  GC  G   V+ ++ +  E+L  +S   + PI+     SL     T+  P            + +Y ++V S +E +VVY+D +      L++Q  L  SDQ+D VL S V D+D+DG  E+L+ T+   +L YK++   SGL ++   F L+ ++  +  + A+ HVD+T DG++EL V++ +G+HI Q  L     ++  RL
Sbjct:  191 FPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRP-----------LQDEYSVLVASMLEPAVVYRDLLNRG---LEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRL 408          
BLAST of Kaptin (actin binding protein) vs. Ensembl Human
Match: KPTN (kaptin, actin binding protein [Source:HGNC Symbol;Acc:HGNC:6404])

HSP 1 Score: 58.151 bits (139), Expect = 9.600e-9
Identity = 41/143 (28.67%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPIT-----SLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDID 1260
            F E + +   VL++D        +R+S  GC  G   V+ ++ +  E+L  +S   + PI+     SL     T+  P            + +Y ++V S +E +VVY+D +      L++Q  L  SDQ+D VL S V D+D
Sbjct:  135 FPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRP-----------LQDEYSVLVASMLEPAVVYRDLLNR---GLEDQLLLPGSDQFDSVLCSLVTDVD 263          
BLAST of Kaptin (actin binding protein) vs. Ensembl Zebrafish
Match: kptn (kaptin (actin binding protein) [Source:ZFIN;Acc:ZDB-GENE-040801-258])

HSP 1 Score: 125.176 bits (313), Expect = 8.453e-31
Identity = 74/228 (32.46%), Postives = 129/228 (56.58%), Query Frame = 1
Query:  835 INQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            + + F E   +   VL++D  ++ +  +R++ FGC  G   +S++N K  EIL  +  +H+SPI+++ L    Q     +       + R  ++L+V SA+E +VVY+D  +   + L  Q CL  SDQ D VL + VVD+D DG+ E+L+GT+   +L YK+  +        + + ++     + +++++D+T DG+KEL VLT +GLHI Q  L    +++ QRL
Sbjct:  183 VERLFPELQDLPSNVLWLDV-LSLDQNRRLTAFGCQSGCVGLSVVNQKGPEILQNWRVQHDSPISTVLLFPLKQHQQNTD----TKSNQRVTFNLLVTSAIEMAVVYRDVEQ---YGLSRQLCLAESDQCDAVLCALVVDLDFDGQHELLLGTYGQDLLCYKFDQTSETFEEKLQPLWRRSFKSPLLSLIYLDLTGDGLKELAVLTLKGLHILQHSLKTTADLVVQRL 402          
BLAST of Kaptin (actin binding protein) vs. Ensembl Zebrafish
Match: kptn (kaptin (actin binding protein) [Source:ZFIN;Acc:ZDB-GENE-040801-258])

HSP 1 Score: 124.79 bits (312), Expect = 1.233e-30
Identity = 74/228 (32.46%), Postives = 129/228 (56.58%), Query Frame = 1
Query:  835 INQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            + + F E   +   VL++D  ++ +  +R++ FGC  G   +S++N K  EIL  +  +H+SPI+++ L    Q     +       + R  ++L+V SA+E +VVY+D  +   + L  Q CL  SDQ D VL + VVD+D DG+ E+L+GT+   +L YK+  +        + + ++     + +++++D+T DG+KEL VLT +GLHI Q  L    +++ QRL
Sbjct:  183 VERLFPELQDLPSNVLWLDV-LSLDQNRRLTAFGCQSGCVGLSVVNQKGPEILQNWRVQHDSPISTVLLFPLKQHQQNTD----TKSNQRVTFNLLVTSAIEMAVVYRDVEQ---YGLSRQLCLAESDQCDAVLCALVVDLDFDGQHELLLGTYGQDLLCYKFDQTSESFEEKLQPLWRRSFKSPLLSLIYLDLTGDGLKELAVLTLKGLHILQHSLKTTADLVVQRL 402          
BLAST of Kaptin (actin binding protein) vs. Ensembl Zebrafish
Match: kptn (kaptin (actin binding protein) [Source:ZFIN;Acc:ZDB-GENE-040801-258])

HSP 1 Score: 121.324 bits (303), Expect = 1.404e-29
Identity = 74/235 (31.49%), Postives = 131/235 (55.74%), Query Frame = 1
Query:  835 INQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRLMLM*YIL 1539
            + + F E   +   VL++D  ++ +  +R++ FGC  G   +S++N K  EIL  +  +H+SPI+++ L    Q     +       + R  ++L+V SA+E +VVY+D  +   + L  Q CL  SDQ D VL + VVD+D DG+ E+L+GT+   +L YK+  +        + + ++     + +++++D+T DG+KEL VLT +GLHI Q+        +  RL+L+ Y +
Sbjct:  183 VERLFPELQDLPSNVLWLDV-LSLDQNRRLTAFGCQSGCVGLSVVNQKGPEILQNWRVQHDSPISTVLLFPLKQHQQNTD----TKSNQRVTFNLLVTSAIEMAVVYRDVEQ---YGLSRQLCLAESDQCDAVLCALVVDLDFDGQHELLLGTYGQDLLCYKFDQTSETFEEKLQPLWRRSFKSPLLSLIYLDLTGDGLKELAVLTLKGLHILQV------GCVRNRLLLIRYCI 403          
BLAST of Kaptin (actin binding protein) vs. Ensembl Zebrafish
Match: kptn (kaptin (actin binding protein) [Source:ZFIN;Acc:ZDB-GENE-040801-258])

HSP 1 Score: 94.7449 bits (234), Expect = 2.766e-22
Identity = 52/139 (37.41%), Postives = 85/139 (61.15%), Query Frame = 1
Query: 1102 RTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            R  ++L+V SA+E +VVY+D  +   + L  Q CL  SDQ D VL + VVD+D DG+ E+L+GT+   +L YK+  +        + + ++     + +++++D+T DG+KEL VLT +GLHI Q  L    +++ QRL
Sbjct:    4 RVTFNLLVTSAIEMAVVYRDVEQ---YGLSRQLCLAESDQCDAVLCALVVDLDFDGQHELLLGTYGQDLLCYKFDQTSESFEEKLQPLWRRSFKSPLLSLIYLDLTGDGLKELAVLTLKGLHILQHSLKTTADLVVQRL 139          
BLAST of Kaptin (actin binding protein) vs. Ensembl Xenopus
Match: KPTN (kaptin, actin binding protein [Source:HGNC Symbol;Acc:HGNC:6404])

HSP 1 Score: 111.309 bits (277), Expect = 6.775e-26
Identity = 70/224 (31.25%), Postives = 115/224 (51.34%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F E   +   V ++        ++RI+ +GC  G   V+ +  +  EIL  +S + + P++ + +      MP    G     +   +Y ++V S +E SVVY++ + +    L  Q  L  SDQ+D VL + + D+D DGELEIL+GT+   +L YK+          F+L+ ++     +H I +VD+T DG+ EL V+  +GLHI Q  L +    L QRL
Sbjct:  186 FPELKEITNNVTWLSVYNIPGTHRRITAYGCQSGYICVAHVEQRNREILQCWSVQQDGPLSKVLVFC----MP----GFGREQNLEKEYSVLVTSTIELSVVYRNVLING---LNEQLLLPESDQFDSVLCAELADVDFDGELEILLGTYGQELLCYKYIKMLGHQGPKFQLLWQRSFPSPLHCIAYVDLTSDGLCELAVVCLKGLHILQHSLTHAGKCLIQRL 398          
BLAST of Kaptin (actin binding protein) vs. Ensembl Mouse
Match: Kptn (kaptin [Source:MGI Symbol;Acc:MGI:1890380])

HSP 1 Score: 119.013 bits (297), Expect = 1.151e-28
Identity = 78/230 (33.91%), Postives = 122/230 (53.04%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPIT-----SLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLM-DSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F E + +   VL++D      + QR+S  GC  G   V+ ++ K  EIL  ++ + + PI+     SL     TQ  P+ E            Y L+V S +E +VVY D +      L +Q  L  SDQ+D VL   V D+D+DG+ E+L+ T+   +L YK++  GL  DS  FRL+ ++  A  + A+ HVD+T DG++EL V++ +G+HI Q  L     ++  RL
Sbjct:  190 FPELTNLTSSVLWLDVHNLPGSSQRLSALGCQSGYVRVAHVDQKNQEILQTWTIQQDGPISRVIVFSLSASEATQDSPQQE-----------GYSLLVASMLEPAVVYWDLLNKG---LDDQLLLPGSDQFDSVLCGLVTDVDLDGQPEVLVATYGQELLCYKYR--GLPEDSRGFRLLWRRSFASPLLAMAHVDLTGDGLRELAVISLKGVHILQHSLIQASELVLTRL 403          
BLAST of Kaptin (actin binding protein) vs. UniProt/SwissProt
Match: sp|Q8VCX6|KPTN_MOUSE (KICSTOR complex protein kaptin OS=Mus musculus OX=10090 GN=Kptn PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.427e-28
Identity = 79/230 (34.35%), Postives = 123/230 (53.48%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPIT-----SLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLM-DSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F E + +   VL++D      + QR+S  GC  G   V+ ++ K  EIL  ++ + + PI+     SL     TQ  P+ E            Y L+V S +E +VVY D +      L +Q  L  SDQ+D VL   V D+D+DG+LE+L+ T+   +L YK++  GL  DS  FRL+ ++  A  + A+ HVD+T DG++EL V++ +G+HI Q  L     ++  RL
Sbjct:  190 FPELTNLTSSVLWLDVHNLPGSSQRLSALGCQSGYVRVAHVDQKNQEILQTWTIQQDGPISRVIVFSLSASEATQDSPQQE-----------GYSLLVASMLEPAVVYWDLLNKG---LDDQLLLPGSDQFDSVLCGLVTDVDLDGQLEVLVATYGQELLCYKYR--GLPEDSRGFRLLWRRSFASPLLAMAHVDLTGDGLRELAVISLKGVHILQHSLIQASELVLTRL 403          
BLAST of Kaptin (actin binding protein) vs. UniProt/SwissProt
Match: sp|Q9Y664|KPTN_HUMAN (KICSTOR complex protein kaptin OS=Homo sapiens OX=9606 GN=KPTN PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 2.617e-24
Identity = 71/232 (30.60%), Postives = 122/232 (52.59%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPIT-----SLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQT--SGLMDSG-SFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F E + +   VL++D        +R+S  GC  G   V+ ++ +  E+L  +S   + PI+     SL     T+  P            + +Y ++V S +E +VVY+D +      L++Q  L  SDQ+D VL S V D+D+DG  E+L+ T+   +L YK++   SGL ++   F L+ ++  +  + A+ HVD+T DG++EL V++ +G+HI Q  L     ++  RL
Sbjct:  191 FPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRP-----------LQDEYSVLVASMLEPAVVYRDLLNRG---LEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRL 408          
BLAST of Kaptin (actin binding protein) vs. UniProt/SwissProt
Match: sp|A0A1D5PJB7|KPTN_CHICK (KICSTOR complex protein kaptin OS=Gallus gallus OX=9031 GN=KPTN PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 8.226e-18
Identity = 62/239 (25.94%), Postives = 113/239 (47.28%), Query Frame = 1
Query:  835 INQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGV---------PNAPSARTD--YHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            +++ F E   +    L++D      + +R++  GC  G   V+ ++     +L  +S + + PI+++ L    +     ++           P+AP       Y L+V S +E SVVY+D +      L  Q  L  SD +D VL + +    +DG  E+L+GT+   +L Y ++         F+L+  ++  G V A+   D+T DG++E+ V   +GLH+ Q  L      L++RL
Sbjct:  179 LHELFPELQELPSSALWLDVCTVPSSRRRLTAVGCQSGYVRVAHVDQDTRAVLQSWSIQQDGPISTVLLFPLEEPDDDGDVAGGHRGADDVGPSAPGPEPTPHYSLLVASTIEMSVVYRDVLSRG---LTEQLSLPGSDHHDAVLCAMLACTALDGGREVLLGTYGQELLCYAYRGR----RCGFQLLWTRRFPGPVLALCGADLTGDGLREVAVGCLQGLHVLQHSLEPTAQRLKERL 410          
BLAST of Kaptin (actin binding protein) vs. TrEMBL
Match: A0A4Y2SKJ3 (KICSTOR complex protein kaptin OS=Araneus ventricosus OX=182803 GN=Kptn_1 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.771e-39
Identity = 87/224 (38.84%), Postives = 137/224 (61.16%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F EFS +   V++MDF   +E   RI+  GC  G  +VS +NL ++ + A +  EH+ PI+++ L  ++  +  ++ G  +        HL V +A+E SVVY+D ++H G  LKNQ  L  S  YDCV+ S + DIDMDG+ E+L+GT+   +L+YKW+ +   + GS++L  KQ     + A+ ++D+  DG+KELLVLT+ GLHI Q  L  V++I  +R+
Sbjct:   83 FPEFSSLNSLVMWMDFFATSE--YRITALGCKDGFVIVSSVNLPETTLQASWKIEHDGPISTVRLFQDST-LESMQNGFFSKTRKDDKIHLCVGNAIEVSVVYRDILKH-GLELKNQELLPESSMYDCVVCSLIADIDMDGKNEVLLGTYGQELLVYKWEVAS-GNKGSYKLYHKQMFPHPLLALSYMDIIGDGVKELLVLTTNGLHILQHDLTQVRDICVERM 301          
BLAST of Kaptin (actin binding protein) vs. TrEMBL
Match: A0A4Y2Q572 (KICSTOR complex protein kaptin OS=Araneus ventricosus OX=182803 GN=Kptn_2 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.465e-38
Identity = 87/224 (38.84%), Postives = 137/224 (61.16%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F EFS +   V++MDF   +E   RI+  GC  G  +VS +NL ++ + A +  EH+ PI+++ L  ++  +  ++ G  +        HL V +A+E SVVY+D ++H G  LKNQ  L  S  YDCV+ S + DIDMDG+ E+L+GT+   +L+YKW+ +   + GS++L  KQ     + A+ ++D+  DG+KELLVLT+ GLHI Q  L  V++I  +R+
Sbjct:  182 FPEFSSLNSLVMWMDFFATSE--YRITALGCKDGFVIVSSVNLPETTLQASWKIEHDGPISTVRLFQDST-LESMQNGFFSKTRKDDKIHLCVGNAIEVSVVYRDILKH-GLELKNQELLPESSMYDCVVCSLIADIDMDGKNEVLLGTYGQELLVYKWEVAS-GNKGSYKLYHKQMFPHPLLALSYMDIIGDGVKELLVLTTNGLHILQHDLAQVRDICVERM 400          
BLAST of Kaptin (actin binding protein) vs. TrEMBL
Match: A0A4Y2PZT9 (KICSTOR complex protein kaptin OS=Araneus ventricosus OX=182803 GN=Kptn_2 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 4.610e-38
Identity = 87/224 (38.84%), Postives = 137/224 (61.16%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F EFS +   V++MDF   +E   RI+  GC  G  +VS +NL ++ + A +  EH+ PI+++ L  ++  +  ++ G  +        HL V +A+E SVVY+D ++H G  LKNQ  L  S  YDCV+ S + DIDMDG+ E+L+GT+   +L+YKW+ +   + GS++L  KQ     + A+ ++D+  DG+KELLVLT+ GLHI Q  L  V++I  +R+
Sbjct:  208 FPEFSSLNSLVMWMDFFATSE--YRITALGCKDGFVIVSSVNLPETTLQASWKIEHDGPISTVRLFQDST-LESMQNGFFSKTRKDDKIHLCVGNAIEVSVVYRDILKH-GLELKNQELLPESSMYDCVVCSLIADIDMDGKNEVLLGTYGQELLVYKWEVAS-GNKGSYKLYHKQMFPHPLLALSYMDIIGDGVKELLVLTTNGLHILQHDLAQVRDICVERM 426          
BLAST of Kaptin (actin binding protein) vs. TrEMBL
Match: A0A4E0RGD5 (Kaptin OS=Fasciola hepatica OX=6192 GN=D915_008523 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.317e-35
Identity = 147/530 (27.74%), Postives = 247/530 (46.60%), Query Frame = 1
Query:   25 SELFFISSLYQSNIYNSTFFSSD--NEDDNGVKGFCNCLLIFYLKPAIPNESIIKQHCDLIYVGSNNDSIHSSQKPLEFPELSVTAEVVSIDSYIDIESDTVSIILCFLKKESKPKSMIHIYDAHLKSESPAEMMEKFKPNLVFKKEIGFNPLHVTHTKYWNTSNEKLGFAYVVS----ISDEYLSHSQKD--KLSPFLLAFIKQTGHQEQGDTDFQFLLSRTGFS-DNDPLDFFKDKKSVRRSAFIEKNTRKRADLDDSENRFDEMTSIPKKYIECVN--INQNFLEFSLVKQ-KVLFMDFKINTENYQ-RISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGV--------PNAPSAR---TDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDS-------GSFRLMAKQKCAGAVHAIM-HVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            SE+F+ +S  QSNIYN T+  S+    D   V    + ++ +Y +PA  + S  KQ+C L    S+ D I +  K ++F  +   +++V ID+  D  +      + F+K   K    ++IY            ++K     +    + + PL +THT Y + +  KL +A+++S     +D  LS S     +L P +  F +               LS TG     D     KD  SV         +R R  L+ SE       SI   Y E      +  F E + +   K+L MDF + +++   R++ FG   G   V   ++++  +L  FS  H SPIT++ L +  QF P  ++          P   S++     + L+VCS+ E +VVY   + H   SL NQ  L  S  +D V  ++V D + DG  EI++GTF   +L Y+W ++  +D        G +RL+A++   G VH I   +D+  DG+  ++VL+ RGLH++Q  +  +  ++ +R+
Sbjct:    7 SEVFYFASQAQSNIYNLTYVKSEIKETDAQSVPSHYDIMVAYY-RPA-SDSSTNKQYCLLHRFSSDGDMIKTVTKNMDFVYIPGASDIVCIDALFDEVNKEYIFGVGFVKDGDK--GYLNIYGE--------SSLDKLPECCLSFSSLSYVPLQLTHTYYISPTTSKLQWAFILSSGNPFADPLLSGSAPSATRLRPPVRVFAQ---------------LSDTGKGVQEDECKKSKDTLSV--------GSRPRQRLNPSE-------SINTIYGELGTEAAHSLFPELATIPGVKILHMDFHVTSKHRPFRLAAFGAQDGWIGVVQTDMEQLTVLHQFSFSHESPITNVKLFN--QF-PSAQVSSHSGARLKSPVCSSSKFWDAQFDLLVCSSFEPAVVYSRILEHEYLSLDNQIVLPLSADFDHVNCASVGDFNFDGLPEIVLGTFGQRLLFYQWDSNKPVDEDACLTLDGGYRLVAQKSLIGPVHCISPPLDLVGDGLDAMVVLSGRGLHVYQHDVDDILELIRKRI 491          
BLAST of Kaptin (actin binding protein) vs. TrEMBL
Match: A0A564YXT5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10575 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 7.999e-32
Identity = 147/529 (27.79%), Postives = 238/529 (44.99%), Query Frame = 1
Query:   22 YSELFFISSLYQSNIYNSTFFSSDNEDDNGVKGFC--NCLLIFYLKPAIPNESIIKQHCDLIYVGSNNDSIHSSQKPLEFPELSVTAEVVSIDSYIDIESDTVSIILCFLKKESKPKSMIHIYDAHLKSESPAEMMEKFKPNLVFKKEIGFNPLHVTHTKYWNTSNEKLGFAYVVSISDEYLSHSQKDKLSP------FLLAFIKQTGHQEQGDTDFQFLLSRTGFSDNDPLDFFKDKKSVRRSAFIEKNTRKRAD--------LDDSE---NRFDEMTSIPKKYIECVNINQNFLEFSLVKQKVLFMDFKI--NTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYK---DFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKW-QTSGLMDSGSFRLMAKQKCAGAVHAIM---HVDVTRDGIKELLVLTSRGLHIFQLH--LPYVQNILEQRL 1518
            Y E+ F  ++ Q  I+N T   S    ++G +  C  + +L+  L P+  N S   + C+L    +  +S+ +S K  +F  L V A++V I+S+ D  S    + +  +K+E       +IY     S  P    EKF    +   E+   P+ V HT + + + +K+ +A ++S S +  S    ++  P           +     QE+         +  G S    L F+  +  +  S    ++ R  AD        L DS    N F E+ ++P +                    V +MDF +  + E   R+S FG   G   V ++++KKSE+ AF+S+ H+S IT L      QF         N+PS   D  L+VCS +E + VY+   D       S+ ++  L  S  +D V  + V D+D DG+ EI+IGTF   +L YKW    G    GS+ L+ +++  GAVH++      D   DG + L VLT+ GLHIF     L +   +L+ RL
Sbjct:   16 YKEVAFFPTIGQGTIHNLTHLPSQTSIEHGDEPNCRKHDILVASLLPSFENSS-SSRCCNLYSFSTVQNSLVTSTKSFDFNYLPV-ADIVCINSFYDEFSRNYVVAMGLVKEEG--SCYFNIYSGRSLSSLP----EKF----ICLSELDHFPVQVVHTYFISPNTQKMQWACLLSTSGQLTSALDLNQNCPSWKPVQVYTRLLDAIPPQEK---------ATEGISRRQGLKFYASETPLTSSGDESQSCRGAADPSAKSIFGLIDSTTTCNLFPELRNLPSRV-------------------VTYMDFFLLDDGEMKYRLSAFGTLDGWIGVGLVDMKKSELRAFYSASHDSIITKLKFFR--QFNQN-----SNSPS---DISLLVCSGLEPAAVYRCPFDGNGEGKLSIGSRIILPQSVDFDQVNCACVADLDFDGQPEIVIGTFGQQLLFYKWISQPGSDKEGSYLLVHQRRMVGAVHSLECGDDCDFLGDGTQSLAVLTTSGLHIFHCSHLLDFCLPLLDARL 494          
BLAST of Kaptin (actin binding protein) vs. Ensembl Cavefish
Match: kptn (kaptin, actin binding protein [Source:NCBI gene;Acc:103021475])

HSP 1 Score: 130.954 bits (328), Expect = 7.758e-33
Identity = 77/230 (33.48%), Postives = 135/230 (58.70%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSAR------TDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            F E S +   VL+MD  ++ +N +R++ FGC  G   ++++N +  EI++ +  + +SPI+++ L         L++   N+  A       T+Y+L+V S +E +VVY++ V  +G S     CL  SDQ D VL + ++D+D DG+ E+L+GT+   +L YK+Q       G F+LM ++     + +++++D+T DG+KEL +LT +GLHI Q  L    +++ QRL
Sbjct:  187 FPELSELPSNVLWMDV-LSIDNCRRLTTFGCQNGCVGLALVNQRGPEIVSSWRLQQDSPISTVLLF-------PLKLPAHNSSKAGLQADEVTEYNLLVTSTIEMAVVYRN-VEQNGMS--KPVCLTDSDQCDAVLCALLIDLDFDGQQEVLLGTYGQDLLCYKFQQPNGTTEGQFQLMWRRSFKSPLLSVIYLDLTGDGLKELAILTIKGLHILQHSLTSTADLVLQRL 405          
BLAST of Kaptin (actin binding protein) vs. Ensembl Cavefish
Match: kptn (kaptin, actin binding protein [Source:NCBI gene;Acc:103021475])

HSP 1 Score: 81.6481 bits (200), Expect = 3.142e-16
Identity = 51/156 (32.69%), Postives = 91/156 (58.33%), Query Frame = 1
Query:  847 FLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSAR------TDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTF 1296
            F E S +   VL+MD  ++ +N +R++ FGC  G   ++++N +  EI++ +  + +SPI+++ L         L++   N+  A       T+Y+L+V S +E +VVY++ V  +G S     CL  SDQ D VL + ++D+D DG+ E+L+GT+
Sbjct:  187 FPELSELPSNVLWMDV-LSIDNCRRLTTFGCQNGCVGLALVNQRGPEIVSSWRLQQDSPISTVLLF-------PLKLPAHNSSKAGLQADEVTEYNLLVTSTIEMAVVYRN-VEQNGMS--KPVCLTDSDQCDAVLCALLIDLDFDGQQEVLLGTY 331          
BLAST of Kaptin (actin binding protein) vs. Ensembl Nematostella
Match: EDO32276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVJ3])

HSP 1 Score: 114.775 bits (286), Expect = 1.245e-27
Identity = 76/271 (28.04%), Postives = 139/271 (51.29%), Query Frame = 1
Query:  700 FKDKKSVRRSAFIEKNTRKRADL---DDSENRFDEMTSIPKKYIECVNINQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKS-EILAFFSSEHNSPITSLHLIS------NTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSG--SFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQ 1476
             K K+SVR + F+   +     +   D++   F+E  +              F EF  ++  V++MD K    + QR++  GC  G   V++++  +  +IL  F  +H+ PIT++++        NT   P + +  P+      +YHL+VC A E  V+Y + +      L     L  SD++DCVL + + D+D DG  E+L+GT+   +L+YK+ ++    S      LM ++  +  ++AI ++D+T DG++E++V +  G+HI Q
Sbjct:  154 IKSKRSVRETVFLLAGSDCTVHMFMEDNTHQSFEEYQT-----------EDIFPEFQDLQSNVIWMDIKCLPLD-QRLTAIGCQSGHVQVALVDTAEDPKILQLFHVDHDGPITAVNVFPWQHDDLNTS-SPDMSVDKPSP-----EYHLLVCCATEPCVIYTNIISQG---LSQIVVLPDSDKFDCVLCTCMADVDWDGNKELLLGTYGQELLVYKFGSTSTGQSTILDLELMWRRSFSSPLYAIQYLDMTGDGLREVVVASLLGVHILQ 403          
BLAST of Kaptin (actin binding protein) vs. Ensembl Medaka
Match: kptn (kaptin, actin binding protein [Source:NCBI gene;Acc:101165087])

HSP 1 Score: 119.398 bits (298), Expect = 9.831e-29
Identity = 74/228 (32.46%), Postives = 127/228 (55.70%), Query Frame = 1
Query:  835 INQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRL 1518
            + + F E   +   VL++D  ++    +R+S FGC  G   ++++N    E+L  +  + +SPI+++ L   +   PK              Y+L++ S +E +VVY+D ++  G S    +CL  SDQ+D VL + V+D+D DG+ E+L+GT+   +L YK+Q++G      F+L  ++     + +I ++D+T DG+KEL VLT +GLHI Q  L     +L  RL
Sbjct:  190 VEKLFPELQELPSNVLWLDM-LSIAGGRRLSAFGCQNGCVGLALVNQAAPELLQTWRVQFDSPISTVLLFPLSS-NPKSSRHNTEEREDTEGYNLLITSTIEMAVVYRD-IQERGLSCS--TCLSESDQWDAVLCALVIDLDFDGQKEVLLGTYGQELLCYKFQSTGSRHE-QFQLQWRRSFKSPLLSITYLDLTGDGLKELAVLTLKGLHILQHSLTSTAELLLVRL 411          
BLAST of Kaptin (actin binding protein) vs. Planmine SMEST
Match: SMESG000076606.1 (SMESG000076606.1)

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 482/504 (95.63%), Postives = 482/504 (95.63%), Query Frame = 1
Query:   16 MKYSELFFISSLYQSNIYNSTFFSSDNEDDNGVKGFCNCLLIFYLKPAIPNESIIKQHCDLIYVGSNNDSIHSSQKPLEFPELSVTAEVVSIDSYIDIESDTVSIILCFLKKESKPKSMIHIYDAHLKSESPAEMMEKFKPNLVFKKEIGFNPLHVTHTKYWNTSNEKLGFAYVVSISDEYLSHSQKDKLSPFLLAFIKQTGHQEQGDTDFQFLLSRTGFSDNDPLDFFKDKKSVRRSAFIEKNTRKRADLDDSENRFDEMTSIPKKYIECVNINQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRLMLM 1527
            MKYSELFFISSLYQSNIYNSTFFSSDNEDDNGVKGFCNCLLIFYLKPAIPNESIIKQHCDLIYVGSNNDSIHSSQKPLEFPELSVT EVVSIDSYIDIESDTVSIILCFLKKESKPKSMIHIYDAHLKSESPAEMMEKFKPNLVFKKEIGFNPLHVTHTKYWNTSNEKLGFAYVVSISDEYLSHSQKDKLSPFLLAFIKQTGHQEQ                    DFFKDKKSVRRSAFIEKNTRKRADLDDSENRFDEMTSIPKKYIECVNINQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISN QFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRLMLM
Sbjct:    1 MKYSELFFISSLYQSNIYNSTFFSSDNEDDNGVKGFCNCLLIFYLKPAIPNESIIKQHCDLIYVGSNNDSIHSSQKPLEFPELSVTTEVVSIDSYIDIESDTVSIILCFLKKESKPKSMIHIYDAHLKSESPAEMMEKFKPNLVFKKEIGFNPLHVTHTKYWNTSNEKLGFAYVVSISDEYLSHSQKDKLSPFLLAFIKQTGHQEQ--------------------DFFKDKKSVRRSAFIEKNTRKRADLDDSENRFDEMTSIPKKYIECVNINQNFLEFSLVKQKVLFMDFKINTENYQRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNAQFMPKLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFSDQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLMAKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQRLMLM 484          
The following BLAST results are available for this feature:
BLAST of Kaptin (actin binding protein) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KPTN5.449e-2530.60kaptin, actin binding protein [Source:HGNC Symbol;... [more]
KPTN9.600e-928.67kaptin, actin binding protein [Source:HGNC Symbol;... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kptn8.453e-3132.46kaptin (actin binding protein) [Source:ZFIN;Acc:ZD... [more]
kptn1.233e-3032.46kaptin (actin binding protein) [Source:ZFIN;Acc:ZD... [more]
kptn1.404e-2931.49kaptin (actin binding protein) [Source:ZFIN;Acc:ZD... [more]
kptn2.766e-2237.41kaptin (actin binding protein) [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
KPTN6.775e-2631.25kaptin, actin binding protein [Source:HGNC Symbol;... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Kptn1.151e-2833.91kaptin [Source:MGI Symbol;Acc:MGI:1890380][more]
back to top
BLAST of Kaptin (actin binding protein) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8VCX6|KPTN_MOUSE1.427e-2834.35KICSTOR complex protein kaptin OS=Mus musculus OX=... [more]
sp|Q9Y664|KPTN_HUMAN2.617e-2430.60KICSTOR complex protein kaptin OS=Homo sapiens OX=... [more]
sp|A0A1D5PJB7|KPTN_CHICK8.226e-1825.94KICSTOR complex protein kaptin OS=Gallus gallus OX... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2SKJ33.771e-3938.84KICSTOR complex protein kaptin OS=Araneus ventrico... [more]
A0A4Y2Q5723.465e-3838.84KICSTOR complex protein kaptin OS=Araneus ventrico... [more]
A0A4Y2PZT94.610e-3838.84KICSTOR complex protein kaptin OS=Araneus ventrico... [more]
A0A4E0RGD51.317e-3527.74Kaptin OS=Fasciola hepatica OX=6192 GN=D915_008523... [more]
A0A564YXT57.999e-3227.79Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kptn7.758e-3333.48kaptin, actin binding protein [Source:NCBI gene;Ac... [more]
kptn3.142e-1632.69kaptin, actin binding protein [Source:NCBI gene;Ac... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO322761.245e-2728.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kptn9.831e-2932.46kaptin, actin binding protein [Source:NCBI gene;Ac... [more]
back to top
BLAST of Kaptin (actin binding protein) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000076606.10.000e+095.63SMESG000076606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000653 ID=SMED30000653|Name=Kaptin (actin binding protein)|organism=Schmidtea mediterranea sexual|type=transcript|length=1547bp
AATTAATTTACGAATATGAAATATTCTGAATTATTTTTTATATCTTCCTT
GTATCAAAGTAATATATACAATTCTACGTTTTTCTCAAGTGATAATGAAG
ATGATAACGGTGTTAAAGGCTTTTGTAATTGTTTGTTAATATTTTATCTG
AAACCAGCTATACCAAATGAATCTATAATCAAACAGCACTGTGATTTGAT
ATATGTAGGATCTAATAATGATTCAATCCATTCTAGTCAAAAACCTTTGG
AATTTCCAGAACTATCGGTTACTGCAGAGGTAGTTTCGATTGATTCGTAT
ATCGATATTGAATCAGATACTGTTTCTATTATATTATGTTTTTTAAAGAA
AGAAAGCAAACCAAAATCTATGATTCATATATACGATGCTCATTTAAAAT
CAGAAAGCCCTGCTGAAATGATGGAAAAATTTAAGCCGAATCTGGTATTC
AAAAAAGAAATCGGATTCAATCCTCTTCATGTTACCCACACAAAATATTG
GAACACATCGAATGAGAAACTTGGATTTGCTTATGTAGTATCAATAAGCG
ATGAATATTTATCTCATTCTCAAAAAGATAAATTAAGTCCGTTTCTGTTG
GCATTTATTAAGCAAACTGGTCATCAGGAACAAGGTGACACTGATTTTCA
GTTTTTATTGTCTCGAACCGGATTTTCTGACAATGACCCTTTAGATTTTT
TCAAGGATAAGAAAAGTGTCCGTCGATCAGCATTCATAGAAAAAAATACA
AGAAAACGAGCAGATTTGGATGACAGTGAAAATCGCTTCGATGAAATGAC
ATCTATTCCAAAGAAATATATTGAATGTGTTAATATAAATCAAAATTTCC
TTGAATTCAGTCTGGTTAAACAAAAGGTATTGTTTATGGATTTCAAAATT
AACACCGAAAACTATCAGCGAATCAGCTGTTTCGGTTGTGACTGTGGGAA
ATTTTTGGTTTCGATATTGAACCTTAAAAAATCAGAAATTTTGGCATTCT
TTAGTTCAGAACATAATTCCCCGATCACAAGTTTACATTTAATCAGTAAT
ACCCAATTCATGCCAAAATTAGAAATTGGTGTACCTAACGCGCCTTCGGC
AAGAACGGATTACCATCTCGTCGTGTGTAGCGCAGTTGAGCAATCGGTCG
TTTACAAAGATTTCGTTAGACATTCTGGATTTTCATTGAAAAATCAATCT
TGTCTAAAGTTTAGTGATCAATATGATTGTGTACTTTCATCTGCCGTGGT
TGATATTGACATGGATGGAGAATTAGAAATATTAATTGGTACATTTCAAC
ACTATGTGTTGATGTATAAATGGCAGACTTCTGGATTAATGGATAGTGGT
TCTTTTCGGTTAATGGCTAAGCAAAAGTGCGCAGGTGCTGTTCATGCCAT
TATGCATGTCGATGTTACTCGGGATGGAATAAAGGAATTACTTGTTCTTA
CTAGTCGAGGGCTTCATATCTTCCAGCTTCATTTGCCATATGTGCAAAAT
ATTTTAGAGCAACGATTAATGTTGATGTGATACATTTTATGTAAATA
back to top

protein sequence of SMED30000653-orf-1

>SMED30000653-orf-1 ID=SMED30000653-orf-1|Name=SMED30000653-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=505bp
MKYSELFFISSLYQSNIYNSTFFSSDNEDDNGVKGFCNCLLIFYLKPAIP
NESIIKQHCDLIYVGSNNDSIHSSQKPLEFPELSVTAEVVSIDSYIDIES
DTVSIILCFLKKESKPKSMIHIYDAHLKSESPAEMMEKFKPNLVFKKEIG
FNPLHVTHTKYWNTSNEKLGFAYVVSISDEYLSHSQKDKLSPFLLAFIKQ
TGHQEQGDTDFQFLLSRTGFSDNDPLDFFKDKKSVRRSAFIEKNTRKRAD
LDDSENRFDEMTSIPKKYIECVNINQNFLEFSLVKQKVLFMDFKINTENY
QRISCFGCDCGKFLVSILNLKKSEILAFFSSEHNSPITSLHLISNTQFMP
KLEIGVPNAPSARTDYHLVVCSAVEQSVVYKDFVRHSGFSLKNQSCLKFS
DQYDCVLSSAVVDIDMDGELEILIGTFQHYVLMYKWQTSGLMDSGSFRLM
AKQKCAGAVHAIMHVDVTRDGIKELLVLTSRGLHIFQLHLPYVQNILEQR
LMLM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029982Kptn
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
Vocabulary: cellular component
TermDefinition
GO:0015629actin cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029982KaptinPANTHERPTHR15435FAMILY NOT NAMEDcoord: 271..503
NoneNo IPR availableSUPERFAMILYSSF69318Integrin alpha N-terminal domaincoord: 406..480