Rho gtpase activating protein, putative

Overview
NameRho gtpase activating protein, putative
Smed IDSMED30000646
Length (bp)2538
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho gtpase activating protein, putative (SMED30000646) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho gtpase activating protein, putative (SMED30000646) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho gtpase activating protein, putative (SMED30000646) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho gtpase activating protein, putative (SMED30000646) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000646

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30000646SMESG000074995.1 dd_Smed_v4_3975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000646SMESG000074995.1 dd_Smed_v4_3975_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho gtpase activating protein, putative vs. Ensembl Human
Match: ARHGAP15 (Rho GTPase activating protein 15 [Source:HGNC Symbol;Acc:HGNC:21030])

HSP 1 Score: 186.037 bits (471), Expect = 2.353e-50
Identity = 133/425 (31.29%), Postives = 221/425 (52.00%), Query Frame = 1
Query: 1024 RHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWKQEDMYSEKAS----TVVVTSDKKLLDAACID--------------------DSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +HI K+ I  P   +LM  E+ G+++KAK+++ GK++ K W    +VL+   + FYK+ K     S M  G     + +         +K S+ NV Q+  T   G+   +LL+  S  D  I  W  A++ A D   +D      +     +  +S  +LL     D                      + DK  +K  LK+F+ RRPS ++L+ +G++K + +FGS L  +C++E + VP FV +C+ A+E RGL   GIYRVSGN A IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +       K    +  +   K L+ K+ P + +T K LFGHL K+  ++SKN M   ++ +V+GP L  +  +    MA+ ++  NQI + +++ YS++F
Sbjct:   65 QHILKDVI--PPLEQLM-VEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKESKQQ-ALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQI--TTVSGNE--FLLQ--SDIDFIILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIK-DQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAI-------KKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGN-MAIHMVYQNQIAELMLSEYSKIF 470          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Human
Match: ARHGAP12 (Rho GTPase activating protein 12 [Source:HGNC Symbol;Acc:HGNC:16348])

HSP 1 Score: 162.925 bits (411), Expect = 1.038e-40
Identity = 151/534 (28.28%), Postives = 233/534 (43.63%), Query Frame = 1
Query:  670 NEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELK--LKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWK----QEDMYSEKASTVVVTSD---------KKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN-KYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +E G  ++ +  T ++W   +DD GRQY+Y     +S W LP                                         +AS  +   I  S   D+ L+ P           I   K  H +  L       E+ G +   K++ENGK+V K W+    VL G  L F K   ++    G  Q K E    LK   ++   K DK SK NV +++         T LL   S  D  I  W   L    + +     E +  E   +  +            KKL         S +++  K  LK+FL RRP+ +++  +G +K + VFGS+L  LC +E   VP+FV  C+  +E  GL   GIYRVSGN A IQKLR AV+ + K  LN S++ ++  +TGA K+FF+EL +PL      +  ++ +      +        V+  K LI ++   + +T + LF HL++V     KN M   +I++V+GP L     +    +AV  +  NQIV+ ++   S +F
Sbjct:  348 DERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELP---------------------------------------KYNASSQQQREIIKSRSLDRRLQEP-----------IVLTKWRHSTIVLDTNDKDQEKYGLLNVTKIAENGKKVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASK-DKSSKKNVFELKTRQG-----TELL-IQSDNDTVINDWFKVLSSTINNQAVETDEGIEEEIPDSPGIEKHDKEKEQKDPKKLRSFKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIK-DQVFGSNLANLCQRENGTVPKFVKLCIEHVEEHGLDIDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQR--------VAAVKDLIRQLPKPNQDTMQILFRHLRRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGN-IAVHTVYQNQIVELILLELSSIF 814          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Human
Match: ARHGAP27 (Rho GTPase activating protein 27 [Source:HGNC Symbol;Acc:HGNC:31813])

HSP 1 Score: 154.836 bits (390), Expect = 3.090e-39
Identity = 113/404 (27.97%), Postives = 205/404 (50.74%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKK-WIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKS------ELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVV--------------TSDKKLLDAACIDDSSG---DKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN-KYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +++G + + K ++ GK + KK W     VL G  L F+KD K +    G+ Q          ++L+   L +  K DK S+ NV+++      GS   YL++  S   +  W  A+         ++  E++ +  V                D +   AA      G   D   ++  L++FL+RRP+ +SL  +G +K + VFG +L  LC++E+++VP FV +C+ A+EARGL   G+YR+SGN A IQKLR  VD + +  L +  + ++  +TGA KLFF+EL +PL       + I  +  +   +++          + L+  +   +++T + LF HL +V     +N M + ++++V+GP L     +  T M + ++  NQ+V+ ++ + +++F
Sbjct:  130 DKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSA-AGGLRQPSKFSTPEYTVELRGATLSWAPK-DKSSRKNVLELRSRD--GSE--YLIQHDSEAIISTWHKAIAQGIQELSAELPPEESESSRVDFGSSERLGSWQEKEEDARPNAAAPALGPVGLESDLSKVRHKLRKFLQRRPTLQSLREKGYIK-DQVFGCALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRS-------RCVRDLVRSLPAPNHDTLRMLFQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVE-ETSMPMTMVFQNQVVELILQQCADIF 518          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Human
Match: ARHGAP27 (Rho GTPase activating protein 27 [Source:HGNC Symbol;Acc:HGNC:31813])

HSP 1 Score: 154.836 bits (390), Expect = 3.090e-39
Identity = 113/404 (27.97%), Postives = 205/404 (50.74%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKK-WIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKS------ELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVV--------------TSDKKLLDAACIDDSSG---DKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN-KYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +++G + + K ++ GK + KK W     VL G  L F+KD K +    G+ Q          ++L+   L +  K DK S+ NV+++      GS   YL++  S   +  W  A+         ++  E++ +  V                D +   AA      G   D   ++  L++FL+RRP+ +SL  +G +K + VFG +L  LC++E+++VP FV +C+ A+EARGL   G+YR+SGN A IQKLR  VD + +  L +  + ++  +TGA KLFF+EL +PL       + I  +  +   +++          + L+  +   +++T + LF HL +V     +N M + ++++V+GP L     +  T M + ++  NQ+V+ ++ + +++F
Sbjct:  130 DKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSA-AGGLRQPSKFSTPEYTVELRGATLSWAPK-DKSSRKNVLELRSRD--GSE--YLIQHDSEAIISTWHKAIAQGIQELSAELPPEESESSRVDFGSSERLGSWQEKEEDARPNAAAPALGPVGLESDLSKVRHKLRKFLQRRPTLQSLREKGYIK-DQVFGCALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRS-------RCVRDLVRSLPAPNHDTLRMLFQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVE-ETSMPMTMVFQNQVVELILQQCADIF 518          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Human
Match: ARHGAP27 (Rho GTPase activating protein 27 [Source:HGNC Symbol;Acc:HGNC:31813])

HSP 1 Score: 154.836 bits (390), Expect = 3.090e-39
Identity = 113/404 (27.97%), Postives = 205/404 (50.74%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKK-WIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKS------ELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVV--------------TSDKKLLDAACIDDSSG---DKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN-KYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +++G + + K ++ GK + KK W     VL G  L F+KD K +    G+ Q          ++L+   L +  K DK S+ NV+++      GS   YL++  S   +  W  A+         ++  E++ +  V                D +   AA      G   D   ++  L++FL+RRP+ +SL  +G +K + VFG +L  LC++E+++VP FV +C+ A+EARGL   G+YR+SGN A IQKLR  VD + +  L +  + ++  +TGA KLFF+EL +PL       + I  +  +   +++          + L+  +   +++T + LF HL +V     +N M + ++++V+GP L     +  T M + ++  NQ+V+ ++ + +++F
Sbjct:  130 DKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSA-AGGLRQPSKFSTPEYTVELRGATLSWAPK-DKSSRKNVLELRSRD--GSE--YLIQHDSEAIISTWHKAIAQGIQELSAELPPEESESSRVDFGSSERLGSWQEKEEDARPNAAAPALGPVGLESDLSKVRHKLRKFLQRRPTLQSLREKGYIK-DQVFGCALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRS-------RCVRDLVRSLPAPNHDTLRMLFQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVE-ETSMPMTMVFQNQVVELILQQCADIF 518          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 150.599 bits (379), Expect = 3.164e-37
Identity = 120/397 (30.23%), Postives = 187/397 (47.10%), Query Frame = 1
Query: 1072 MRTERSGFVEKAKVSENGKEVLK----KWIKFHMVLTGPELFFYKDPKAAIPKSG----MPQGKSELK-LKIQNLQFTEKLDKDSKANVVQMEDTGAP-----GSNIT-----------YLLKFPSPEDMKIWLI-----------------ALQYA------KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLY 2118
            +RT R G +E+++  E  ++V+K    +WI  +M LT   L  YKD K+A  K G     PQG  +L+   +   Q    + K  +   +Q+E          G N T            + K PSP      +I                  L +A         +++D  S+ A   V TS          D+    K+ I   L++F + RP+ ESL+ +GI KPE VFGS+L  +C  E + VP+F+      IE++GL   GIYRVSGN + +QK+R   D++ Y+      ++  LTGA KLFF+EL  PL    L  +    +  +  +    +K       ++L+S++   + ET K L  HL +VA  SS+N M   N+++V+GP L+
Sbjct:  386 VRTIRCGDLERSENDEPAEKVVKPKKREWITNYMYLTTAHLILYKDQKSA-EKHGKHYDAPQGVWDLRGASVTWYQDNRDVQKKKQRKYIQLELCNTKKYLLRGPNDTEAVEWYKSLEEVVAKLPSPGSSNQPMIDVTNGVARNPSYIGSTRPLSHALIPISRSMRRRDDPMSQSAIETVSTS-------VSTDEPRPSKETIIEKLRRFFRTRPTVESLKEKGIYKPEPVFGSTLSAICQHENSLVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAM--QMPNATTRFKKF-----EELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 767          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 150.599 bits (379), Expect = 3.328e-37
Identity = 120/397 (30.23%), Postives = 187/397 (47.10%), Query Frame = 1
Query: 1072 MRTERSGFVEKAKVSENGKEVLK----KWIKFHMVLTGPELFFYKDPKAAIPKSG----MPQGKSELK-LKIQNLQFTEKLDKDSKANVVQMEDTGAP-----GSNIT-----------YLLKFPSPEDMKIWLI-----------------ALQYA------KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLY 2118
            +RT R G +E+++  E  ++V+K    +WI  +M LT   L  YKD K+A  K G     PQG  +L+   +   Q    + K  +   +Q+E          G N T            + K PSP      +I                  L +A         +++D  S+ A   V TS          D+    K+ I   L++F + RP+ ESL+ +GI KPE VFGS+L  +C  E + VP+F+      IE++GL   GIYRVSGN + +QK+R   D++ Y+      ++  LTGA KLFF+EL  PL    L  +    +  +  +    +K       ++L+S++   + ET K L  HL +VA  SS+N M   N+++V+GP L+
Sbjct:  388 VRTIRCGDLERSENDEPAEKVVKPKKREWITNYMYLTTAHLILYKDQKSA-EKHGKHYDAPQGVWDLRGASVTWYQDNRDVQKKKQRKYIQLELCNTKKYLLRGPNDTEAVEWYKSLEEVVAKLPSPGSSNQPMIDVTNGVARNPSYIGSTRPLSHALIPISRSMRRRDDPMSQSAIETVSTS-------VSTDEPRPSKETIIEKLRRFFRTRPTVESLKEKGIYKPEPVFGSTLSAICQHENSLVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAM--QMPNATTRFKKF-----EELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 769          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 140.969 bits (354), Expect = 1.231e-36
Identity = 81/231 (35.06%), Postives = 127/231 (54.98%), Query Frame = 1
Query: 1426 KQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLY 2118
            +++D  S+ A   V TS          D+    K+ I   L++F + RP+ ESL+ +GI KPE VFGS+L  +C  E + VP+F+      IE++GL   GIYRVSGN + +QK+R   D++ Y+      ++  LTGA KLFF+EL  PL    L  +    +  +  +    +K       ++L+S++   + ET K L  HL +VA  SS+N M   N+++V+GP L+
Sbjct:   34 RRDDPMSQSAIETVSTS-------VSTDEPRPSKETIIEKLRRFFRTRPTVESLKEKGIYKPEPVFGSTLSAICQHENSLVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAM--QMPNATTRFKKF-----EELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 250          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Celegans
Match: chin-1 (CHImaeriN (Rac-GTPase-activating protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q965N4])

HSP 1 Score: 95.1301 bits (235), Expect = 1.838e-20
Identity = 56/192 (29.17%), Postives = 107/192 (55.73%), Query Frame = 1
Query: 1618 VFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLI 2193
            +FG  +  LC      +P  V  C+  +E+RGL   GIYRVSG+   ++KL+   D N+Y   +   ++ T+ G  KL+F+ L Q L+   +  +L  L++ ++ ++++T++       +K++ ++  ++  T  A+  HLKKVA  S+KN M + N++ ++ P L+ S        ++  M ++Q++ FLI
Sbjct:  231 MFGVDITTLCMAHGADLPPIVPLCIGEVESRGLDVEGIYRVSGSYDHMEKLKQQFDSNQYVDLATVCDIHTVCGLLKLYFRLLPQQLIPFSVHKQL--LVAYQETNQRSTHE--RERQIRKVMMELSDANIITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTLFCSG-------SIPAMPNHQLLHFLI 411          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Celegans
Match: rrc-1 (GTPase-activating protein rrc-1 [Source:UniProtKB/Swiss-Prot;Acc:Q20498])

HSP 1 Score: 88.9669 bits (219), Expect = 5.998e-18
Identity = 69/256 (26.95%), Postives = 115/256 (44.92%), Query Frame = 1
Query: 1462 VVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEF--MELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYS---SSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            V++  DK+L +    +  +  +   + +   F  RR  P             +FG  L  L  +   KVP  V +C  +IE +G+  +GIYR  G Q+ IQ+LR   D        EF   ++ +++   K +F++L  PL   +   KLI+       +K+++  +  V + +  +  M  +HY T+K L  HL ++    S   M   N+++VW PNL+    +   A T +   L  H  I DF I     LF
Sbjct:  238 VMLIDDKRLPNPLNNEQKASTRNARRYMTTMFRNRRREP-------------IFGLELTDLYMRTGKKVPVIVEKCCASIEDQGIV-TGIYRQCGIQSNIQRLRAKFDSGAEPDLHEFGQRDIYSVSSLLKQYFRQLPNPLFTYQAYPKLIEAF-----EKEDSLSE-KVESLRFSLETMPEAHYRTAKFLMEHLTRLCKSKSLTDMTSKNLAIVWSPNLFRPPPTLNGADTHLLSGLNVHTAICDFFIENSESLF 473          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0112920)

HSP 1 Score: 89.3521 bits (220), Expect = 1.006e-17
Identity = 48/176 (27.27%), Postives = 94/176 (53.41%), Query Frame = 1
Query: 1594 RGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELE--TLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNL 2115
            RG  KP A+FG+ +  +  +EK  +P  +  C+  +E RG+   G YRVSG+ + + KL+ A + + Y+      E++  ++TG  K F +EL + L  ++L  +  D  S    + ++T     ++   K+  ++  ++  +  ++  HL +V  + + N M + N++MV+GP L
Sbjct: 1193 RGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNEST----RINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTL 1364          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0112919)

HSP 1 Score: 89.3521 bits (220), Expect = 1.006e-17
Identity = 48/176 (27.27%), Postives = 94/176 (53.41%), Query Frame = 1
Query: 1594 RGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELE--TLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNL 2115
            RG  KP A+FG+ +  +  +EK  +P  +  C+  +E RG+   G YRVSG+ + + KL+ A + + Y+      E++  ++TG  K F +EL + L  ++L  +  D  S    + ++T     ++   K+  ++  ++  +  ++  HL +V  + + N M + N++MV+GP L
Sbjct: 1193 RGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNEST----RINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTL 1364          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0340054)

HSP 1 Score: 89.3521 bits (220), Expect = 1.007e-17
Identity = 48/176 (27.27%), Postives = 94/176 (53.41%), Query Frame = 1
Query: 1594 RGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELE--TLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNL 2115
            RG  KP A+FG+ +  +  +EK  +P  +  C+  +E RG+   G YRVSG+ + + KL+ A + + Y+      E++  ++TG  K F +EL + L  ++L  +  D  S    + ++T     ++   K+  ++  ++  +  ++  HL +V  + + N M + N++MV+GP L
Sbjct: 1194 RGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNEST----RINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTL 1365          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0300967)

HSP 1 Score: 89.3521 bits (220), Expect = 1.021e-17
Identity = 68/231 (29.44%), Postives = 104/231 (45.02%), Query Frame = 1
Query: 1543 ILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQ--LNSEF-MELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIV--DFLITRYSELFEG 2220
              + F+  RPS   L+  GI + E VF   L          +P  +  C   IE  G+   GIYR+SG  + IQ+LR A DE +     N E   ++  ++   K++F+EL  PL   +L    ++      +  K    D  +   K+ + K+ P HY T K L  HL KV+    +  M   N+++VW PNL  S    S  +A L     Q V  ++LI     +F+ 
Sbjct:  397 FFRSFILSRPSRRRLKQSGIYR-ERVFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGVI-DGIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVE-----AIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIFDA 620          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0340053)

HSP 1 Score: 89.3521 bits (220), Expect = 1.023e-17
Identity = 48/176 (27.27%), Postives = 94/176 (53.41%), Query Frame = 1
Query: 1594 RGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELE--TLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNL 2115
            RG  KP A+FG+ +  +  +EK  +P  +  C+  +E RG+   G YRVSG+ + + KL+ A + + Y+      E++  ++TG  K F +EL + L  ++L  +  D  S    + ++T     ++   K+  ++  ++  +  ++  HL +V  + + N M + N++MV+GP L
Sbjct: 1192 RGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNEST----RINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTL 1363          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Zebrafish
Match: arhgap27 (Rho GTPase activating protein 27 [Source:ZFIN;Acc:ZDB-GENE-030131-3922])

HSP 1 Score: 211.846 bits (538), Expect = 1.100e-56
Identity = 156/542 (28.78%), Postives = 262/542 (48.34%), Query Frame = 1
Query:  670 NEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKL----------DKDSKANVVQMED-TGAPGSNITYLLKFPSPEDMKIWL-IALQYAKDWKQEDMYSEKASTVVVTS----------DKKLLDAACIDDSS-----GDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            + +GT  F +  T+++W  ++DD GR Y+Y     +S WNLP      E +  P +  +       +    +  +  + + D        +N  DS  S  P + P                         + +   E++G + K KVSENGK+V K W     VL G +L F+KDPK+       P G S    +I   +FT  L          DK SK NV++++  TGA      YL+++ +   ++ W  + L        +  +SE+   V+  S          +K+ +  A    S+      +++ ++  LK+FL +RP+ +S++ +G ++ E VFG  L  LC QEK +VP FV +C+ A+E RGL   G+YRVSGN A IQKLR   D     L     ++  +TGA KLFF+EL++PL    L ++ I  +       K       +S  + L+  + P +++T +ALF HL++V    ++N M + N+++V+GP L     + ++ +A  ++  NQIV+FL++ +  +F
Sbjct:  480 DSEGTWTFTSEYTQEQWIKSLDDQGRTYYYLRDGSKSQWNLP------EYSASPGQYGVGNGASGEQDTVGSNWRHSAGYPDDKNHSSYIQNTSDSEASSSP-DTP-------------------------HNVSNLEKAGILNKTKVSENGKKVRKNWGHSWTVLHGGKLTFHKDPKST------PAGASSKTNQILP-EFTVDLKGATINRAPKDKSSKKNVLELKTRTGA-----EYLIQYDTDSIIQDWHKVILDTIHQLNGDQHHSEEEDEVIDKSPTLDREERPFEKRTMSTATRQPSTSSTSEAEQKKVRTKLKKFLLKRPTLQSVKDKGYIR-ENVFGCHLHNLCSQEKTRVPSFVEKCIRAVEKRGLEIDGLYRVSGNLAVIQKLRFKADHEDLDLEEGNWDIHVITGALKLFFRELQEPLFPYNLFNEFICAIKTPDYYSK-------ISHMRNLVRSLPPPNHDTMEALFSHLRRVIQHGNENRMTVQNVAIVFGPTLLKPEEETAS-IATYMVFQNQIVEFLLSEFESIF 968          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Zebrafish
Match: arhgap15 (Rho GTPase activating protein 15 [Source:ZFIN;Acc:ZDB-GENE-070912-314])

HSP 1 Score: 173.326 bits (438), Expect = 3.238e-46
Identity = 135/409 (33.01%), Postives = 206/409 (50.37%), Query Frame = 1
Query: 1093 FVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE-LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKD---WKQEDMYSEKASTVVVTSDKKLLDAACIDD------------------------SSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSSK 2229
            ++ KAK++E GK++ K W    +VL+  +L FYK+ K     +  P GK + + L    +++T   +K S+ NV+Q+  T   G    +LL+      +  W  A++ A D            +A+     S + L    C                            S DK  +K  LK+F+ RRPS ++L+ +GI+K + VFG  +  LCD+EK  VP+FV  CV  +E RGL   GIYRVSGN A IQKLR  VD E +  L +S++ ++  +TGA K+FF+EL +PL       +  DL       K+ T K   V   KKLI ++   ++ T K LF HL++V  +S KN M    +S+V+GP L     + S  M V ++  NQIV+ ++    E+F  + K
Sbjct:   72 YLNKAKIAEGGKKLRKNWTLTWVVLSSNQLLFYKESKQEAVSNLKPGGKPDGVDLNGAVIEWTT--EKSSRKNVIQI--TTPTGHE--FLLQADHFPTISKWHDAIKKAVDILSSGSGGQSCGRAALHRSNSTECLSRPTCESSKPKPKETKSEHRRSIMFKLNYSASDSADKNGVKNRLKKFISRRPSMKTLQEKGIIK-DRVFGCHMLTLCDREKTTVPKFVKLCVEEVEKRGLEADGIYRVSGNLAIIQKLRFLVDQEEELDLGDSQWEDIHVITGALKMFFRELPEPLFP----FRFFDLFVETIKIKEPTQK---VQAMKKLIHQLPKPNHNTMKLLFHHLRRVLTKSQKNLMSTQGVSIVFGPTLMWPEFE-SGNMEVNMVYQNQIVECILIGCVEIFGPADK 465          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Zebrafish
Match: arhgap15 (Rho GTPase activating protein 15 [Source:ZFIN;Acc:ZDB-GENE-070912-314])

HSP 1 Score: 173.326 bits (438), Expect = 3.238e-46
Identity = 135/409 (33.01%), Postives = 206/409 (50.37%), Query Frame = 1
Query: 1093 FVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE-LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKD---WKQEDMYSEKASTVVVTSDKKLLDAACIDD------------------------SSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSSK 2229
            ++ KAK++E GK++ K W    +VL+  +L FYK+ K     +  P GK + + L    +++T   +K S+ NV+Q+  T   G    +LL+      +  W  A++ A D            +A+     S + L    C                            S DK  +K  LK+F+ RRPS ++L+ +GI+K + VFG  +  LCD+EK  VP+FV  CV  +E RGL   GIYRVSGN A IQKLR  VD E +  L +S++ ++  +TGA K+FF+EL +PL       +  DL       K+ T K   V   KKLI ++   ++ T K LF HL++V  +S KN M    +S+V+GP L     + S  M V ++  NQIV+ ++    E+F  + K
Sbjct:   72 YLNKAKIAEGGKKLRKNWTLTWVVLSSNQLLFYKESKQEAVSNLKPGGKPDGVDLNGAVIEWTT--EKSSRKNVIQI--TTPTGHE--FLLQADHFPTISKWHDAIKKAVDILSSGSGGQSCGRAALHRSNSTECLSRPTCESSKPKPKETKSEHRRSIMFKLNYSASDSADKNGVKNRLKKFISRRPSMKTLQEKGIIK-DRVFGCHMLTLCDREKTTVPKFVKLCVEEVEKRGLEADGIYRVSGNLAIIQKLRFLVDQEEELDLGDSQWEDIHVITGALKMFFRELPEPLFP----FRFFDLFVETIKIKEPTQK---VQAMKKLIHQLPKPNHNTMKLLFHHLRRVLTKSQKNLMSTQGVSIVFGPTLMWPEFE-SGNMEVNMVYQNQIVECILIGCVEIFGPADK 465          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Zebrafish
Match: arhgap27l (Rho GTPase activating protein 27, like [Source:ZFIN;Acc:ZDB-GENE-120406-11])

HSP 1 Score: 180.259 bits (456), Expect = 3.520e-46
Identity = 128/397 (32.24%), Postives = 211/397 (53.15%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSEL------KLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIW------LIALQYAKDWKQEDMYSEKASTVVVTSDK-KLLDAACIDDSSG---DKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFE 2217
            E++G + K KV+ENGK + K W +   VL    L F+KDPK A   +GM    +++      +LK   L +  K +K SK NV++++     GS   YL+++ +   ++ W       I L +      ED   +      + +DK K  +AA +  +S    D+  ++  L++FL+RRP+ +S++ +G +K E VFG  L+ LC +E   VP+FV +C+ ++E RGL   GIYRVSGN A IQKLR   D E    L + ++ E+  +TGA KLF +EL +PL       K I  +      +K       VS  + L+  +   +++T + LF HL+KV      N M + + ++V+GP L     +++  M ++    NQIV+ ++  ++ELF+
Sbjct:  633 EKAGILNKTKVAENGKRLRKNWAQSWTVLHDGVLTFHKDPKFA--PAGMSSKTNQIVPEYTVELKGATLSWASK-EKSSKKNVLELKTRH--GSE--YLIQYDTDSIIQDWQKIILDTIKLLHEHGHNSEDEAEDVPEKSPLPADKEKKPEAARLSSTSSIDTDQGRVRTKLRKFLQRRPTLQSVKEKGYIK-ENVFGCHLDTLCHRENTTVPKFVEKCIRSVEKRGLKIDGIYRVSGNLAVIQKLRYKADHEEDLDLEDGQWEEIHVITGALKLFLRELPEPLFPFSFFDKFIAAIQISDYSQK-------VSYIRDLVRNLPLPNHDTMEVLFRHLRKVIEHGEMNRMSVQSTAIVFGPTLLRPQEESNITMHMVFQ--NQIVELVLNEFNELFQ 1012          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Zebrafish
Match: arhgap27l (Rho GTPase activating protein 27, like [Source:ZFIN;Acc:ZDB-GENE-120406-11])

HSP 1 Score: 180.259 bits (456), Expect = 3.520e-46
Identity = 128/397 (32.24%), Postives = 211/397 (53.15%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSEL------KLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIW------LIALQYAKDWKQEDMYSEKASTVVVTSDK-KLLDAACIDDSSG---DKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFE 2217
            E++G + K KV+ENGK + K W +   VL    L F+KDPK A   +GM    +++      +LK   L +  K +K SK NV++++     GS   YL+++ +   ++ W       I L +      ED   +      + +DK K  +AA +  +S    D+  ++  L++FL+RRP+ +S++ +G +K E VFG  L+ LC +E   VP+FV +C+ ++E RGL   GIYRVSGN A IQKLR   D E    L + ++ E+  +TGA KLF +EL +PL       K I  +      +K       VS  + L+  +   +++T + LF HL+KV      N M + + ++V+GP L     +++  M ++    NQIV+ ++  ++ELF+
Sbjct:  633 EKAGILNKTKVAENGKRLRKNWAQSWTVLHDGVLTFHKDPKFA--PAGMSSKTNQIVPEYTVELKGATLSWASK-EKSSKKNVLELKTRH--GSE--YLIQYDTDSIIQDWQKIILDTIKLLHEHGHNSEDEAEDVPEKSPLPADKEKKPEAARLSSTSSIDTDQGRVRTKLRKFLQRRPTLQSVKEKGYIK-ENVFGCHLDTLCHRENTTVPKFVEKCIRSVEKRGLKIDGIYRVSGNLAVIQKLRYKADHEEDLDLEDGQWEEIHVITGALKLFLRELPEPLFPFSFFDKFIAAIQISDYSQK-------VSYIRDLVRNLPLPNHDTMEVLFRHLRKVIEHGEMNRMSVQSTAIVFGPTLLRPQEESNITMHMVFQ--NQIVELVLNEFNELFQ 1012          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Xenopus
Match: tox3 (TOX high mobility group box family member 3 [Source:Xenbase;Acc:XB-GENE-5887160])

HSP 1 Score: 189.504 bits (480), Expect = 7.581e-53
Identity = 123/383 (32.11%), Postives = 204/383 (53.26%), Query Frame = 1
Query: 1078 TERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
             E++  + K K++E G+++ K W    +VLTG  L FYKDPK   P +  P+  S + L+   +  T+++   SK NV+ +       +   YLL+  S +D+ I  W  ALQ   +                      L  + +  +  DK+ ++  LK+ L RRP  ++L+ +G++K + VFG  L+ LC +E + VP+FV  C+ A+  RGL   GIYRV+GN A IQKLR  VD E K  L+ S++ ++  +TGA K+FF+EL +PL+   +  + ++ +    +D++       + T K L+S +   +++T K +  HLK+V   S  N M   NI +V+GP L     +  + +A  ++  NQ+V+  +T Y ELF
Sbjct:    3 VEKASQLNKTKIAEGGRKLKKNWSASWVVLTGNSLMFYKDPKVLKPSNSKPE--SSVDLRGATIDSTQEMS--SKKNVIHLRMV----TGNEYLLQ--SDKDLLIQEWYDALQRVIE---------------------RLVVSWVSSNPSDKKKVRTRLKKLLVRRPPLQTLQEKGLIK-DQVFGCRLDALCHRENSTVPKFVCMCIEAVNERGLEADGIYRVNGNLATIQKLRFIVDREEKLDLSTSDWEDVHVITGALKMFFRELPEPLIPFSMFEQYVEAVQIPDLDER-------IETIKDLVSTLPEPNHDTLKHMLSHLKRVMEHSETNRMTTQNIGIVFGPTLMRPEKELFSNIAANMVYQNQVVEHFLTYYEELF 346          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:Xenbase;Acc:XB-GENE-972398])

HSP 1 Score: 181.03 bits (458), Expect = 6.048e-49
Identity = 125/402 (31.09%), Postives = 207/402 (51.49%), Query Frame = 1
Query: 1084 RSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSEL--KLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWKQEDMYSEKASTVVVTSDKKL-------------------LDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            + GF+ K K++E GK++ K W+  + VL+GP+L FYKD K         Q  S+L  ++ ++        +K S+ NV Q+  T   G+       F S  D+ +  W  A++   D      + + A       ++K                    L+ +  D S  ++  +K  LK+F+ RRPS ++L+ +GI+K + VFG  LE LC +E   VP FV +C+ A+E RG+   GIYRVSGN + IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +       K     + V   + L+  + P++  T KALF HL+K+  ++S N M   ++ +V+GP L          MAV ++  NQIV+ ++T + ++F
Sbjct:   64 KEGFLNKTKIAEKGKKLRKNWVTSYTVLSGPKLEFYKDAK--------DQTASDLVKRIDLRGASVEWANEKSSRKNVFQI--TTLSGNEFL----FQSDADITVQEWFRAIRNTIDSLVCIRFLQIAPFKERKKERKKERKKERKKERKKERKKIFKLNYSASDTS--ERNRVKTRLKKFISRRPSLKTLQEKGIIK-DQVFGCHLETLCKRENETVPRFVTQCIEAVEKRGMDADGIYRVSGNLSTIQKLRFIVNQEEKLNLDDSQWDDIHVVTGALKMFFRELPEPLFPYRFFEQFVEAI-------KLQESHLRVKALRDLVWNLPPANRNTMKALFEHLRKIVAKASVNLMSTQSLGIVFGPTLLRPESDMGN-MAVCMVYQNQIVEIMLTEFDQIF 440          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:Xenbase;Acc:XB-GENE-972398])

HSP 1 Score: 167.933 bits (424), Expect = 3.425e-44
Identity = 120/381 (31.50%), Postives = 198/381 (51.97%), Query Frame = 1
Query: 1138 KKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIA-------------LQYA--KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGD---KQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            K W+  + VL+GP+L FYKD K     S     +  + L+  ++++    +K S+ NV Q+  T   G+       F S  D+ +  W  A             LQ A  K    E ++ E  +T     +++      ++ S+ D   +  +K  LK+F+ RRPS ++L+ +GI+K + VFG  LE LC +E   VP FV +C+ A+E RG+   GIYRVSGN + IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +       K     + V   + L+  + P++  T KALF HL+K+  ++S N M   ++ +V+GP L          MAV ++  NQIV+ ++T + ++F
Sbjct:   96 KNWVTSYTVLSGPKLEFYKDAKDQTRSST---KQERIDLRGASVEWAN--EKSSRKNVFQI--TTLSGNEFL----FQSDADITVQEWFRAIRNTIDSLVCIRFLQIAPFKTSNIELLHLEGENTKEHKHEQRKSLIFKLNYSASDTSERNRVKTRLKKFISRRPSLKTLQEKGIIK-DQVFGCHLETLCKRENETVPRFVTQCIEAVEKRGMDADGIYRVSGNLSTIQKLRFIVNQEEKLNLDDSQWDDIHVVTGALKMFFRELPEPLFPYRFFEQFVEAI-------KLQESHLRVKALRDLVWNLPPANRNTMKALFEHLRKIVAKASVNLMSTQSLGIVFGPTLLRPESDMGN-MAVCMVYQNQIVEIMLTEFDQIF 456          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Xenopus
Match: psmd2 (proteasome 26S subunit, non-ATPase 2 [Source:Xenbase;Acc:XB-GENE-972398])

HSP 1 Score: 161.384 bits (407), Expect = 4.956e-44
Identity = 85/235 (36.17%), Postives = 139/235 (59.15%), Query Frame = 1
Query: 1516 SGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            + ++  +K  LK+F+ RRPS ++L+ +GI+K + VFG  LE LC +E   VP FV +C+ A+E RG+   GIYRVSGN + IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +       K     + V   + L+  + P++  T KALF HL+K+  ++S N M   ++ +V+GP L          MAV ++  NQIV+ ++T + ++F
Sbjct:   29 TSERNRVKTRLKKFISRRPSLKTLQEKGIIK-DQVFGCHLETLCKRENETVPRFVTQCIEAVEKRGMDADGIYRVSGNLSTIQKLRFIVNQEEKLNLDDSQWDDIHVVTGALKMFFRELPEPLFPYRFFEQFVEAI-------KLQESHLRVKALRDLVWNLPPANRNTMKALFEHLRKIVAKASVNLMSTQSLGIVFGPTLLRPESDMGN-MAVCMVYQNQIVEIMLTEFDQIF 254          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Xenopus
Match: ARHGAP12 (Rho GTPase activating protein 12 [Source:NCBI gene;Acc:100493129])

HSP 1 Score: 161.384 bits (407), Expect = 2.083e-40
Identity = 128/382 (33.51%), Postives = 201/382 (52.62%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQ--NLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN-KYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            E+ G +   K++ENGK+V K W+    VL G  L    +  AA  K G  Q K E  + I+  ++ +  K DK SK NV++++ T    S    L++  S   +K W  A          D+   K     +     L+ A  ID++  +++  K  LK+FL RRP+ +++  +G +K + VFGSSL  LC +E   VP FV  C+  +E +GL   G+YRVSGN A IQKLR AV  + K  LN S++ ++  +TGA K+FF+EL +PL      S   D ++  K + K     + V   K LI ++   +++T +ALF HLKKV     KN M   ++++V+GP L     +    +A+  +  NQIV+ ++   + +F
Sbjct:  388 EKYGVLLVTKITENGKKVRKNWMSSWTVLKGTTLLLQAN--AAGWKFGGNQSKPEFTVDIKGASVDWASK-DKSSKKNVIELKTT----SGTELLIQSDSDTVIKDWYTAFCNTTGTTVSDLIGYKLLQPKIAF---LVPANSIDNA--EQKKTKTKLKKFLTRRPTMQAVREKGYIK-DPVFGSSLASLCQRENTTVPNFVKMCIEHVEEQGLDVDGLYRVSGNLAVIQKLRFAVTHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLF---TFSHFNDFVNAIKQEPK-----LRVQAIKDLIKQLPKPNHDTMQALFKHLKKVVETGEKNRMTYQSLAIVFGPTLLKPESETGN-IAIHTVYQNQIVELILLECNSIF 747          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Mouse
Match: Arhgap15 (Rho GTPase activating protein 15 [Source:MGI Symbol;Acc:MGI:1923367])

HSP 1 Score: 189.119 bits (479), Expect = 1.697e-51
Identity = 127/406 (31.28%), Postives = 222/406 (54.68%), Query Frame = 1
Query: 1078 TERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKA-AIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDW--KQEDMYSEKASTVVVTSDKKLLDAACID--------------------DSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
             E+ G+++KAK+++ GK++ K W    +VL+G ++ FYKD K  A+P          + L   ++++ +  +K S+ +V Q+  T   G+   +LL+  S  D  I  W  A++ A D   K     S +   +  +S  +L     ID                      + DK  +K  LK+F+ RRPS ++L+ +G++K + +FGS L  +C++E + VP FV +C+ A+E RGL   GIYRVSGN A IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +  +  ++K       + T + L+ ++ P +++T K LF HL K+  ++S+N M   ++ +V+GP L  +  + S  +AV ++  NQI +F++T Y ++F
Sbjct:   88 VEKEGYLQKAKIADGGKKLRKNWSTSWIVLSGRKIEFYKDSKQQALPNMKTRHNVESVDLCGAHIEWAK--EKSSRKSVFQI--TTVSGNE--FLLQ--SDIDFLILDWFQAIKNAIDRLPKNPSCGSLELFNLQRSSSSELPSHCHIDRKEQKPEHRKSFMFRLHHSASDTSDKNRVKSRLKKFISRRPSLKTLQEKGLIK-DQIFGSHLHTVCEREHSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELSEPLFPYSFFERFVEAIKKQDSNEK-------IETMRSLVKRLPPPNHDTMKILFRHLTKIVAKASQNLMSTQSLGIVFGPTLLRAENE-SGNVAVHMVYQNQIAEFMLTEYDKIF 476          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Mouse
Match: Arhgap12 (Rho GTPase activating protein 12 [Source:MGI Symbol;Acc:MGI:1922665])

HSP 1 Score: 166.777 bits (421), Expect = 4.506e-42
Identity = 155/538 (28.81%), Postives = 250/538 (46.47%), Query Frame = 1
Query:  670 NEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKD-ALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQN--LQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWKQEDMYSEKASTVVVTSD----------------KKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN-KYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +E G  ++ +  T+++W   +DD GRQY+Y     +S W LP     ++   + IK  +L+  ++      +         W   ++   D N KDS P+   L +PE+             K +  +G L  +    E+ G +   K++ENGK+V K W+    VL G  L F K   ++    G  Q K E  + ++   ++   K DK SK NV +++         T LL   S  D  I  W   L    +     +     +    T D                KKL         S +++  K  LK+FL RRP+ +++  +G +K + VFGS+L  LC +E   VP+FV  C+  +E  GL   GIYRVSGN A IQKLR AV+ + K  LN S++ ++  +TGA K+FF+EL +PL      +  ++ +      +        V+  K LI ++   + +T + LF HLK+V     KN M   +I++V+GP L     + +  +AV  +  NQIV+ ++   S +F
Sbjct:  345 DERGHTLYTSDYTKEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTK---------W-RHSTIVLDSNDKDS-PTTTKLCLPENESPPTSS------KHQDPAGSLKGQ----EKYGLLNVTKITENGKKVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGAVIEMASK-DKSSKKNVFELKTRQG-----TELL-IQSDNDAVINDWFKVLSSTIN---NQVAEADEAAEEETPDSPGVEKHDKEKDQKELKKLRSMKGSSMDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIK-DQVFGSNLANLCQRENGTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQR--------VTAVKDLIRQLPKPNQDTMQILFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPE-RETGNIAVHTVYQNQIVELILLELSTVF 841          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Mouse
Match: Arhgap9 (Rho GTPase activating protein 9 [Source:MGI Symbol;Acc:MGI:2143764])

HSP 1 Score: 160.999 bits (406), Expect = 6.694e-42
Identity = 121/429 (28.21%), Postives = 202/429 (47.09%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQG------KSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKD-------------------------WKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-------------------ENKYQLNS-EFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            ERSG +   K+++ G+++ K W    +VLTG  L FY++     P+S   QG      + E  + ++           S+ NV+ +     PG    +LL+     +++ W  AL+   +                          + +++ SE  S  ++    +   + C + +   K  ++  LK+ + +RP+ +SL+ RG+ + + VFG  LE LC +E + VP FV  CV A++ +GL   GIYRVSGN A +QKLR  VD                   E K  L+S E+ ++  +TGA KLFF+EL QPL+   L     D L   + ++        +S  +KLI  +   +++T K +  HL +V   S KN M   N+ +V+GP L+    +AS  MA  +    Q+V  ++  ++ LF
Sbjct:   61 ERSGLLNMTKIAQGGRKLRKNWGPAWVVLTGSSLVFYRE---RPPQSASLQGWARAGSRPESSVDLRGAALASGRQLSSRRNVLHIRTV--PGHE--FLLQSDEETELRDWHRALRTVIERLDRENPLELRLSGSGPAELAELSAGEDDELESEPVSKSLMRLGSRRTSSRCAEGTD-QKNRVRNKLKRLIAKRPTLQSLQERGLFR-DQVFGCQLESLCQREGDTVPSFVRLCVEAVDKKGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYMFPEQAGQEGKLDLDSAEWDDIHVVTGALKLFFRELPQPLVPALLLPDFRDALELSEPEQ-------CLSKIQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKNRMTAHNLGIVFGPTLFRPEQEAS-DMAAHVFYPGQLVQLMLNNFASLF 472          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Mouse
Match: Arhgap9 (Rho GTPase activating protein 9 [Source:MGI Symbol;Acc:MGI:2143764])

HSP 1 Score: 160.999 bits (406), Expect = 6.694e-42
Identity = 121/429 (28.21%), Postives = 202/429 (47.09%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQG------KSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKD-------------------------WKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-------------------ENKYQLNS-EFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            ERSG +   K+++ G+++ K W    +VLTG  L FY++     P+S   QG      + E  + ++           S+ NV+ +     PG    +LL+     +++ W  AL+   +                          + +++ SE  S  ++    +   + C + +   K  ++  LK+ + +RP+ +SL+ RG+ + + VFG  LE LC +E + VP FV  CV A++ +GL   GIYRVSGN A +QKLR  VD                   E K  L+S E+ ++  +TGA KLFF+EL QPL+   L     D L   + ++        +S  +KLI  +   +++T K +  HL +V   S KN M   N+ +V+GP L+    +AS  MA  +    Q+V  ++  ++ LF
Sbjct:   61 ERSGLLNMTKIAQGGRKLRKNWGPAWVVLTGSSLVFYRE---RPPQSASLQGWARAGSRPESSVDLRGAALASGRQLSSRRNVLHIRTV--PGHE--FLLQSDEETELRDWHRALRTVIERLDRENPLELRLSGSGPAELAELSAGEDDELESEPVSKSLMRLGSRRTSSRCAEGTD-QKNRVRNKLKRLIAKRPTLQSLQERGLFR-DQVFGCQLESLCQREGDTVPSFVRLCVEAVDKKGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYMFPEQAGQEGKLDLDSAEWDDIHVVTGALKLFFRELPQPLVPALLLPDFRDALELSEPEQ-------CLSKIQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKNRMTAHNLGIVFGPTLFRPEQEAS-DMAAHVFYPGQLVQLMLNNFASLF 472          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Mouse
Match: Arhgap12 (Rho GTPase activating protein 12 [Source:MGI Symbol;Acc:MGI:1922665])

HSP 1 Score: 164.466 bits (415), Expect = 2.189e-41
Identity = 150/537 (27.93%), Postives = 235/537 (43.76%), Query Frame = 1
Query:  670 NEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQN--LQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWKQEDMYSEKASTVVVTSD----------------KKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN-KYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +E G  ++ +  T+++W   +DD GRQY+Y     +S W LP                                         +AS  +   I  S   D+ L+ P           I   K  H +  L +     E+ G +   K++ENGK+V K W+    VL G  L F K   ++    G  Q K E  + ++   ++   K DK SK NV +++         T LL   S  D  I  W   L    +     +     +    T D                KKL         S +++  K  LK+FL RRP+ +++  +G +K + VFGS+L  LC +E   VP+FV  C+  +E  GL   GIYRVSGN A IQKLR AV+ + K  LN S++ ++  +TGA K+FF+EL +PL      +  ++ +      +        V+  K LI ++   + +T + LF HLK+V     KN M   +I++V+GP L     + +  +AV  +  NQIV+ ++   S +F
Sbjct:  345 DERGHTLYTSDYTKEKWLKHVDDQGRQYYYSADGSRSEWELP---------------------------------------KYNASSQQQREIIKSRSLDRRLQEP-----------IVLTKWRHSTIVLDSNDKGQEKYGLLNVTKITENGKKVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGAVIEMASK-DKSSKKNVFELKTRQG-----TELL-IQSDNDAVINDWFKVLSSTIN---NQVAEADEAAEEETPDSPGVEKHDKEKDQKELKKLRSMKGSSMDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIK-DQVFGSNLANLCQRENGTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQR--------VTAVKDLIRQLPKPNQDTMQILFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPE-RETGNIAVHTVYQNQIVELILLELSTVF 811          
BLAST of Rho gtpase activating protein, putative vs. UniProt/SwissProt
Match: sp|Q6AYC5|RHG15_RAT (Rho GTPase-activating protein 15 OS=Rattus norvegicus OX=10116 GN=Arhgap15 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 7.425e-55
Identity = 139/425 (32.71%), Postives = 239/425 (56.24%), Query Frame = 1
Query: 1024 RHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE-LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKD-------WKQEDMYSEKASTVVVTSDKKLLDAA----------------CIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +H+ K+ I  PL + ++  E+ G+++KAK+++ GK++ K W    +VL+G +L FYKDPK     +  P+  +E + L   ++++  K DK SK +V Q+  T A G+   +LL+  S  D  I  W  A++ A D       +   +++S + S+         +D                   + D+S DK  +K  LK+F+ RRPS ++L+ +GI+K + +FGS L  +C++E + VP FV +C+ A+E RGL   GIYRVSGN A IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +  +  D K       + T K L+  + P +++T K LFGHL K+  ++++N M   ++ +V+GP L  +  + S  +AV ++  NQ+ +F++T Y ++F
Sbjct:   73 QHVLKDVIP-PLEHPMV--EKEGYLQKAKIADGGKKLRKNWSTSWIVLSGRKLEFYKDPKQQALPNVKPRPNAESVDLCGAHIEWAAK-DKSSKKSVFQI--TTASGNE--FLLQ--SDIDFLILDWFHAIKNAIDRLPKNPSFGSLELFSFQRSSSSEQPSHCHIDRKEQKPENRKSFMFRLHHSVSDTS-DKNRVKSRLKKFISRRPSLKTLQEKGIIK-DQIFGSHLHTVCEREHSTVPWFVKQCIEAVEKRGLEVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELSEPLFPYSFFERFVEAIKKQDSDAK-------IETMKSLVKSLPPPNHDTMKILFGHLTKIVAKAAQNLMSTQSLGIVFGPTLLRAENE-SGNVAVHMVYQNQVAEFMLTEYDKIF 477          
BLAST of Rho gtpase activating protein, putative vs. UniProt/SwissProt
Match: sp|A4IF90|RHG15_BOVIN (Rho GTPase-activating protein 15 OS=Bos taurus OX=9913 GN=ARHGAP15 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.750e-51
Identity = 133/421 (31.59%), Postives = 216/421 (51.31%), Query Frame = 1
Query: 1024 RHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTG-------------------APGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKL---LDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +HI K+ I  P   +LM  E+ G+++KAK+++ GK++ K W    +VL+  ++ FYK+ K     S M  G     + +         +K S+ NV Q+                       A  + I  L K PS     + L  +Q +   +    Y            K L   L  +  D S  DK  +K  LK+F+ RRPS ++L+ +G++K + +FGS L  LC++EK+ VP FV +C+ A+E RGL   GIYRVSGN A IQKLR  V+ E K  L +S++ ++  +TGA K+FF++L +PL       + ++ +       K    +  +   K L+ K+ P + +T K LFGHL K+  ++SKN M   ++ +V+GP L  +  + S  MAV ++  NQI + +++ Y ++F
Sbjct:   65 QHILKDVI--PPLEQLM-VEKEGYLQKAKIADGGKKLRKNWTTSWIVLSSRKIEFYKESKQQ-ALSNMKTGNKPESVDLCGAHIEWAKEKSSRKNVFQITTLSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDPSSHSRNLELFKIQRSSSTELLSHYDSDTKEQKPEHRKSLMFRLHHSASDTS--DKNRVKSRLKKFITRRPSLKTLQEKGLIK-DQIFGSHLHTLCEREKSTVPRFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRDLPEPLFPYSFFEQFVEAI-------KKQDNNTRIEAIKSLVQKLPPPNRDTMKVLFGHLTKIVARASKNLMSTHSLGIVFGPTLLRAEDE-SGNMAVHMVYQNQIAELMLSAYDQIF 470          
BLAST of Rho gtpase activating protein, putative vs. UniProt/SwissProt
Match: sp|Q811M1|RHG15_MOUSE (Rho GTPase-activating protein 15 OS=Mus musculus OX=10090 GN=Arhgap15 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.187e-50
Identity = 127/406 (31.28%), Postives = 222/406 (54.68%), Query Frame = 1
Query: 1078 TERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKA-AIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDW--KQEDMYSEKASTVVVTSDKKLLDAACID--------------------DSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
             E+ G+++KAK+++ GK++ K W    +VL+G ++ FYKD K  A+P          + L   ++++ +  +K S+ +V Q+  T   G+   +LL+  S  D  I  W  A++ A D   K     S +   +  +S  +L     ID                      + DK  +K  LK+F+ RRPS ++L+ +G++K + +FGS L  +C++E + VP FV +C+ A+E RGL   GIYRVSGN A IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +  +  ++K       + T + L+ ++ P +++T K LF HL K+  ++S+N M   ++ +V+GP L  +  + S  +AV ++  NQI +F++T Y ++F
Sbjct:   88 VEKEGYLQKAKIADGGKKLRKNWSTSWIVLSGRKIEFYKDSKQQALPNMKTRHNVESVDLCGAHIEWAK--EKSSRKSVFQI--TTVSGNE--FLLQ--SDIDFLILDWFQAIKNAIDRLPKNPSCGSLELFNLQRSSSSELPSHCHIDRKEQKPEHRKSFMFRLHHSASDTSDKNRVKSRLKKFISRRPSLKTLQEKGLIK-DQIFGSHLHTVCEREHSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELSEPLFPYSFFERFVEAIKKQDSNEK-------IETMRSLVKRLPPPNHDTMKILFRHLTKIVAKASQNLMSTQSLGIVFGPTLLRAENE-SGNVAVHMVYQNQIAEFMLTEYDKIF 476          
BLAST of Rho gtpase activating protein, putative vs. UniProt/SwissProt
Match: sp|Q53QZ3|RHG15_HUMAN (Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.130e-49
Identity = 133/425 (31.29%), Postives = 221/425 (52.00%), Query Frame = 1
Query: 1024 RHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWKQEDMYSEKAS----TVVVTSDKKLLDAACID--------------------DSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +HI K+ I  P   +LM  E+ G+++KAK+++ GK++ K W    +VL+   + FYK+ K     S M  G     + +         +K S+ NV Q+  T   G+   +LL+  S  D  I  W  A++ A D   +D      +     +  +S  +LL     D                      + DK  +K  LK+F+ RRPS ++L+ +G++K + +FGS L  +C++E + VP FV +C+ A+E RGL   GIYRVSGN A IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +       K    +  +   K L+ K+ P + +T K LFGHL K+  ++SKN M   ++ +V+GP L  +  +    MA+ ++  NQI + +++ YS++F
Sbjct:   65 QHILKDVI--PPLEQLM-VEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKESKQQ-ALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQI--TTVSGNE--FLLQ--SDIDFIILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIK-DQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAI-------KKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGN-MAIHMVYQNQIAELMLSEYSKIF 470          
BLAST of Rho gtpase activating protein, putative vs. UniProt/SwissProt
Match: sp|Q5ZMM3|RHG15_CHICK (Rho GTPase-activating protein 15 OS=Gallus gallus OX=9031 GN=ARHGAP15 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.057e-49
Identity = 132/411 (32.12%), Postives = 222/411 (54.01%), Query Frame = 1
Query: 1078 TERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE-LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKI--WLIALQYAKDWKQEDMYSEKAST-------VVVTSDKKLLDAACIDD--------------------SSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
             E+ G++ KAK+++ GK++ K W    +VLT  ++ FYK+ K     +  P  K E + L   ++++T   +K S+ NV Q+  T   G+   +LL+  S  D  I  W  A++ A D     +  E++ T       +  +S  +LL++   +                      S D+  +K  LK+F+ RRPS ++L+ +G++K + +FGS L ++C+ E + VP+FV +C+ A+E RGL   GIYRVSGN A IQKLR  V+ E K  L +S++ ++  +TGA K+FF+EL +PL       + ++ +   K+    T     +   K L+ K+   +Y+T K LF HLKK+A + S N M   ++ +V+GP L     +    MAV ++  NQIV+ +++ YS++F
Sbjct:   81 VEKEGYLLKAKIADGGKKLRKNWSTSWIVLTSRKMEFYKESKQPALANLKPGYKPECVDLCGAHIEWTP--EKSSRKNVFQI--TTVSGNE--FLLQ--SDIDFLILDWFHAIKNAID----RLPKERSCTSRNLEFKLRRSSSTELLNSLDTESKESKPEHRKSLIFRLNYSASDSNDRSRVKSRLKKFISRRPSLKTLQEKGLIK-DQIFGSHLHLVCEHENSTVPQFVRQCIKAVERRGLEVDGIYRVSGNLATIQKLRFVVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYCFFEQFVEAI---KIQDNAT----RIKAVKTLVKKLPRPNYDTMKVLFEHLKKIAAKESVNLMSTQSLGIVFGPTLLRPEKETGN-MAVHMLYQNQIVELMLSEYSKIF 470          
BLAST of Rho gtpase activating protein, putative vs. TrEMBL
Match: G7Y6X0 (Rho GTPase-activating protein 27 OS=Clonorchis sinensis OX=79923 GN=CLF_101935 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 8.216e-76
Identity = 180/530 (33.96%), Postives = 277/530 (52.26%), Query Frame = 1
Query:  658 WIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHE--------DENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKD-SKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSD--KKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            W+R + DG +++++  T ++W  T D +G  Y+Y   S +S W L       ED +   KDA      S  S     T  +   + +  + H         D N +  +  ++P ++P    +D+    +  +KKE+ISGP  NKL   ER G  + AK++ N + V K+W    +VL+GP    YKD K+A PK   P GK E KL +Q ++ ++  + + SK +V+++E   A G +  YL++ P P  +  W  A++YA    Q+ M  EK  T  +  D  K  L      D+      I   + +F + RPSPE+L +RGILK E VF S+L  +C+ E + VP FV   V AIEARGL H G+YR+S N A +QKLR  V++  Y LNS+   L+ L GA KLFF+ELK+PL      SK+  L ++ K D +       V   + ++  M   H+ T++ LF HL +V   + +N M I  +++V+GP+L  S     + +A+L       VDF +T   +LF
Sbjct:  218 WLRYHYDGDEMYVDQKTGEQWVLTTDSNGIPYYYQVNSERSVWEL-------ED-IGNCKDADPSEHSSQTSSNVDSTPTKRRTFAATPATHAPTQRLSMLDLNRQPPV-INEPAQVP---CEDSRLFDVTRMKKEYISGPQENKLAHFERRGLAKYAKITTNDRRVKKRWSDCLLVLSGPWFLIYKDNKSATPKPNNPYGKPEAKLHVQLIEPSDATESETSKEHVLKIEQKDARGISTAYLIQMP-PNVIVCWKAAIRYA----QQLMEEEKLLTPSLARDTLKNFLKPPSKLDN-----GILSKMLEFFRSRPSPEALRSRGILKNEPVFASTLIQICESENSDVPRFVVCAVRAIEARGLDHLGLYRISANAATVQKLRCCVNQYNYSLNSDKWSLDVLAGALKLFFRELKEPLFTFNAFSKIAALFASNKPDSE------MVGLFRSILDSMPTPHFVTARVLFHHLTRVQEHAEQNQMHIHKLALVFGPSLLRSETDTES-LAMLTNVQAPCVDFCLTHVVDLF 718          
BLAST of Rho gtpase activating protein, putative vs. TrEMBL
Match: A0A094ZZX6 (Rho GTPase-activating protein 27 OS=Schistosoma haematobium OX=6185 GN=MS3_09001 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.329e-75
Identity = 185/555 (33.33%), Postives = 285/555 (51.35%), Query Frame = 1
Query:  658 WIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDE------------------------NIKDSLPS--------DKPLEIPESNKDDNYKIG---IRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTE-KLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            W     +G +++IN +T ++W    D  G+ Y+Y+  +R S W L        DA     D+L   ++ +E     E  + S F D +   + D+                        +    +PS        ++P  +   +  D    G   I+++ KEHISGP  NKL   ER G V +  + ENGK + KKWI   + L+GP LF YKD K ++PK   P GK +++  I+ ++ +E   ++ S+ NV+++E   A   N+ +L++ P+  D + W  A++YAKD   ED          VT  + L        S  DK+ + + L+ F + RP+  SL +RGILK E+VF S++  +C+ E + VP F+ R + AIEARGL H GIYR SGN A IQKLR AV++  Y LNSE   LE LTGA KLFF+ELK+PL+  ++  ++  LL +      N   D+ V   ++LI+ M   H +TS+  F HL +V   SS N M   N+++V+GP+L     + S     L       +++L+T   E+F
Sbjct:   91 WRHCVNNGQEMYINEATNEKWVPATDQYGKTYYYELNTRHSVWALEDLETSPTDAPHS-SDSLNNYLDINEPNAPKEAFDCSVFEDENNGSYVDQYPSVSRMSSISKVNRRTMSQSKVSHRSSHIPSEVCSTQVINRPFSLVSLDDQDQGAGGRFQIKNVSKEHISGPSENKLTHFERRGAVIRTMLIENGKRISKKWIPGVLHLSGPLLFLYKDNKPSLPKIHQPLGKPDVQFNIREVKVSEANGEQTSRKNVLKIECETAGKLNV-HLVQIPAI-DYESWKAAIRYAKDLLNEDH--------GVTLGRSLTRYDSGQPSVLDKK-LLVKLRDFFRTRPTAASLRSRGILKNESVFASTIMQICENEDSDVPNFIVRAIRAIEARGLDHVGIYRSSGNGATIQKLRCAVNQYNYSLNSEKWSLEVLTGALKLFFRELKEPLITFKIYPEVDQLLGD-----NNIAPDLKVIRMRELINSMPVPHIDTSRIFFHHLYRVMQLSSINQMHSYNLAIVFGPSLIWPEVE-SVAYRALKSVQVPCIEYLLTHVEEIF 627          
BLAST of Rho gtpase activating protein, putative vs. TrEMBL
Match: A0A4E0RVI1 (WW domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_007696 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 5.179e-75
Identity = 157/406 (38.67%), Postives = 227/406 (55.91%), Query Frame = 1
Query: 1012 KIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKD-SKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDW--KQEDMYSEKASTVV--VTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            +  +RHI KEHISGP  NKL   ER G V + K+ E G+ V KKW +  MVL+GP LF Y+D KAA PK+  P GK E++   Q L  T+   +D S+  V+++E      S   YL++ P    +  W  A +YAK+    +E +  + A + +  +      LD + +             ++ F + RPS ESL ARGILK E VF S+L  +C+ EK++VP F+   V AIEARGL H G+YR+S N +++QKLR  V++  Y LNSE   L+ L G  KLFF+ELK+PL   EL  KL  L ++ KVD+ NT     +++ +++IS M   H  T++ LF HL +V   S  N M    +++V+GPNL  S  +    + +L       VDF +    +LF
Sbjct:  422 RFNLRHIGKEHISGPEQNKLTNFERRGMVSRTKLVEQGRRVSKKWSEALMVLSGPWLFLYRDTKAATPKASCPYGKPEVRFHAQQLVVTDATGEDTSRKCVLKLEVEAPESSKTAYLVQLPE-NVLDSWKAAFRYAKEILNDEERLTPQLARSTIRNLPRPPSKLDTSLVTK-----------MRDFFRTRPSAESLRARGILKNEPVFASTLVQICENEKSEVPRFIACAVRAIEARGLDHLGLYRISANASEVQKLRCCVNQYNYSLNSEKWSLDVLAGGLKLFFRELKEPLFTFELFPKLKRLFAS-KVDEANT-----LTSMQEMISSMPGPHIATARVLFHHLYRVLKHSDANQMHAHKLAIVFGPNLIRSDTEVE-HLGILTAVQAPCVDFCLKHIVQLF 808          
BLAST of Rho gtpase activating protein, putative vs. TrEMBL
Match: A0A430QP53 (Rho GTPase-activating protein 12/27 (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0000971 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.841e-74
Identity = 183/555 (32.97%), Postives = 284/555 (51.17%), Query Frame = 1
Query:  658 WIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDE------------------------NIKDSLPS--------DKPLEIPESNKDDNYKIG---IRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTE-KLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            W     +G +++IN +T ++W    D  G+ Y+Y+  +R S W L        DA     D+L   ++ +E     E  + S F D +   + D+                        +    +PS        ++P  +   +  D    G   ++++ KEHISGP  NKL   ER G V +  + ENGK + KKWI   + L+GP LF YKD K ++PK   P GK +++  I+ ++ +E   ++ S+ NV+++E   A   N+ +L++ P+  D + W  A++YAKD   ED          VT  + L        S  DK+ + + L+ F + RP+  SL +RGILK E+VF S++  +C+ E + VP F+ R + AIEARGL H GIYR SGN A IQKLR AV++  Y LNSE   LE LTGA KLFF+ELK+PL+  ++  ++  LL +  +       D+ V   ++LI+ M   H  TS+  F HL +V   SS N M   N+++V+GP+L     + S     L       +++L+T   E+F
Sbjct:   89 WRHCVNNGQEMYINEATNEKWVPATDQYGKTYYYELNTRHSVWALEDLETSPTDAPHS-SDSLNNYLDINEPNASKEAFDCSVFEDDNNGSYVDQYPSVSRMSSISKVNRRTMSQSKVSHRSSHIPSEVCSTQVINRPFSLVSLDDQDQGAGGRFQMKNLSKEHISGPSENKLTHFERRGAVIRTMLIENGKRISKKWIPGVLHLSGPLLFLYKDNKPSLPKIHQPLGKPDVQFNIREVKVSEANGEQTSRKNVLKIECETAGKLNV-HLVQIPA-IDYESWKAAIRYAKDLLNEDH--------GVTLGRSLTRYDSGQPSVLDKK-LLVKLRDFFRTRPTAASLRSRGILKNESVFASTIMQICENEDSDVPNFIVRAIRAIEARGLDHVGIYRSSGNGATIQKLRCAVNQYNYSLNSEKWSLEVLTGALKLFFRELKEPLITFKIYPEVDQLLGDNDIA-----PDLKVIRMRELINSMPVPHINTSRIFFHHLYRVMQLSSINQMHSYNLAIVFGPSLIWPEVE-SVAYRALKSVQVPCIEYLLTHVEEIF 625          
BLAST of Rho gtpase activating protein, putative vs. TrEMBL
Match: A0A075AGI7 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04454 PE=4 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 4.201e-74
Identity = 172/520 (33.08%), Postives = 273/520 (52.50%), Query Frame = 1
Query:  646 VDSNWIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLP--GPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENI------KDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKD-SKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQI 2178
             +  W+R + DG +++++  T ++W  T D +G  Y+Y   S +S W L   G  + A+ +     D        + S  E+   +   F  + A+      +      + +   ++P ++P    +D+    +  +KKEHISGP  NKL   ER G  + AK++ N + V K+W    +VL+GP    YKD K+A PK   P GK E KL +Q ++ ++  + + SK +V+++E   A G   TYL++ P P  +  W  A++YA    Q+ M  EK  T  +  D       C+   S     I   + +F + RPSPE+L +RGILK E VF S+L  +C+ E + VP FV   V AIEARGL H G+YR+S N A +QKLR  V++  Y LNS+   L+ L GA KLFF+ELK+PL      SK+  L ++ K D +       V   + ++  M   H+ T++ LF HL +V   + +N M I  +++V+GP+L  S     +   + ++T+NQ+
Sbjct:  360 TNPRWLRYHNDGDEMYVDQKTGEQWVLTTDSNGIPYYYQVNSERSVWELEDIGNCKDADPS-----DQTSQTGRQTSSNVESAPTKRRTFAATPATHAPTHRLSMLELNRSTHLINEPAQVP---CEDSRFFDVTRMKKEHISGPQENKLAHFERRGLAKYAKLTTNDRRVKKRWSDCLLVLSGPWFLIYKDNKSATPKPNNPFGKPEAKLHVQLIEPSDATESETSKEHVLKIEQKDARGVATTYLIQMP-PNVIVCWKAAIRYA----QQLMDEEKLLTPSLARDTL---KNCLKPPSKLDNGILSKMLEFFRSRPSPEALRSRGILKNEPVFASTLIQICESENSDVPRFVVCAVRAIEARGLDHLGLYRISANAATVQKLRCCVNQYNYSLNSDKWSLDVLAGALKLFFRELKEPLFTFNAFSKIAALFASNKPDSE------MVGLFRTILDSMPTPHFATARVLFHHLTRVQEHAEQNQMHIHKLALVFGPSLLRSETDTES---LAMLTNNQM 854          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Cavefish
Match: ARHGAP9 (Rho GTPase activating protein 9 [Source:HGNC Symbol;Acc:HGNC:14130])

HSP 1 Score: 184.111 bits (466), Expect = 6.033e-50
Identity = 125/402 (31.09%), Postives = 205/402 (51.00%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQG---KSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDD-SSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-------ENKYQLNSEFMELE-------------TLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            E++G + K K++E G+++ K W    +VL G  L F+KDPK   P S  P     +S + L+   LQ+    D  S+ NV ++       +   +LL+  +   ++ W   +Q   D     +       ++ T    L     I +  + +++ +K  LK+ + RRP  ++L+ +G++K + VFG SLE+LC++EK+ VP FV  C   +E +GL   GIYRVSGN A IQKLR AV+       + +Y    E ++++              +TGA KLFF+EL +PL+       +++ +S+        Y D  V+  K LI  M P +++T + +F HLK+V   S  N M   NI +V+GP L          MAV ++  NQ V+ +++ Y +LF
Sbjct:   87 EKAGLLNKTKIAEGGRKLRKNWNPSWVVLVGNSLVFFKDPKTQSPASWKPGNSCPESSVDLRGAQLQWAN--DLSSRKNVFKLRTI----TGNEFLLQSETDSLIREWYGTIQKVIDRLVGPLLL--PCCLIFTVFHFLASFDVISNLENSERKRVKSRLKKLILRRPPLQALQEKGLIK-DQVFGCSLEVLCEREKSTVPRFVRNCTETVEKKGLETDGIYRVSGNLAVIQKLRFAVNHERAVSTDGRYLFPEELVQVDRIDLEDPQWEDIHVITGALKLFFRELPEPLVPYGFFHDIVETMSD--------YLD-KVNRMKLLIISMPPPNHDTMRHMFRHLKRVMEHSDSNRMTTQNIGIVFGPTLMRPQSDCGN-MAVNMIYQNQAVELILSEYDQLF 469          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Cavefish
Match: arhgap15 (Rho GTPase activating protein 15 [Source:ZFIN;Acc:ZDB-GENE-070912-314])

HSP 1 Score: 171.785 bits (434), Expect = 1.026e-45
Identity = 134/458 (29.26%), Postives = 222/458 (48.47%), Query Frame = 1
Query:  937 DENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSG-FVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE-LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYA--KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDS-------------------------SGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLN---SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            + N  + L   K + IP+ +         R  + +H  G    +    +  G ++ KAK+S+ GK++ K W    +VL   EL FYK+ K        P GK++ + L    +++T   +K S+ NV Q+       S   +LL+      +  W  A++ A  +    +       +T+V ++  + L     D +                         S DK  +K  LK+F+ RRPS ++L+ +G++K + VFG  +  LC +E   VP FV  CV  +E RGL   GIYRVSGN + IQKLR  VD+ +  LN   S++ ++  +TGA K+FF+EL +PL         ++ +  ++  +K       + + KKL+ ++   ++ T K LF HL++V  +S +N M    +S+V+GP L      A   MAV ++  NQIV+FL+    E+F
Sbjct:   23 NANTGERLSQTKSMVIPDLDTPSKPINRHRRNQSQHNVGQGLQQFQPVDFQGEYLNKAKISDGGKKLRKNWTTCWVVLCSNELHFYKEQKQEELAKLKPGGKTDGVDLCDAVIEWTT--EKSSRKNVFQITTR----SGDEFLLQSDDYATISKWHDAIKRAVGRLSSGDARPGTGKATLVRSNSTECLPRRGYDSTKIKAKEPKPEHRRSIMFKLNYSASDSADKNGVKNRLKKFISRRPSMKTLQEKGLIK-DCVFGCHMLTLCQREGTTVPRFVQMCVTEVEKRGLEADGIYRVSGNLSTIQKLRFLVDQEE-TLNLGDSQWEDIHVITGALKMFFRELPEPLFPFRFFDLFVEAIKTKEQKQK-------IQSLKKLVHQLPKPNHNTMKLLFHHLQRVLTKSRQNLMSSQGVSIVFGPTLMWPELDAGN-MAVNMVYQNQIVEFLLLECVEIF 464          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Cavefish
Match: arhgap15 (Rho GTPase activating protein 15 [Source:ZFIN;Acc:ZDB-GENE-070912-314])

HSP 1 Score: 171.785 bits (434), Expect = 1.026e-45
Identity = 134/458 (29.26%), Postives = 222/458 (48.47%), Query Frame = 1
Query:  937 DENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSG-FVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE-LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYA--KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDS-------------------------SGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLN---SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            + N  + L   K + IP+ +         R  + +H  G    +    +  G ++ KAK+S+ GK++ K W    +VL   EL FYK+ K        P GK++ + L    +++T   +K S+ NV Q+       S   +LL+      +  W  A++ A  +    +       +T+V ++  + L     D +                         S DK  +K  LK+F+ RRPS ++L+ +G++K + VFG  +  LC +E   VP FV  CV  +E RGL   GIYRVSGN + IQKLR  VD+ +  LN   S++ ++  +TGA K+FF+EL +PL         ++ +  ++  +K       + + KKL+ ++   ++ T K LF HL++V  +S +N M    +S+V+GP L      A   MAV ++  NQIV+FL+    E+F
Sbjct:   23 NANTGERLSQTKSMVIPDLDTPSKPINRHRRNQSQHNVGQGLQQFQPVDFQGEYLNKAKISDGGKKLRKNWTTCWVVLCSNELHFYKEQKQEELAKLKPGGKTDGVDLCDAVIEWTT--EKSSRKNVFQITTR----SGDEFLLQSDDYATISKWHDAIKRAVGRLSSGDARPGTGKATLVRSNSTECLPRRGYDSTKIKAKEPKPEHRRSIMFKLNYSASDSADKNGVKNRLKKFISRRPSMKTLQEKGLIK-DCVFGCHMLTLCQREGTTVPRFVQMCVTEVEKRGLEADGIYRVSGNLSTIQKLRFLVDQEE-TLNLGDSQWEDIHVITGALKMFFRELPEPLFPFRFFDLFVEAIKTKEQKQK-------IQSLKKLVHQLPKPNHNTMKLLFHHLQRVLTKSRQNLMSSQGVSIVFGPTLMWPELDAGN-MAVNMVYQNQIVEFLLLECVEIF 464          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Cavefish
Match: arhgap15 (Rho GTPase activating protein 15 [Source:ZFIN;Acc:ZDB-GENE-070912-314])

HSP 1 Score: 171.785 bits (434), Expect = 1.026e-45
Identity = 134/458 (29.26%), Postives = 222/458 (48.47%), Query Frame = 1
Query:  937 DENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSG-FVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE-LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYA--KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDS-------------------------SGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLN---SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            + N  + L   K + IP+ +         R  + +H  G    +    +  G ++ KAK+S+ GK++ K W    +VL   EL FYK+ K        P GK++ + L    +++T   +K S+ NV Q+       S   +LL+      +  W  A++ A  +    +       +T+V ++  + L     D +                         S DK  +K  LK+F+ RRPS ++L+ +G++K + VFG  +  LC +E   VP FV  CV  +E RGL   GIYRVSGN + IQKLR  VD+ +  LN   S++ ++  +TGA K+FF+EL +PL         ++ +  ++  +K       + + KKL+ ++   ++ T K LF HL++V  +S +N M    +S+V+GP L      A   MAV ++  NQIV+FL+    E+F
Sbjct:   23 NANTGERLSQTKSMVIPDLDTPSKPINRHRRNQSQHNVGQGLQQFQPVDFQGEYLNKAKISDGGKKLRKNWTTCWVVLCSNELHFYKEQKQEELAKLKPGGKTDGVDLCDAVIEWTT--EKSSRKNVFQITTR----SGDEFLLQSDDYATISKWHDAIKRAVGRLSSGDARPGTGKATLVRSNSTECLPRRGYDSTKIKAKEPKPEHRRSIMFKLNYSASDSADKNGVKNRLKKFISRRPSMKTLQEKGLIK-DCVFGCHMLTLCQREGTTVPRFVQMCVTEVEKRGLEADGIYRVSGNLSTIQKLRFLVDQEE-TLNLGDSQWEDIHVITGALKMFFRELPEPLFPFRFFDLFVEAIKTKEQKQK-------IQSLKKLVHQLPKPNHNTMKLLFHHLQRVLTKSRQNLMSSQGVSIVFGPTLMWPELDAGN-MAVNMVYQNQIVEFLLLECVEIF 464          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Cavefish
Match: arhgap27 (rho GTPase-activating protein 27 [Source:NCBI gene;Acc:103022762])

HSP 1 Score: 168.318 bits (425), Expect = 1.662e-42
Identity = 122/407 (29.98%), Postives = 205/407 (50.37%), Query Frame = 1
Query: 1066 KLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKA----AIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIW----------LIALQYAKDWKQE----DMYSEKASTVVVTSDKKLLDAAC-----IDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENK-YQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            K+   E++G + K K+ +NGK+V K W     VL G  L F+KDPK+    A  K+     +  + L+   + +  K +K SK NV++++          +L+++ +   +  W          L   Q+  + ++E       SEK    V  +D++ +  A         S  D + ++  LK+FL +RP+ +S++ +G ++ E VFG  L  LC QEK  VP FV +C+  +E RGL   GIYRVSGN A IQKLR   D  +   L     ++  +TGA KLFF+EL++PL      S     +   K+   ++     VS    L+  +   ++ T +ALF HL+KV     +N M + N+++V+GP L     + S  + + ++  NQI++F++  +  +F
Sbjct:  650 KMSNLEKAGILNKTKICDNGKKVRKNWGLSWTVLHGGILTFHKDPKSNPTGAASKTNQFVPEFTVDLRGAMIGWAAK-EKSSKKNVLELKSRAG----AEFLVQYDTESIINDWHKVITDTIRQLDVEQHHSEDEEEVSEKTFSSEKEDRPVAIADRRRMSNAGKLSSSFSSSESDPKKVRNKLKKFLLKRPTLQSVKEKGYIR-ENVFGCHLHNLCAQEKTTVPSFVEKCIRTVEKRGLGIDGIYRVSGNLAVIQKLRFRADHAEDLNLEEGNWDIHVITGALKLFFRELQEPLFP---YSHFNSFVQGIKIADYHS----RVSYMSDLVKSLPAPNHNTMEALFSHLRKVIEHGEENRMTVQNVAIVFGPTLLKPEME-SANITMYMVFQNQIIEFILNEFETIF 1042          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004494.1 (pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-1 gene:ENSPMAG00000004080.1 transcript:ENSPMAT00000004494.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 2.522e-50
Identity = 159/535 (29.72%), Postives = 247/535 (46.17%), Query Frame = 1
Query:  676 DGTDIFINASTRQRWRATIDDS-GRQYFYDEKSRQSAWNLPGPAQIA----EDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDSLPS-DKPLEIPESNKDDNYK-IGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAA------------CIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQLNS-EFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHL-KKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            DG  ++IN  T+++W   +D S G  YFY+E + QS+W+LP    I        ++ +K   +G            T          A  HE       LP+ ++      +N+D   K +G  H  K            +T + G + KAK+ E GK++ K W    + LT   + F +        S   +G   + L+   ++     DK SK NV+QM       S   YLL+    E++  WL  +    +   +D  S+ A+   VTS  K+  +             C   S+ D +N    LK  + RRP+ ++LE +GI+K E VFG  L+ LC++E + VP F    V  +E  GL   GIYRVSGN A IQKLR  VD E K  L   ++ ++  +TGA K+FF+EL +PL   +     I+ +  +   +K       +    KLI+ + P++ ET K LF HL  +V      N M + N+++V+GP L     Q     AV ++  NQIV+ ++T +   F
Sbjct:  112 DGNVLYINEETQEQWTRCVDTSTGSVYFYNEMTNQSSWDLPKNYNIQYYRYSRHIQSVKTLTQGYTIKMIVNFARHTLA-----PPIALGHE-------LPTVERSKSFSSANRDSLVKPLGAEHKDK------------KTIKQGTLNKAKIVEGGKKLRKSWSNVFVTLTTSTISFKESGPGWKLASMSTKGLHAVCLRGARIEVVR--DKSSKKNVMQMTTV----SEDVYLLQSDKEENVNQWLQEIHKLPNSSNDDSDSKLAAHDEVTSLPKIQPSITRSSNRESRFLHCRRVSTLDNKNK---LKNLISRRPTRQALEEKGIIK-EQVFGCPLQTLCEREGSAVPNFARLSVQCVERTGLQVDGIYRVSGNLATIQKLRFIVDHEEKLDLEEPQWDDVHVITGALKMFFRELPEPLFPFKFFPHFINAIKIKDYAEK-------IRCMGKLIAILPPTNRETMKLLFNHLATRVVAHGKTNRMSVQNLAIVFGPTLLRPE-QEVGHFAVHMVYQNQIVEHILTEHKTFF 604          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004676.1 (pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-1 gene:ENSPMAG00000004196.1 transcript:ENSPMAT00000004676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 2.545e-46
Identity = 153/528 (28.98%), Postives = 259/528 (49.05%), Query Frame = 1
Query:  691 FINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPA---QIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKA---AIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIAL---QYAKDWKQEDMYSEKASTVVVTSDKKLLDA---------ACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            F + ++  +W+  +D++G+ YFY  K   S W LP  A   Q+ +  V     ++  + + S       T  +    D D S       K +  +  PL    +      +   +H+     S PL       +++G + K K+ E GK++ K W    +VL+G  L F+K+PKA   A  K+G  Q K E  ++++        DK SK NV Q++ TG    +  +LL+  +   +  W  A+   ++  ++ + D    +  +      +K  D+         A ++  S DK+  K  L +F  +RP  +SL  +G++K E VFG  L +LC++E   VP+FV   +  ++ RGL   GIYRVSGN A IQKLR  VD E K  L+ S + ++  +TGA K+FF+EL +PL         I  +  +   +K       ++  K+ + K+   + +T +ALF HLKKV      N M   ++++V+GP L     ++S+ MA  L+  NQIV+F+++ ++ +F
Sbjct:  122 FTHLASPDKWKRLMDENGKVYFYTSKG-DSVWELPKAAWATQLLQTIV-----SVASIFKISSHSLSLITPHKRTLSDHDLSD------KAAPATVNPLSPVSATAASTLR---KHLVSP--SQPL-------DKAGMLNKTKIMEAGKKLRKNWAPSWVVLSGSSLVFHKEPKAQTAASWKTGSAQSKPEGSVELRGAHVEWARDKSSKKNVFQIQ-TGT--GHHEFLLQSDNDTIINEWFQAISVVKFGGNFDEVDGSGGEEESSESPLREKSKDSKRPWAVGKPAVVE--STDKKKAKRKLMKFFPKRPPIQSLRDKGLIK-EQVFGCPLAMLCERENTTVPKFVQLSIETVDKRGLCIDGIYRVSGNLATIQKLRFLVDHEEKVSLDESHWEDIHVITGALKMFFRELPEPLFPFNQFDPFISAIKLQDSREK-------LTKIKEQVQKLPKPNKDTMRALFEHLKKVIACGDANRMTTQSVAIVFGPTLLRPENESSS-MAFHLVYQNQIVEFILSEFTTVF 611          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Sea Lamprey
Match: ARHGAP15 (Rho GTPase activating protein 15 [Source:HGNC Symbol;Acc:HGNC:21030])

HSP 1 Score: 174.096 bits (440), Expect = 2.295e-45
Identity = 127/398 (31.91%), Postives = 198/398 (49.75%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIP-KSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIW------LIALQYAKDWKQEDMYSEKASTVVVTSDKK-----------LLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQ--LNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            E++G + K K++E GK++ K W    +VL G +L  YKDPK+    K G    K E  + ++        DK SK NV Q+  +GA      +LL+  +   M+ W      LIA + A      D+  +         DKK           +L    I D    +      L++ + RRP+ ++L+ +G +K E VFG  L  LC++E + VP FV  C++A+E + L   G+YRVSGNQA IQKLR+ VD +++    +S++ ++  +TGA KLFF+EL +PL+      + I  +      K   Y +  V   K LI+ +   ++ T K L  HLK V     KN M + N+++V+ P L          MAV ++  NQIVD ++     +F
Sbjct:  420 EKAGMLNKTKITEGGKKLRKNWTNVWVVLVGHDLILYKDPKSHTGWKQGASNSKPECCIDLRGAHIEWTRDKSSKKNVCQLTVSGAN----EFLLQSDNDHTMQEWYQSIRSLIA-RLASTPDDGDVSGDDEPYEPSLRDKKDQRDSRKGHVFMLSTNEISDKKRSR------LRKLITRRPTLQTLKDKGYIK-EQVFGCPLACLCERENSMVPLFVRMCMIALEWQRLEIDGVYRVSGNQATIQKLRIMVDHDEHVDLDDSQWEDINVITGALKLFFRELPEPLVPYIFFEQFIAAI------KIFEYHN-RVKCMKDLINILPLPNHNTMKFLIRHLKTVVAHGEKNRMSMQNMAIVFAPTLLRPEVDPGN-MAVHMVYQNQIVDLILGECDNIF 797          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009729.1 (pep scaffold:Pmarinus_7.0:GL479885:30406:34857:-1 gene:ENSPMAG00000008792.1 transcript:ENSPMAT00000009729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 9.683e-25
Identity = 63/172 (36.63%), Postives = 98/172 (56.98%), Query Frame = 1
Query: 1711 GLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQL--NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHN-QIVDFLITRYSELF 2214
            GL   GIYR+SGN A +QKLR A+D E+K  L  +S + ++  ++GA KLFF+EL + L+ ++     +  L       + TY         +LI+ +   H ET K LFGHLK+VA     N M + N+++V+GP L  S    S + A+  M H  Q+++F++ ++S LF
Sbjct:    1 GLQVDGIYRLSGNLASVQKLRYAIDREDKLDLGTDSPWADIHVVSGALKLFFRELPESLIPQKNFGDFVKALGMNNCQAR-TY------AIGELINSLAGPHLETMKFLFGHLKRVAKHRDANRMSVENLAIVFGPTLLRSE-MNSPQSAMNDMPHQAQVLEFILGQFSTLF 164          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 93.9745 bits (232), Expect = 2.941e-21
Identity = 58/204 (28.43%), Postives = 99/204 (48.53%), Query Frame = 1
Query: 1618 VFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLN---SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHL--KKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            VFG  L  L    + ++P  V  C+  IEARGL   G+YRVSG    ++++R A D+   + +     + ++  +TGA KL+F+EL  PL+  +     ++  + +  D     + +     ++ +  + P+HY+T   L  HL  ++V+ Q   N M   N+S+V+GP L     Q        +     +V+ LI    ELF
Sbjct:  109 VFGCDLTALVKAHRGRLPMVVEMCIGEIEARGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFVE--AAKVSDPAERLEQL-----RRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRPHEQDVLATLNGMRHQRLLVELLIRHVQELF 305          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 83.5741 bits (205), Expect = 8.822e-17
Identity = 55/199 (27.64%), Postives = 94/199 (47.24%), Query Frame = 1
Query: 1618 VFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDE-----NKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDK--KNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFL 2190
            +FG  LE +C++E   +P  V + +  IE RGL   G+YR+ G+   I  L+ A DE     N + L +  + E+  + G FK++ +EL   L    + +   DL    K        YK +      +L+ K+   +Y+T K +  HL KV      N MD SN+++V+  +  +    A++  + L      + DF+
Sbjct: 1964 IFGVPLEDVCERENTLIPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRM----MNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQEDLANSMGSRLGAVQTILQDFI 2158          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 75.0998 bits (183), Expect = 2.505e-14
Identity = 53/183 (28.96%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 1597 GILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELET---------LTGA-FKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNL 2115
            G+ K    FG  LE L + E++ VP  V +C+  I+  GL   GIYR S N   + KL+  +D++   ++   M L +         L G+  K FF  L   +L + L S++   L   +++   T K+        LI  +  + Y T +AL  HLK+V    ++N M++  + ++WGP +
Sbjct:  462 GVQKNFKTFGVPLESLIEFEQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANIS---MILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCL---QIEDPTTRKNF----MHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTI 634          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 72.4034 bits (176), Expect = 1.780e-13
Identity = 57/222 (25.68%), Postives = 106/222 (47.75%), Query Frame = 1
Query: 1618 VFGSSLEILCDQEKNKVPEFVYRCVLAIEA--RGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEF------MELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRK-------------VDKKNTYKDINVSTA-KKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSS-SGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            ++GSSL   C+ E N++P  +  C+  IE+    +   GIYR SG+Q  I+++       K Q N+E        +L  +TG  K + ++L  P+   ++   L+ L+ ++K             ++ KN+   ++  +A K ++  +   HY   + L  H++KV   S  N M + N+++V+ P L    SG+   K  + +   N IV F+   Y ++ 
Sbjct:  788 LYGSSLVARCNYENNEIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLIRDFSGE---KDIIDMKERNYIVAFIFGNYKDIL 1006          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 67.781 bits (164), Expect = 5.831e-12
Identity = 66/248 (26.61%), Postives = 119/248 (47.98%), Query Frame = 1
Query: 1570 PSPESLEARGILKPEA--VFGSSLEILCDQEKNKVPEFVYRCVLAIEAR--GLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEF--------------MELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRK-VDKKNTYKDINVSTAKKL------------ISKMKP-SHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNL-YSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            PSP+ L+      P+   ++GSSL+  C  EK+ VP  +  C+  IE    GL+  G+YR SG+Q  ++++     EN++  N+                 ++  +    K + ++L  P+L   +   LIDL+ N + +++     D  + + +K+            I K+ P  H E  K L  H+ KV   S +N M++ N+S+V+ P+L +   G+   K  V +   N IV+F++  Y ++F
Sbjct:  771 PSPKRLD----YTPDGSHLYGSSLQARCAYEKSTVPIIIRCCIDRIEKDDIGLNMEGLYRKSGSQTLVEEI-----ENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLIHDFDGE---KDIVDMKERNYIVEFILGNYRDIF 1006          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Yeast
Match: BEM3 (Rho GTPase activating protein (RhoGAP); involved in control of the cytoskeleton organization; targets the essential Rho-GTPase Cdc42p, which controls establishment and maintenance of cell polarity, including bud-site assembly [Source:SGD;Acc:S000006036])

HSP 1 Score: 58.151 bits (139), Expect = 4.662e-9
Identity = 54/193 (27.98%), Postives = 90/193 (46.63%), Query Frame = 1
Query: 1615 AVFGSSLEILCDQEKNK------VPEFVYRCVLAI-EARGLHHSGIYRVSGNQAKIQKLR------LAVDENKYQLNSE----------FMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTA-KKLISKMKPSHYETS--KALFGHLKKVAGQSSKNYMDISNISMVWGPNL 2115
            A+FGSSLE       +K      +P  VYRC+  + + RG+   GI+R+SG+   I+ L+        VD  +Y  + E          ++ + T++G  KL+ ++L   L  +E        LS ++V  +N    + +S   K+LI      H   S   ALF  L ++   S  N M++ N+ +V+ P L
Sbjct:  903 AIFGSSLETCLRLSSHKYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKTLQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDE------QFLSFKRVVDENHNNPVQISLGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRNLCIVFSPTL 1089          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Nematostella
Match: EDO49474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG60])

HSP 1 Score: 160.614 bits (405), Expect = 6.100e-43
Identity = 119/400 (29.75%), Postives = 202/400 (50.50%), Query Frame = 1
Query: 1078 TERSGFVEKAKVSENGKEVLKK--WIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE--LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQED-----------MYSEKASTVVVTSDKKLLDAACIDD---SSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFE 2217
             ++ G + + K++++G + +K+  W    + L    + FY+D K+A  K G+P GK E   +L+  NL++        K N  Q+       S + +LL+  +      W  A+                      +S++  TV     + +  A  +     S   K  IK  L++ + RRP+ E LE +GI++ E VFG  +  LC++E   +P FV +C+ AIE+RGL   GIYRV GN A +Q++R+ VD E    L  S F ++  L G+ KL+F+E+ +PL+  +  S  ++ +       K + ++  +   K L+ ++   +++T K L GHL KV G S  N M   N+++VWGPN+      A   +A+ ++  NQIV+FL+  Y E+F 
Sbjct:    9 VQKQGPLNRKKIADSGNKKIKRPSWNNTFVALFNSNIVFYRDHKSASQKPGLPHGKPESSCELRGGNLEWVTS-SSTRKKNAFQISTV----SGLQFLLQSDNQTLANEWFSAIANTITRLPSTPTSLTPGGIMRSFSKRRGTVCPAPFRLVPHAWLLSHFTLSDDQKTKIKDKLRKLISRRPTIEELEKKGIIR-EQVFGCPITHLCEREGTTIPIFVSKCINAIESRGLEFDGIYRVCGNVALVQRIRIMVDQEEPIALGESPFDDVHALAGSLKLYFREMPEPLVPFDFFSGFVEAI-------KQSTRNSKLGALKSLVGQLPRINFDTLKLLLGHLHKVMGFSEVNRMHAQNLAIVWGPNMMRPRYDAGN-IAMNMVYQNQIVEFLLLEYDEIFR 394          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 98.9821 bits (245), Expect = 3.092e-21
Identity = 65/212 (30.66%), Postives = 108/212 (50.94%), Query Frame = 1
Query: 1522 DKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQ---LNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKM 2148
            DKQ    +  Q+ K R   + +E +  +    VFG  +E +  +E   +P  V  CV  IE RGL   GIYR+SG  + +++L+   DEN      L SE  ++  + G FK++ ++L +PL  +EL  K +   +    ++K         T  +L   +   +  T+  LF HL+KVA +S  + M ++N+S V+GPN+   S + S+ M
Sbjct:  580 DKQGAITLSLQYSKTR---QGIERKKSVNSVGVFGVDIETVTSRESCDIPLIVIGCVREIEKRGLEEVGIYRLSGASSDVKRLKEGFDENSQSALVLVSE-ADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKR-------ETMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRPSPKTSSPM 780          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Nematostella
Match: EDO42176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S254])

HSP 1 Score: 93.9745 bits (232), Expect = 3.108e-20
Identity = 65/210 (30.95%), Postives = 97/210 (46.19%), Query Frame = 1
Query: 1621 FGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLN-----------SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFE 2217
            FG  L  L      K P  V  C+  +E RGL   G+YRVSG    I+ L+ + D+                 S + ++ T+TG  KL+F++L  PL+  E  SK I          K   K + +    K + ++  +HYET K L GHL +V+ + SKN M   N+S+V+GP L  +    S    V +      V+ LI+    LF+
Sbjct:  253 FGVDLTTLVKLHNTKRPFVVDICINEVEKRGLDSEGLYRVSGFADDIEALKNSFDKGNTHTTVNYSDGESVNLSTYDDINTITGVCKLYFRQLPLPLITFETYSKFI-------AAAKTQDKHLRIEELSKALGELPQAHYETMKFLMGHLHRVSQRRSKNMMTEENLSIVFGPTLMRAPEGDSLDSLVDMKFQRLAVELLISHQHVLFD 455          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Nematostella
Match: EDO38242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK1])

HSP 1 Score: 83.9593 bits (206), Expect = 1.739e-18
Identity = 60/191 (31.41%), Postives = 90/191 (47.12%), Query Frame = 1
Query: 1546 LKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLN---SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGP 2109
            LK  LKR  S          K   VFG  L +  + E++ VP  V +CVL IE RGL   G+YR+SGN  + ++LR   DEN   ++       ++  +TG  K + +EL +PL+ E++   L     N   DKK    D       +L+S +   +  T   +  HL+ V  +   N MD  N+S+   P
Sbjct:   10 LKTLLKRVQSS---------KKSGVFGFRLNVTSELEQSSVPLLVRKCVLEIEKRGLESVGLYRISGNARRKKELRGFFDENSEAVDISEENCPDINVITGILKDYLRELPEPLITEKMTEGLRKAAKNEIQDKK---VDEQKQVMSELLSGLPDPNRHTLVFILNHLRHVMEKKEFNKMDARNLSVCLAP 188          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Nematostella
Match: EDO31406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY14])

HSP 1 Score: 87.0409 bits (214), Expect = 7.308e-18
Identity = 59/194 (30.41%), Postives = 97/194 (50.00%), Query Frame = 1
Query: 1669 PEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQLNSEFM--ELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKM------AVLLMTHNQ--IVDFLITRYSELFE 2217
            P  + +C   IE  G+   GIYR+SG+ + IQKLR   D +   +L+ E+   ++  ++   K++F+EL  PLL   L  K +  +  +  D+K     I+      ++ ++ P HY T + L  HL KVA  + +  M   N+++VW PNL     Q    +        LL  + Q  IV++LI   +ELF+
Sbjct:  293 PLVLEKCAAVIEEHGIV-DGIYRLSGSSSIIQKLRFLFDGDEPPELDDEYYLRDVHCISSLLKMYFRELPNPLLTYSLYDKFVSAI--QITDEKERKVAIH-----HVVQQLPPPHYRTLEYLLQHLAKVASHAGQTAMHAKNLAIVWAPNLLKPRSQVRITIIYEYGSTALLEINVQAIIVEYLIRNAAELFD 478          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Medaka
Match: ARHGAP9 (Rho GTPase activating protein 9 [Source:NCBI gene;Acc:101162752])

HSP 1 Score: 185.267 bits (469), Expect = 3.062e-48
Identity = 124/398 (31.16%), Postives = 213/398 (53.52%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIP---KSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQED-------MYSEKASTVVVTSD--------KKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-ENKYQLN-SEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            E++G + K K++E G+++ K W    +VL G  L FYKDPK+  P   K G  + +S + L+   L +  +L   SK NV ++       +   +LL+  +   ++ W   ++   D    +       +Y+ + +  V   D        +  L  +  +  + +K+ ++  LK+ + +RP  ++L+ +G++K + VFG SLE+LC++E+  VP FV  C  A+E RGL   GIYRVSGN A IQKLR  V+ E K  L+ SE+ ++  +TGA KLFF+EL +P++     + +++ L      K   Y +  V   K L+  M P +++T + +  HL++V G S  N M+  NI +V+GP L     + +  MAV ++  NQ V+ ++T +  +F
Sbjct:  482 EKAGLLNKTKIAEGGRKLRKNWCSSWVVLVGNSLVFYKDPKSQSPSSWKPGSSRPESSVDLRGAQLHWANELS--SKKNVFKLRTV----TGNEFLLQSETDSLIREWYNTIKNVIDRLDRENPLDNVLLYTLRRAGSVEMLDHSGDEDERRASLPRSASNLENTEKKRVRTRLKKLILKRPPLQALQEKGLIK-DQVFGCSLEMLCERERCTVPRFVRLCTEAVERRGLDTDGIYRVSGNLAVIQKLRFLVNHEEKLNLDESEWEDIHVITGALKLFFRELPEPVVPFGFFTDIVETL------KMPDYVE-KVDRMKCLVLNMPPPNHDTLQFMCQHLRRVLGHSDTNRMNTQNIGIVFGPTLMRPE-RDTGNMAVNMVFQNQAVELILTEFDHIF 864          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Medaka
Match: arhgap27 (rho GTPase-activating protein 15 [Source:NCBI gene;Acc:101169742])

HSP 1 Score: 183.726 bits (465), Expect = 1.864e-47
Identity = 154/542 (28.41%), Postives = 257/542 (47.42%), Query Frame = 1
Query:  676 DGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALE-GVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDS---LPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAA----IPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSN-ITYLLKFPSPEDMKIW-------LIALQYAKDWKQE---DMYS----EKASTVVVTSDKKLLDAACIDDSSG--DKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQL-NSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGS 2223
            +GT +F   ++  +W  ++D+ G+ Y+Y     +S WNLP      E  V P K   E GV+  + S            W       +    +D    +P+ K       N  DN   G         S    + +   E++G + K KVSENGK+V K W     VL    L F+KDPK+     I K+     +  ++LK   + +  K DK SK NV++++     G N + +L+++ +   +  W       +  L Y  +  +E   D+Y     +K S+ +               SSG  D + ++  L + L +RP+ E+++ +G  + E VFG  L+ LC  EK  VP FV +C+ A+E RGL   G+YRVSGN A IQKLR   D  +  L + ++ ++  +TGA KLFF+EL +PL      S     +S  ++   N      +S   +L+  +  ++++T   LF HL ++      N M + N+++V+GP L     ++S  +A+ ++  NQIV+F++  +  +F  S
Sbjct:  468 NGTWVFTTENSSDQWIKSMDEQGQTYYYLRDGSRSQWNLP------EAPVAPYKSREENGVVGENVSVIRN--------WRHTMGPSQFSTGQDDGRFVPAHK------RNMSDNSSNGT----STENSSETQHDIQNLEKAGILNKTKVSENGKKVRKNWTPTWTVLREGVLTFHKDPKSTAAGNINKTNQIVPEFAVELKGATIGWASK-DKSSKKNVLELK-----GKNGVEFLIQYDTDSIIHDWHKIILDAIRKLDYQDNHPEEEDGDIYEKIADDKPSSTIDRRKHPKQPVTHTPSSSGETDPKKVRTKLMKLLMKRPTLEAVKEKGYFR-ENVFGCPLDALCALEKTTVPSFVEKCIKAVEKRGLDIDGLYRVSGNLAVIQKLRCKADHEELNLEDGQWEDVHVITGALKLFFRELPEPLFP---FSHFDAFISAIRISDYNA----KLSRIYELVKSLPQANHDTMALLFEHLHRLIQYGEDNRMTVQNVAIVFGPTLLRPEKESS-NIAMHMIFQNQIVEFVLNEFECIFRSS 970          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Medaka
Match: ARHGAP9 (Rho GTPase activating protein 9 [Source:NCBI gene;Acc:101162752])

HSP 1 Score: 179.874 bits (455), Expect = 2.025e-46
Identity = 124/416 (29.81%), Postives = 213/416 (51.20%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIP---KSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQED-------MYSEKASTVVVTSD--------KKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD-------ENKYQLNSEFMELETL-------------TGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            E++G + K K++E G+++ K W    +VL G  L FYKDPK+  P   K G  + +S + L+   L +  +L   SK NV ++       +   +LL+  +   ++ W   ++   D    +       +Y+ + +  V   D        +  L  +  +  + +K+ ++  LK+ + +RP  ++L+ +G++K + VFG SLE+LC++E+  VP FV  C  A+E RGL   GIYRVSGN A IQKLR  V+       + +Y   +EF++ E L             TGA KLFF+EL +P++     + +++ L      K   Y +  V   K L+  M P +++T + +  HL++V G S  N M+  NI +V+GP L     + +  MAV ++  NQ V+ ++T +  +F
Sbjct:  482 EKAGLLNKTKIAEGGRKLRKNWCSSWVVLVGNSLVFYKDPKSQSPSSWKPGSSRPESSVDLRGAQLHWANELS--SKKNVFKLRTV----TGNEFLLQSETDSLIREWYNTIKNVIDRLDRENPLDNVLLYTLRRAGSVEMLDHSGDEDERRASLPRSASNLENTEKKRVRTRLKKLILKRPPLQALQEKGLIK-DQVFGCSLEMLCERERCTVPRFVRLCTEAVERRGLDTDGIYRVSGNLAVIQKLRFLVNHERAVTTDGRYMFPTEFVQEEKLNLDESEWEDIHVITGALKLFFRELPEPVVPFGFFTDIVETL------KMPDYVE-KVDRMKCLVLNMPPPNHDTLQFMCQHLRRVLGHSDTNRMNTQNIGIVFGPTLMRPE-RDTGNMAVNMVFQNQAVELILTEFDHIF 882          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Medaka
Match: ENSORLT00000043698.1 (rho GTPase-activating protein 12 [Source:NCBI gene;Acc:101158884])

HSP 1 Score: 176.407 bits (446), Expect = 8.457e-46
Identity = 131/398 (32.91%), Postives = 204/398 (51.26%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE--LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYA----------------KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAV--DENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            E+ G V   K++ENGK V K W     VL G EL F K   +     G  Q K E  + LK  ++++  K DK SK NV++++     G+++  L++  +   +  W  AL+                   +   E+M  +K S V   S K+          + DK   K  L++FL RRP+ +S+  +G +K + VFG SL  LC +E + VP FV  C+  +E++GL   G+YRVSGN A IQKLR AV  DE     + ++ ++   TGA K+FF+EL +PL    L  + ++ +      K N Y+   V   K L+ ++   +++T +ALF HL KV   S +N M   +I++V+GP L     + +  MAV ++  NQIVD ++  Y  +F
Sbjct:  315 EKCGVVNMTKITENGKRVRKNWTSSWTVLQGSELLFAKGQASGSSWFGGGQSKPEFTVDLKGASVEWASK-DKSSKKNVIELKIQN--GTDL--LIQCDNDGTITEWFNALEETVHSHACESDEALEEDLPESPGEEMKKKKDSRV---SKKEKASKPATATETSDKTKHK--LRKFLSRRPTLQSVRDKGYIK-DQVFGCSLASLCQRESSTVPHFVKLCIDHVESKGLSIDGLYRVSGNLAVIQKLRFAVNHDEKVNLSDPKWEDIHVTTGALKMFFRELSEPLFTYALFQQFVNAI------KMNDYRQ-RVQAIKDLVRQLPKPNHDTMQALFKHLMKVIDHSEENRMSNQSIAIVFGPTLLRPETE-TWNMAVHMVYQNQIVDLILLEYENIF 693          
BLAST of Rho gtpase activating protein, putative vs. Ensembl Medaka
Match: ENSORLT00000041355.1 (rho GTPase-activating protein 12 [Source:NCBI gene;Acc:101158884])

HSP 1 Score: 176.022 bits (445), Expect = 2.524e-45
Identity = 131/398 (32.91%), Postives = 204/398 (51.26%), Query Frame = 1
Query: 1081 ERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSE--LKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYA----------------KDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAV--DENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELF 2214
            E+ G V   K++ENGK V K W     VL G EL F K   +     G  Q K E  + LK  ++++  K DK SK NV++++     G+++  L++  +   +  W  AL+                   +   E+M  +K S V   S K+          + DK   K  L++FL RRP+ +S+  +G +K + VFG SL  LC +E + VP FV  C+  +E++GL   G+YRVSGN A IQKLR AV  DE     + ++ ++   TGA K+FF+EL +PL    L  + ++ +      K N Y+   V   K L+ ++   +++T +ALF HL KV   S +N M   +I++V+GP L     + +  MAV ++  NQIVD ++  Y  +F
Sbjct:  433 EKCGVVNMTKITENGKRVRKNWTSSWTVLQGSELLFAKGQASGSSWFGGGQSKPEFTVDLKGASVEWASK-DKSSKKNVIELKIQN--GTDL--LIQCDNDGTITEWFNALEETVHSHACESDEALEEDLPESPGEEMKKKKDSRV---SKKEKASKPATATETSDKTKHK--LRKFLSRRPTLQSVRDKGYIK-DQVFGCSLASLCQRESSTVPHFVKLCIDHVESKGLSIDGLYRVSGNLAVIQKLRFAVNHDEKVNLSDPKWEDIHVTTGALKMFFRELSEPLFTYALFQQFVNAI------KMNDYRQ-RVQAIKDLVRQLPKPNHDTMQALFKHLMKVIDHSEENRMSNQSIAIVFGPTLLRPETE-TWNMAVHMVYQNQIVDLILLEYENIF 811          
BLAST of Rho gtpase activating protein, putative vs. Planmine SMEST
Match: SMESG000074995.1 (SMESG000074995.1)

HSP 1 Score: 1347.41 bits (3486), Expect = 0.000e+0
Identity = 685/689 (99.42%), Postives = 686/689 (99.56%), Query Frame = 1
Query:  169 MTEKYFIARHDYVLNNNEGNPINISVGNQFILVEYVDNEYVKLKPIDLDTCNDTELILPRRIVEDMSLPIARKNNQISRSQSAIKERICXXXXXXXXXXXXXTCKFSSFGHGTAIHESIRCMSRSSYESDKKEVVPIVNKVENENSEMITDTPRLRQSHVDSNWIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIXXXXXXXXXXXXXXXDFWDSDASQHEDENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFPSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSSKQT 2235
            MTEKYFIARHDYVLNNNEGNPINISVGNQFILVEY+DNEYVKLKPIDLDTCNDTELILPRRIVEDMSLPIARKNNQISRSQSAIKERICSLNLNDNGSSLSDTCKFSSFGHGTAIHESIRCMSRSSYESDKKEVVPIVNKVENENSEMITDTPRLRQSHVDSNWIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIESSESEEEAETKEESDFWDSDASQHE EN KDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKF SPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSSKQT
Sbjct:    1 MTEKYFIARHDYVLNNNEGNPINISVGNQFILVEYLDNEYVKLKPIDLDTCNDTELILPRRIVEDMSLPIARKNNQISRSQSAIKERICSLNLNDNGSSLSDTCKFSSFGHGTAIHESIRCMSRSSYESDKKEVVPIVNKVENENSEMITDTPRLRQSHVDSNWIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEKSRQSAWNLPGPAQIAEDAVKPIKDALEGVIESSESEEEAETKEESDFWDSDASQHEAENNKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNKLMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPKSGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKFLSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSSGDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSSKQT 689          
BLAST of Rho gtpase activating protein, putative vs. Planmine SMEST
Match: SMESG000057671.1 (SMESG000057671.1)

HSP 1 Score: 88.5817 bits (218), Expect = 7.603e-18
Identity = 56/194 (28.87%), Postives = 98/194 (50.52%), Query Frame = 1
Query: 1618 VFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDEN----KYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDF 2187
            VFG  L  L   E   +P    + + A+E R L+  G+YR+SGN   I+++R+ ++++     ++ +  F ++ETLTG  KLF ++L  PL+  EL + LI +   RK + K     I     +  +S +   HY T +    HL KV+     N+M  SN+++++ P L      + T ++  ++      DF
Sbjct:  417 VFGIELTSLAKMENRAIPLVFEKLIQALEDRDLNSQGLYRISGNIDLIEEVRIDLNKDIESVDFKGDPRFRDIETLTGLIKLFLRQLPIPLITSELYTNLISI---RKAEDK---IPIRYYQFRNTMSILNSVHYATLEFFIRHLNKVSQFHRTNFMTSSNLAIIFAPTLICKPNTSDTGLSPEMLIFRMQSDF 604          
BLAST of Rho gtpase activating protein, putative vs. Planmine SMEST
Match: SMESG000066507.1 (SMESG000066507.1)

HSP 1 Score: 88.1965 bits (217), Expect = 9.864e-18
Identity = 54/172 (31.40%), Postives = 91/172 (52.91%), Query Frame = 1
Query: 1618 VFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSE----FMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYS 2121
            VFG  L  L   EK  VP  + R V  +EARG+   GIYRVSGN   I +++  +D++   ++ E      E+  ++   KLFF++L  PL+  E+ S L+D++  ++  K      + +      + ++   HY T K L  HL K++  S  N M + N+++++ P+L S
Sbjct:  422 VFGIELTSLGKVEKRGVPMIIMRLVEEVEARGMEIEGIYRVSGNSELIDEVKADLDKDIDSIDMEKDGRLCEIHNISSLIKLFFRQLPIPLVTLEVSSMLMDIIKTQENQK------VRLEQFTDCLLRLPLVHYATLKYLMAHLYKLSSFSEINKMTVENLAIIFAPSLIS 587          
BLAST of Rho gtpase activating protein, putative vs. Planmine SMEST
Match: SMESG000028956.1 (SMESG000028956.1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.171e-17
Identity = 57/245 (23.27%), Postives = 124/245 (50.61%), Query Frame = 1
Query: 1501 CIDDSSGDKQNIKII-LKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD--ENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSS 2226
            C+  + G+ ++I  I   + L+   S  S+E   ++K   +FG +L+      +  +P  ++  +  I   G+H+ GI+R+SG+QA+I +L+   D  ++ +  NS+  ++    G  K++F+ELK+P+    L  ++++     +  +K ++    ++ A+++++ +    Y   + LF  LK V+     N MD  N+++ +GP L     + +  +  +    N+IV   I  ++ +F   S
Sbjct:  478 CLKQALGEGKSITSINPNKPLRESRSIASVENENLIK---IFGGTLQEYVTLSQQPIPPLIHNTINIINLYGMHNQGIFRISGSQAEINELKEMYDNCQDPFINNSQIPDVNVAAGLLKMYFRELKEPVFSGTLFHQIVETFETER--EKKSF----INKAREIMNSIPTEIYVILRYLFAFLKYVSELKEDNMMDSYNLAICFGPCLMPIPNEFNKVLFHMQAIVNEIVRLFIENHNSIFNNPS 713          
BLAST of Rho gtpase activating protein, putative vs. Planmine SMEST
Match: SMESG000028956.1 (SMESG000028956.1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.249e-17
Identity = 57/245 (23.27%), Postives = 124/245 (50.61%), Query Frame = 1
Query: 1501 CIDDSSGDKQNIKII-LKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKVPEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVD--ENKYQLNSEFMELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVSTAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLYSSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSS 2226
            C+  + G+ ++I  I   + L+   S  S+E   ++K   +FG +L+      +  +P  ++  +  I   G+H+ GI+R+SG+QA+I +L+   D  ++ +  NS+  ++    G  K++F+ELK+P+    L  ++++     +  +K ++    ++ A+++++ +    Y   + LF  LK V+     N MD  N+++ +GP L     + +  +  +    N+IV   I  ++ +F   S
Sbjct:  478 CLKQALGEGKSITSINPNKPLRESRSIASVENENLIK---IFGGTLQEYVTLSQQPIPPLIHNTINIINLYGMHNQGIFRISGSQAEINELKEMYDNCQDPFINNSQIPDVNVAAGLLKMYFRELKEPVFSGTLFHQIVETFETER--EKKSF----INKAREIMNSIPTEIYVILRYLFAFLKYVSELKEDNMMDSYNLAICFGPCLMPIPNEFNKVLFHMQAIVNEIVRLFIENHNSIFNNPS 713          
The following BLAST results are available for this feature:
BLAST of Rho gtpase activating protein, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP152.353e-5031.29Rho GTPase activating protein 15 [Source:HGNC Symb... [more]
ARHGAP121.038e-4028.28Rho GTPase activating protein 12 [Source:HGNC Symb... [more]
ARHGAP273.090e-3927.97Rho GTPase activating protein 27 [Source:HGNC Symb... [more]
ARHGAP273.090e-3927.97Rho GTPase activating protein 27 [Source:HGNC Symb... [more]
ARHGAP273.090e-3927.97Rho GTPase activating protein 27 [Source:HGNC Symb... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-3253.164e-3730.23WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3253.328e-3730.23WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3251.231e-3635.06WW domain-containing protein tag-325 [Source:UniP... [more]
chin-11.838e-2029.17CHImaeriN (Rac-GTPase-activating protein) homolog ... [more]
rrc-15.998e-1826.95GTPase-activating protein rrc-1 [Source:UniProtKB... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP1A1.006e-1727.27gene:FBgn0025836 transcript:FBtr0112920[more]
RhoGAP1A1.006e-1727.27gene:FBgn0025836 transcript:FBtr0112919[more]
RhoGAP1A1.007e-1727.27gene:FBgn0025836 transcript:FBtr0340054[more]
CdGAPr1.021e-1729.44gene:FBgn0032821 transcript:FBtr0300967[more]
RhoGAP1A1.023e-1727.27gene:FBgn0025836 transcript:FBtr0340053[more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap271.100e-5628.78Rho GTPase activating protein 27 [Source:ZFIN;Acc:... [more]
arhgap153.238e-4633.01Rho GTPase activating protein 15 [Source:ZFIN;Acc:... [more]
arhgap153.238e-4633.01Rho GTPase activating protein 15 [Source:ZFIN;Acc:... [more]
arhgap27l3.520e-4632.24Rho GTPase activating protein 27, like [Source:ZFI... [more]
arhgap27l3.520e-4632.24Rho GTPase activating protein 27, like [Source:ZFI... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tox37.581e-5332.11TOX high mobility group box family member 3 [Sourc... [more]
psmd26.048e-4931.09proteasome 26S subunit, non-ATPase 2 [Source:Xenba... [more]
psmd23.425e-4431.50proteasome 26S subunit, non-ATPase 2 [Source:Xenba... [more]
psmd24.956e-4436.17proteasome 26S subunit, non-ATPase 2 [Source:Xenba... [more]
ARHGAP122.083e-4033.51Rho GTPase activating protein 12 [Source:NCBI gene... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgap151.697e-5131.28Rho GTPase activating protein 15 [Source:MGI Symbo... [more]
Arhgap124.506e-4228.81Rho GTPase activating protein 12 [Source:MGI Symbo... [more]
Arhgap96.694e-4228.21Rho GTPase activating protein 9 [Source:MGI Symbol... [more]
Arhgap96.694e-4228.21Rho GTPase activating protein 9 [Source:MGI Symbol... [more]
Arhgap122.189e-4127.93Rho GTPase activating protein 12 [Source:MGI Symbo... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYC5|RHG15_RAT7.425e-5532.71Rho GTPase-activating protein 15 OS=Rattus norvegi... [more]
sp|A4IF90|RHG15_BOVIN1.750e-5131.59Rho GTPase-activating protein 15 OS=Bos taurus OX=... [more]
sp|Q811M1|RHG15_MOUSE1.187e-5031.28Rho GTPase-activating protein 15 OS=Mus musculus O... [more]
sp|Q53QZ3|RHG15_HUMAN1.130e-4931.29Rho GTPase-activating protein 15 OS=Homo sapiens O... [more]
sp|Q5ZMM3|RHG15_CHICK5.057e-4932.12Rho GTPase-activating protein 15 OS=Gallus gallus ... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y6X08.216e-7633.96Rho GTPase-activating protein 27 OS=Clonorchis sin... [more]
A0A094ZZX61.329e-7533.33Rho GTPase-activating protein 27 OS=Schistosoma ha... [more]
A0A4E0RVI15.179e-7538.67WW domain-containing protein OS=Fasciola hepatica ... [more]
A0A430QP531.841e-7432.97Rho GTPase-activating protein 12/27 (Fragment) OS=... [more]
A0A075AGI74.201e-7433.08Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP96.033e-5031.09Rho GTPase activating protein 9 [Source:HGNC Symbo... [more]
arhgap151.026e-4529.26Rho GTPase activating protein 15 [Source:ZFIN;Acc:... [more]
arhgap151.026e-4529.26Rho GTPase activating protein 15 [Source:ZFIN;Acc:... [more]
arhgap151.026e-4529.26Rho GTPase activating protein 15 [Source:ZFIN;Acc:... [more]
arhgap271.662e-4229.98rho GTPase-activating protein 27 [Source:NCBI gene... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004494.12.522e-5029.72pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-... [more]
ENSPMAT00000004676.12.545e-4628.98pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-... [more]
ARHGAP152.295e-4531.91Rho GTPase activating protein 15 [Source:HGNC Symb... [more]
ENSPMAT00000009729.19.683e-2536.63pep scaffold:Pmarinus_7.0:GL479885:30406:34857:-1 ... [more]
chn22.941e-2128.43chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BEM28.822e-1727.64Rho GTPase activating protein (RhoGAP); involved i... [more]
RGD12.505e-1428.96GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
RGA11.780e-1325.68GTPase-activating protein for polarity-establishme... [more]
RGA25.831e-1226.61GTPase-activating protein for polarity-establishme... [more]
BEM34.662e-927.98Rho GTPase activating protein (RhoGAP); involved i... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494746.100e-4329.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474413.092e-2130.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421763.108e-2030.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382421.739e-1831.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314067.308e-1830.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP93.062e-4831.16Rho GTPase activating protein 9 [Source:NCBI gene;... [more]
arhgap271.864e-4728.41rho GTPase-activating protein 15 [Source:NCBI gene... [more]
ARHGAP92.025e-4629.81Rho GTPase activating protein 9 [Source:NCBI gene;... [more]
ENSORLT00000043698.18.457e-4632.91rho GTPase-activating protein 12 [Source:NCBI gene... [more]
ENSORLT00000041355.12.524e-4532.91rho GTPase-activating protein 12 [Source:NCBI gene... [more]
back to top
BLAST of Rho gtpase activating protein, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074995.10.000e+099.42SMESG000074995.1[more]
SMESG000057671.17.603e-1828.87SMESG000057671.1[more]
SMESG000066507.19.864e-1831.40SMESG000066507.1[more]
SMESG000028956.14.171e-1723.27SMESG000028956.1[more]
SMESG000028956.14.249e-1723.27SMESG000028956.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000646 ID=SMED30000646|Name=Rho gtpase activating protein, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2538bp
TCGGTCATGTTGGAGAACAAAAAGTAAATTTATAATCCAACCAGAAATTG
ATAAAATTTCAATTCCTTAAATATTTAAAATTAATTTCTCATAAATTCTT
AAGATAATAATATATTGAAAATTTATCAATTTCTGGTTGGATTATAAATT
TAATTTTTGTTCTCCAACATGACCGAAAAATATTTTATCGCCAGACATGA
TTATGTTTTAAATAACAATGAAGGAAATCCAATTAACATTTCTGTGGGCA
ACCAATTTATTCTAGTCGAGTATGTCGATAATGAATATGTTAAGTTGAAA
CCAATTGATTTGGATACCTGTAACGACACTGAATTGATTTTACCCAGAAG
AATTGTAGAAGACATGTCACTTCCAATTGCTCGGAAAAATAATCAAATAT
CAAGATCTCAGTCCGCCATTAAAGAACGGATTTGCAGTCTTAATCTAAAT
GATAATGGTTCAAGTTTGTCAGATACTTGTAAATTCAGTTCATTCGGTCA
TGGGACAGCAATTCACGAATCTATTAGATGCATGTCACGATCGTCCTATG
AATCTGACAAAAAAGAGGTCGTGCCCATTGTCAATAAAGTTGAAAATGAA
AACTCAGAAATGATTACAGACACTCCAAGATTGAGACAATCGCATGTAGA
TTCGAATTGGATCAGAACAAATGAGGATGGAACTGATATATTTATCAACG
CGAGTACTAGACAAAGGTGGCGTGCTACAATTGATGATTCTGGCCGTCAG
TATTTTTATGATGAGAAATCAAGGCAATCAGCCTGGAATTTACCAGGACC
AGCACAAATCGCAGAAGATGCAGTTAAACCAATCAAAGATGCTCTTGAAG
GTGTGATTGAATCGTCAGAGAGCGAAGAGGAGGCCGAAACAAAGGAAGAA
AGTGATTTCTGGGATAGTGATGCTAGTCAACACGAGGATGAGAATATCAA
GGATTCTTTACCCTCAGACAAACCACTTGAAATCCCAGAATCAAATAAAG
ACGACAATTATAAAATTGGAATACGCCATATCAAAAAAGAGCACATCTCT
GGTCCATTATTTAATAAATTAATGAGAACAGAACGTTCAGGATTTGTTGA
AAAGGCAAAAGTCAGTGAAAACGGCAAAGAAGTGTTGAAAAAGTGGATAA
AATTCCACATGGTTTTAACGGGACCAGAATTATTTTTTTACAAAGATCCC
AAGGCAGCTATTCCCAAATCCGGCATGCCACAGGGAAAGTCTGAATTGAA
ATTAAAAATTCAAAATCTTCAATTCACCGAAAAGCTCGACAAAGATAGCA
AAGCCAATGTCGTACAAATGGAAGACACCGGAGCTCCTGGATCGAACATA
ACCTACCTTTTAAAGTTCCCTTCGCCCGAAGACATGAAAATTTGGCTCAT
AGCATTACAATATGCGAAAGATTGGAAACAAGAAGATATGTATTCAGAAA
AAGCCAGCACTGTTGTAGTGACATCGGACAAAAAACTTTTGGACGCTGCC
TGCATTGACGATTCCTCCGGCGATAAACAGAATATCAAAATAATCTTGAA
GCAATTTCTCAAAAGACGACCGTCGCCAGAGAGCCTTGAAGCTCGTGGCA
TTTTAAAACCTGAAGCAGTGTTCGGATCGAGTTTGGAGATTTTGTGTGAT
CAGGAAAAGAATAAAGTCCCGGAATTTGTCTACCGCTGTGTTCTGGCAAT
CGAAGCCCGAGGATTACACCATAGCGGTATTTATCGGGTCAGTGGAAATC
AGGCAAAAATTCAAAAGTTGCGCTTAGCAGTCGATGAGAATAAGTATCAA
TTGAACTCCGAATTCATGGAATTAGAGACTTTGACTGGAGCATTCAAATT
ATTCTTCAAAGAATTAAAGCAGCCATTATTAGATGAAGAATTGTGCTCAA
AATTAATTGATTTGTTATCGAATAGGAAAGTCGACAAAAAGAATACCTAC
AAAGATATTAATGTGAGTACTGCCAAGAAGTTGATATCTAAGATGAAACC
TTCACACTATGAAACCTCAAAAGCTTTATTTGGACACTTGAAAAAGGTTG
CGGGGCAATCATCTAAAAACTATATGGATATTAGTAACATCTCCATGGTG
TGGGGTCCGAACCTTTATTCATCGAGCGGGCAGGCCTCAACCAAAATGGC
AGTATTATTGATGACTCACAACCAAATAGTTGACTTCCTTATTACTCGCT
ACTCAGAATTATTTGAAGGATCCTCGAAACAAACCTGATCAATTAAAACA
TTCAACTCATGATTTATATCTCGAACAGGTTTTGCCGTTGCCATCGGCCT
GTAAATAATTGTGATCGTTCGCAACATGAATATTTTCGTTATTTTCTACT
CAATAAATACTAGTCCTTCTTTATTTTCATAATCCGTGCGCTGCCTTTGT
TTAAATTCAATGCCGATTTCATGGCGGATGATAATCTGAATTGATTGGTG
GATCTGAATTATTGATTTGATTCTGATCGGTTTTTTGCCCGCTTTCATTT
TTAAAAATCGTTATGTAACAATTAAAATTGAATTCACT
back to top

protein sequence of SMED30000646-orf-1

>SMED30000646-orf-1 ID=SMED30000646-orf-1|Name=SMED30000646-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=690bp
MTEKYFIARHDYVLNNNEGNPINISVGNQFILVEYVDNEYVKLKPIDLDT
CNDTELILPRRIVEDMSLPIARKNNQISRSQSAIKERICSLNLNDNGSSL
SDTCKFSSFGHGTAIHESIRCMSRSSYESDKKEVVPIVNKVENENSEMIT
DTPRLRQSHVDSNWIRTNEDGTDIFINASTRQRWRATIDDSGRQYFYDEK
SRQSAWNLPGPAQIAEDAVKPIKDALEGVIESSESEEEAETKEESDFWDS
DASQHEDENIKDSLPSDKPLEIPESNKDDNYKIGIRHIKKEHISGPLFNK
LMRTERSGFVEKAKVSENGKEVLKKWIKFHMVLTGPELFFYKDPKAAIPK
SGMPQGKSELKLKIQNLQFTEKLDKDSKANVVQMEDTGAPGSNITYLLKF
PSPEDMKIWLIALQYAKDWKQEDMYSEKASTVVVTSDKKLLDAACIDDSS
GDKQNIKIILKQFLKRRPSPESLEARGILKPEAVFGSSLEILCDQEKNKV
PEFVYRCVLAIEARGLHHSGIYRVSGNQAKIQKLRLAVDENKYQLNSEFM
ELETLTGAFKLFFKELKQPLLDEELCSKLIDLLSNRKVDKKNTYKDINVS
TAKKLISKMKPSHYETSKALFGHLKKVAGQSSKNYMDISNISMVWGPNLY
SSSGQASTKMAVLLMTHNQIVDFLITRYSELFEGSSKQT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036020WW_dom_sf
IPR000198RhoGAP_dom
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR001202WW_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 498..679
e-value: 1.4E-44
score: 164.1
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 501..653
e-value: 2.3E-36
score: 124.9
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 487..682
score: 36.657
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 304..420
e-value: 8.5E-6
score: 35.3
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 305..416
e-value: 5.6E-9
score: 36.4
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 303..418
score: 9.987
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 465..684
e-value: 1.3E-54
score: 186.7
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 482..682
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 299..419
e-value: 2.1E-14
score: 55.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 246..277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 231..245
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 230..277
NoneNo IPR availablePANTHERPTHR23176:SF104RHO GTPASE-ACTIVATING PROTEIN 27coord: 150..683
NoneNo IPR availablePANTHERPTHR23176RHO/RAC/CDC GTPASE-ACTIVATING PROTEINcoord: 150..683
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 304..426
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 178..211
score: 11.25
IPR001202WW domainCDDcd00201WWcoord: 184..209
e-value: 0.00259374
score: 33.6554
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 183..213