Kinesin protein

Overview
NameKinesin protein
Smed IDSMED30000644
Length (bp)5128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin protein (SMED30000644) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin protein (SMED30000644) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin protein (SMED30000644) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin protein (SMED30000644) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000644

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000644h1SMcG0010923 dd_Smed_v4_7196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000644h1SMcG0010923 dd_Smed_v4_7196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000644h1SMcG0010923 dd_Smed_v4_7196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30000644h1SMcG0010923 Contig51077uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000644h1SMcG0010923 Contig51077newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30000644h1SMcG0010923 dd_Smed_v4_7196_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30000644h1SMcG0010923 dd_Smed_v4_7196_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21A (kinesin family member 21A [Source:HGNC Symbol;Acc:HGNC:19349])

HSP 1 Score: 537.339 bits (1383), Expect = 1.111e-161
Identity = 269/458 (58.73%), Postives = 357/458 (77.95%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   ++GII R V++LF  I++ +    K  LP PDFK+ AQFLELYNEE++DL D     D K KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      D+  D+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL++R  Q+++++
Sbjct:    7 ESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYIQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKHLFKSIEEKKHIAIKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQIDADNATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRSRITQLVSDQ 460          

HSP 2 Score: 315.079 bits (806), Expect = 2.625e-86
Identity = 160/362 (44.20%), Postives = 221/362 (61.05%), Query Frame = 2
Query: 3854 NQENVFKRLTSTR--SSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            N+ NVF RLT ++  +S    KG I        +    PLQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG    G    + TSR    P GEN I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+L +    L SGSRD  IKKWDL     +     AH+DW+ AL    D    LSGCR G+LK+WN +    +G+++ H+S I A+  +S  IF+A+ D  V+IWK RNL D
Sbjct: 1262 NELNVFNRLTVSQGNTSVQQDKGIINPFPASKGIRA-FPLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKARNLQD 1621          

HSP 3 Score: 217.624 bits (553), Expect = 4.179e-56
Identity = 146/416 (35.10%), Postives = 246/416 (59.13%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNP--------------------------PVTVKSQSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVY----EMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KV++EYE+KL  +  EL +LQ A++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++      +S+   P                          PV  + Q+ P P  +  R             ++K  R KW  +E  +   I+++ TI++ E DMN  +K+RE+L  + +KL  RR +  K+    D+ V     EM+++ + I+ + + IS+CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  634 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQAMNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPV-ARVQALPTPATNGNRKKYQRKGLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKRREKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1048          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21A (kinesin family member 21A [Source:HGNC Symbol;Acc:HGNC:19349])

HSP 1 Score: 536.954 bits (1382), Expect = 1.198e-161
Identity = 269/458 (58.73%), Postives = 357/458 (77.95%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   ++GII R V++LF  I++ +    K  LP PDFK+ AQFLELYNEE++DL D     D K KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      D+  D+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL++R  Q+++++
Sbjct:    7 ESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYIQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKHLFKSIEEKKHIAIKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQIDADNATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRSRITQLVSDQ 460          

HSP 2 Score: 314.694 bits (805), Expect = 3.237e-86
Identity = 160/362 (44.20%), Postives = 221/362 (61.05%), Query Frame = 2
Query: 3854 NQENVFKRLTSTR--SSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            N+ NVF RLT ++  +S    KG I        +    PLQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG    G    + TSR    P GEN I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+L +    L SGSRD  IKKWDL     +     AH+DW+ AL    D    LSGCR G+LK+WN +    +G+++ H+S I A+  +S  IF+A+ D  V+IWK RNL D
Sbjct: 1246 NELNVFNRLTVSQGNTSVQQDKGIINPFPASKGIRA-FPLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKARNLQD 1605          

HSP 3 Score: 192.2 bits (487), Expect = 2.488e-48
Identity = 133/392 (33.93%), Postives = 230/392 (58.67%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLAD-----NQIRNLEQEKMRK-NQILKRKQEEVEALRRRQHVIGTNISKS------RQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVY----EMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KV++EYE+KL  +  EL +LQ A++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D      Q+R +  +   K  + L       +        + T+ S++      R  V    + P        K   +  +     ++K  R KW  +E  +   I+++ TI++ E DMN  +K+RE+L  + +KL  RR +  K+    D+ V     EM+++ + I+ + + IS+CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  634 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQAMNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDVTALRRQVRPMSDKVAGKVTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPVARVQALPTPATNGNRKKYQRKGLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKRREKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1025          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21A (kinesin family member 21A [Source:HGNC Symbol;Acc:HGNC:19349])

HSP 1 Score: 537.339 bits (1383), Expect = 2.252e-161
Identity = 269/458 (58.73%), Postives = 357/458 (77.95%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   ++GII R V++LF  I++ +    K  LP PDFK+ AQFLELYNEE++DL D     D K KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      D+  D+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL++R  Q+++++
Sbjct:    7 ESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYIQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKHLFKSIEEKKHIAIKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQIDADNATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRSRITQLVSDQ 460          

HSP 2 Score: 307.76 bits (787), Expect = 5.542e-84
Identity = 149/324 (45.99%), Postives = 205/324 (63.27%), Query Frame = 2
Query: 3962 PLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            PLQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG    G    + TSR    P GEN I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+L +    L SGSRD  IKKWDL     +     AH+DW+ AL    D    LSGCR G+LK+WN +    +G+++ H+S I A+  +S  IF+A+ D  V+IWK RNL D
Sbjct: 1336 PLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKARNLQD 1658          

HSP 3 Score: 216.853 bits (551), Expect = 6.841e-56
Identity = 146/416 (35.10%), Postives = 246/416 (59.13%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNP--------------------------PVTVKSQSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVY----EMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KV++EYE+KL  +  EL +LQ A++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++      +S+   P                          PV  + Q+ P P  +  R             ++K  R KW  +E  +   I+++ TI++ E DMN  +K+RE+L  + +KL  RR +  K+    D+ V     EM+++ + I+ + + IS+CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  647 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQAMNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPV-ARVQALPTPATNGNRKKYQRKGLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKRREKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1061          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21A (kinesin family member 21A [Source:HGNC Symbol;Acc:HGNC:19349])

HSP 1 Score: 536.954 bits (1382), Expect = 2.263e-161
Identity = 269/458 (58.73%), Postives = 357/458 (77.95%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   ++GII R V++LF  I++ +    K  LP PDFK+ AQFLELYNEE++DL D     D K KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      D+  D+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL++R  Q+++++
Sbjct:    7 ESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYIQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKHLFKSIEEKKHIAIKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQIDADNATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRSRITQLVSDQ 460          

HSP 2 Score: 307.76 bits (787), Expect = 5.266e-84
Identity = 149/324 (45.99%), Postives = 205/324 (63.27%), Query Frame = 2
Query: 3962 PLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            PLQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG    G    + TSR    P GEN I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+L +    L SGSRD  IKKWDL     +     AH+DW+ AL    D    LSGCR G+LK+WN +    +G+++ H+S I A+  +S  IF+A+ D  V+IWK RNL D
Sbjct: 1323 PLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKARNLQD 1645          

HSP 3 Score: 217.238 bits (552), Expect = 4.979e-56
Identity = 146/416 (35.10%), Postives = 246/416 (59.13%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNP--------------------------PVTVKSQSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVY----EMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KV++EYE+KL  +  EL +LQ A++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++      +S+   P                          PV  + Q+ P P  +  R             ++K  R KW  +E  +   I+++ TI++ E DMN  +K+RE+L  + +KL  RR +  K+    D+ V     EM+++ + I+ + + IS+CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  634 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQAMNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPV-ARVQALPTPATNGNRKKYQRKGLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKRREKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1048          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21A (kinesin family member 21A [Source:HGNC Symbol;Acc:HGNC:19349])

HSP 1 Score: 535.028 bits (1377), Expect = 9.280e-161
Identity = 268/455 (58.90%), Postives = 354/455 (77.80%), Query Frame = 2
Query:  182 VKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            V+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   ++GII R V++LF  I++ +    K  LP PDFK+ AQFLELYNEE++DL D     D K KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      D+  D+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL++R  Q+++++
Sbjct:    1 VRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYIQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKHLFKSIEEKKHIAIKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQIDADNATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRSRITQLVSDQ 451          

HSP 2 Score: 307.76 bits (787), Expect = 4.485e-84
Identity = 149/324 (45.99%), Postives = 205/324 (63.27%), Query Frame = 2
Query: 3962 PLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            PLQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG    G    + TSR    P GEN I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+L +    L SGSRD  IKKWDL     +     AH+DW+ AL    D    LSGCR G+LK+WN +    +G+++ H+S I A+  +S  IF+A+ D  V+IWK RNL D
Sbjct: 1315 PLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKARNLQD 1637          

HSP 3 Score: 217.238 bits (552), Expect = 5.115e-56
Identity = 146/416 (35.10%), Postives = 246/416 (59.13%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNP--------------------------PVTVKSQSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVY----EMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KV++EYE+KL  +  EL +LQ A++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++      +S+   P                          PV  + Q+ P P  +  R             ++K  R KW  +E  +   I+++ TI++ E DMN  +K+RE+L  + +KL  RR +  K+    D+ V     EM+++ + I+ + + IS+CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  625 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQAMNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPV-ARVQALPTPATNGNRKKYQRKGLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKRREKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1039          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-12 (Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc:B3GWD7])

HSP 1 Score: 439.499 bits (1129), Expect = 5.388e-128
Identity = 236/456 (51.75%), Postives = 327/456 (71.71%), Query Frame = 2
Query:  170 SDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFD--ISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGET-ETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFN 1528
            +D  V+VA+R+RPQ  RE+++ +++C SV PN+PQ+ IG D++FTYD VF++ + Q  ++ +  + L+DG  +GYNAT+LAYGQTGSGKT TMG+ FD  ++    D+G+IPR +Q+ F +I + +    ++ L  P F++  QF+ELYN++++DLL     +   S I+IHE++ G I L GV  R V  +  T+  LK+G L R+ A+TNMN  SSRSHAIFTLH+KQQR+  + LD++   +T E + E L AKFHFVDLAGSER+KRTGATG+RAKEGISIN GLLALGNVI+ LG    +  HVPYR+SKLTRLLQDSLGGNS+T+MIAC SPSD DF+ETLNT+ YANRA+ IKNK+  NQDK+SK +  +R +I +L+AELLE++Q    G+++ D       +D Y EN  L SE    R ++KAL+ET++ L+  N  + A++E FN
Sbjct:    2 ADTCVQVALRIRPQGNREKLEGSRVCTSVLPNDPQVTIGGDRSFTYDHVFDMPTLQYVVYESCVEKLVDGLFDGYNATVLAYGQTGSGKTHTMGTAFDAAVTQKEEDLGVIPRAIQHTFRKIAECKAQAIEQGLLEPAFEVSVQFVELYNDDVLDLLSDD--RSMSSSIRIHEDSRGEIVLHGVEQRSVFDMHGTMDILKNGALNRTVAATNMNEQSSRSHAIFTLHLKQQRVAANPLDESGEQKTGELEMEMLCAKFHFVDLAGSERMKRTGATGDRAKEGISINVGLLALGNVIAALGGANGKVSHVPYRDSKLTRLLQDSLGGNSRTLMIACCSPSDSDFVETLNTMKYANRAKEIKNKVVANQDKSSKMIGELRSRIAALEAELLEFKQ----GRRTVDVDGHEVVNDQYHENVYLTSEVNHLRFRVKALNETLDILRTENIDLKAKQE-FN 450          

HSP 2 Score: 162.925 bits (411), Expect = 7.146e-40
Identity = 108/326 (33.13%), Postives = 168/326 (51.53%), Query Frame = 2
Query: 3986 DGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIR--DCKKCIKTLWSSGLSQDGPP-EFSQT-SRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAP---VMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVES-LALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTH--FLSGCRSGVLKLWNTENCAYIGDVQ----AHESGITALKXXXXXXXXXXXDCKVKIWKRN 4921
            +GH + +L +DV++ +++TGSKDR AK+WD+    EI +L  H N+V  VK    +N  FT   F  + WD R  +C  C+K L SSG   +G   + SQ   RQ   P  E  I        G  +F + +  V++W++R +  +G+L+    +P   V  L  +     S    TGS+DHY+K +EV  G+ G+I    E  PPHYD V + L LN   L + S+D  I K+ L   +      +AH+ +IQ+L     K     +S C+ G ++ W+  + + +  V+    AH+ GI  + S+   +F+AS D  V  WK N
Sbjct: 1256 EGHARGVLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIHPNNVHLVKFVPFSNYVFTFSMFEARAWDYRTPEC-ICVKVLNSSGQVNEGDSIDVSQVMPRQNTIPFLETLITAADVDPTGQLLFTSFSAYVRVWNLREWKPLGRLNAASHSPKSEVSCLRTTMTPEGSILAYTGSRDHYVKEYEVGLGT-GVIESKCEFTPPHYDNVTAVLPLNGH-LYTASKDVNIMKFSLKDGKREHLELRAHQQYIQSLTGFGPKGKELLVSACKDGTIRFWDVGSSSRMKLVEEYSKAHQEGINDMCSTKSMLFTASGDSTVGFWKSN 1578          

HSP 3 Score: 126.331 bits (316), Expect = 1.167e-28
Identity = 109/420 (25.95%), Postives = 213/420 (50.71%), Query Frame = 2
Query: 2042 LHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVV---SAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSE----YAKDG-------------RTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNC-SLDEAQYLLEQVYQLAVNKGILAQTL--EMQENGLKF-QLEAKFQEREQAL 3229
            L   L+ +  E+D+K++LI +L+  ++Q ++IR+ YE +L  L  +IK+TE ERD+VL N G     N E+++ +K EYE K+++L+ EL +++   +EH  ++   QR+  E   L+ E+ +LK  KV+L KK+ E+ K+ +  +    +      K+ RL  N+IR LE +  ++ Q LK+  +EV ALR+ + V      ++ +      +A +N P           +  ++  +  AK ++ KW+ I   ++++  RR  +   E ++   + ER  + ++  + E + ++      +DG                D+I Y+ K      +  ++  +    N   ++    ++++  +   C +L EA+YLL+ ++ L ++K  LA  +  E +E   +  QLE +   +EQ L
Sbjct:  598 LQIDLSEVMIELDIKEKLIDQLERAERQNQQIRETYEKKLRELMERIKDTETERDRVL-NEGGKRGGNNEQMKAIKQEYELKITDLRKELKKIEALDKEHLKVIAKSQRELQEKTRLKSEVVDLKKAKVELIKKMNEDKKKQKTQQLANARAFATKEKQTRLQANKIRTLEMKDKQREQFLKKTTQEVNALRKEKAVAAATARQANRGTPRGGAAVTNSPARRVRGVVGGVQ-AIKELAFSAKASKVKWDVIVRKIEESARRRQIVQKMEAELERYLNERHAVMVEIVENEKQFTQSQDVIYRDGLLEAIDSAKQKLQYVQDQITYQQK---LICDVDEDITASNAENEPILDVGLKKQTIKQLFDGCDTLSEARYLLQHLFDLCIDKAALAAKVESEFKECAARIEQLEQQSSLKEQLL 1012          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-12 (Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc:B3GWD7])

HSP 1 Score: 439.499 bits (1129), Expect = 7.520e-128
Identity = 236/456 (51.75%), Postives = 327/456 (71.71%), Query Frame = 2
Query:  170 SDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFD--ISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGET-ETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFN 1528
            +D  V+VA+R+RPQ  RE+++ +++C SV PN+PQ+ IG D++FTYD VF++ + Q  ++ +  + L+DG  +GYNAT+LAYGQTGSGKT TMG+ FD  ++    D+G+IPR +Q+ F +I + +    ++ L  P F++  QF+ELYN++++DLL     +   S I+IHE++ G I L GV  R V  +  T+  LK+G L R+ A+TNMN  SSRSHAIFTLH+KQQR+  + LD++   +T E + E L AKFHFVDLAGSER+KRTGATG+RAKEGISIN GLLALGNVI+ LG    +  HVPYR+SKLTRLLQDSLGGNS+T+MIAC SPSD DF+ETLNT+ YANRA+ IKNK+  NQDK+SK +  +R +I +L+AELLE++Q    G+++ D       +D Y EN  L SE    R ++KAL+ET++ L+  N  + A++E FN
Sbjct:    2 ADTCVQVALRIRPQGNREKLEGSRVCTSVLPNDPQVTIGGDRSFTYDHVFDMPTLQYVVYESCVEKLVDGLFDGYNATVLAYGQTGSGKTHTMGTAFDAAVTQKEEDLGVIPRAIQHTFRKIAECKAQAIEQGLLEPAFEVSVQFVELYNDDVLDLLSDD--RSMSSSIRIHEDSRGEIVLHGVEQRSVFDMHGTMDILKNGALNRTVAATNMNEQSSRSHAIFTLHLKQQRVAANPLDESGEQKTGELEMEMLCAKFHFVDLAGSERMKRTGATGDRAKEGISINVGLLALGNVIAALGGANGKVSHVPYRDSKLTRLLQDSLGGNSRTLMIACCSPSDSDFVETLNTMKYANRAKEIKNKVVANQDKSSKMIGELRSRIAALEAELLEFKQ----GRRTVDVDGHEVVNDQYHENVYLTSEVNHLRFRVKALNETLDILRTENIDLKAKQE-FN 450          

HSP 2 Score: 162.925 bits (411), Expect = 8.366e-40
Identity = 108/326 (33.13%), Postives = 168/326 (51.53%), Query Frame = 2
Query: 3986 DGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIR--DCKKCIKTLWSSGLSQDGPP-EFSQT-SRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAP---VMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVES-LALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTH--FLSGCRSGVLKLWNTENCAYIGDVQ----AHESGITALKXXXXXXXXXXXDCKVKIWKRN 4921
            +GH + +L +DV++ +++TGSKDR AK+WD+    EI +L  H N+V  VK    +N  FT   F  + WD R  +C  C+K L SSG   +G   + SQ   RQ   P  E  I        G  +F + +  V++W++R +  +G+L+    +P   V  L  +     S    TGS+DHY+K +EV  G+ G+I    E  PPHYD V + L LN   L + S+D  I K+ L   +      +AH+ +IQ+L     K     +S C+ G ++ W+  + + +  V+    AH+ GI  + S+   +F+AS D  V  WK N
Sbjct: 1281 EGHARGVLSVDVNEKLMVTGSKDRTAKLWDIEACREIRTLGIHPNNVHLVKFVPFSNYVFTFSMFEARAWDYRTPEC-ICVKVLNSSGQVNEGDSIDVSQVMPRQNTIPFLETLITAADVDPTGQLLFTSFSAYVRVWNLREWKPLGRLNAASHSPKSEVSCLRTTMTPEGSILAYTGSRDHYVKEYEVGLGT-GVIESKCEFTPPHYDNVTAVLPLNGH-LYTASKDVNIMKFSLKDGKREHLELRAHQQYIQSLTGFGPKGKELLVSACKDGTIRFWDVGSSSRMKLVEEYSKAHQEGINDMCSTKSMLFTASGDSTVGFWKSN 1603          

HSP 3 Score: 126.331 bits (316), Expect = 1.073e-28
Identity = 109/420 (25.95%), Postives = 213/420 (50.71%), Query Frame = 2
Query: 2042 LHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVV---SAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSE----YAKDG-------------RTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNC-SLDEAQYLLEQVYQLAVNKGILAQTL--EMQENGLKF-QLEAKFQEREQAL 3229
            L   L+ +  E+D+K++LI +L+  ++Q ++IR+ YE +L  L  +IK+TE ERD+VL N G     N E+++ +K EYE K+++L+ EL +++   +EH  ++   QR+  E   L+ E+ +LK  KV+L KK+ E+ K+ +  +    +      K+ RL  N+IR LE +  ++ Q LK+  +EV ALR+ + V      ++ +      +A +N P           +  ++  +  AK ++ KW+ I   ++++  RR  +   E ++   + ER  + ++  + E + ++      +DG                D+I Y+ K      +  ++  +    N   ++    ++++  +   C +L EA+YLL+ ++ L ++K  LA  +  E +E   +  QLE +   +EQ L
Sbjct:  598 LQIDLSEVMIELDIKEKLIDQLERAERQNQQIRETYEKKLRELMERIKDTETERDRVL-NEGGKRGGNNEQMKAIKQEYELKITDLRKELKKIEALDKEHLKVIAKSQRELQEKTRLKSEVVDLKKAKVELIKKMNEDKKKQKTQQLANARAFATKEKQTRLQANKIRTLEMKDKQREQFLKKTTQEVNALRKEKAVAAATARQANRGTPRGGAAVTNSPARRVRGVVGGVQ-AIKELAFSAKASKVKWDVIVRKIEESARRRQIVQKMEAELERYLNERHAVMVEIVENEKQFTQSQDVIYRDGLLEAIDSAKQKLQYVQDQITYQQK---LICDVDEDITASNAENEPILDVGLKKQTIKQLFDGCDTLSEARYLLQHLFDLCIDKAALAAKVESEFKECAARIEQLEQQSSLKEQLL 1012          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-19 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:O45935])

HSP 1 Score: 277.33 bits (708), Expect = 2.479e-76
Identity = 170/394 (43.15%), Postives = 231/394 (58.63%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPD-FKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIH--ENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQ 1339
            SSDAS++V VR RP N RE  +    C     N  QI I +   FT+D VF   S Q+ ++ T A PL+D    G+NAT+LAYGQTGSGKT+TMG+  ++  D +  GIIPR V  LF RI  + T+        P+ F +     E+Y + + DLL     +  K  + +H  E     + LT V    V  L+  LK L  G   R+ A T MN+ SSRSHA+FT+ +++                E D    +AK   VDLAGSERLK+T A G R KEGI+IN GLL L  VI+ L  K K   H+PYRNS +TR+LQDSLGGNS T+ +ACISP+D +  ETLNTL YA+RA+ IKNK  +N++  ++++A ++ Q++ LQ E  + +Q
Sbjct:    2 SSDASLRVVVRARPMNGRETKEGASRCVQFYENTKQIVINESATFTFDAVFADTSDQESVYETTALPLLDRIFAGFNATVLAYGQTGSGKTYTMGTEDNVGTDEMRRGIIPRLVSALFQRI--MNTE-------APESFAVTVSMFEVYGDNVYDLL-----RPDKVKLNVHGDEKNCTVVNLTAVP---VIDLKGALKQLAVGCHYRTKAETAMNAMSSRSHAVFTVFVEK------------TATAECD-SAFSAKLQLVDLAGSERLKKTEAEGNRMKEGININGGLLILSQVIAALATKQK---HIPYRNSVITRVLQDSLGGNSFTVFLACISPADSNSQETLNTLRYADRAKQIKNKPIVNKNPKAEEIAILQAQLKRLQKENADLKQ 362          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 259.61 bits (662), Expect = 4.870e-73
Identity = 164/384 (42.71%), Postives = 223/384 (58.07%), Query Frame = 2
Query:  179 SVKVAVRVRPQNARERMQMNQICASVTPNEPQIYI----GKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQA 1318
            SV+VAVR RP N RE+     +C  +TPN  Q+ +    G  K FT+D  + + S  ++I+N +  PL++  +EGYN T+ AYGQTGSGKTF+M     I       G+IPR   ++F       T+  K       F +   +LE+YNEE+ DLL    G D K  ++I E     +Y+ G+S  +   +    + +  G   R   +T MN  SSRSH+IFT++++              G TET       K + VDLAGSER  +TGATG+R KE   IN  L ALGNVIS L D   +  H+PYR+SKLTRLLQDSLGGN++TIMIAC+SPS  ++ ETL+TL YANRA+NIKNK TIN+D     L   + +I  L++
Sbjct:    4 SVRVAVRCRPFNQREKDLNTTLCVGMTPNVGQVNLNAPDGAAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQG---IETIPAQRGVIPRAFDHIFTAT--ATTENVK-------FLVHCSYLEIYNEEVRDLL----GADNKQKLEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVE--------------GMTETG-SIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSK--HIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQEEIARLKS 354          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 248.054 bits (632), Expect = 1.403e-69
Identity = 156/385 (40.52%), Postives = 219/385 (56.88%), Query Frame = 2
Query:  182 VKVAVRVRPQNARERMQMNQICASVTPNEPQIYI------GKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDV-GIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQ 1315
            VKV VR RP +  E++Q ++I  +    E  + I         + F +D VF+  + Q  ++N  A+P+++  L+GYN TI AYGQTG+GKTFTM       L+ V++ GIIP    ++F+ I K + D          F +   +LE+YNEE+ DLL     KD   +++I E     +Y+  +S   V +       ++ G+  R   +T MN  SSRSHA+FT+ I+  R          NG           K   VDLAGSER  +TGA GER KE   IN  L  LGNVIS+L D   +  H+PYRNSKLTRLLQDSLGGNS+T+MIA + P+  ++ ETL+TL YANRA+NI+N   IN+D    QL   +++IE+L+
Sbjct:    7 VKVVVRCRPISTTEKLQGHKIAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAG----DLEPVEMRGIIPNSFAHIFDHIAKCQHD--------TTFLVRVSYLEIYNEEIRDLL----SKDHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCR----------NGLV------TQGKLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDG--KSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALR 357          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0302039)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 381/939 (40.58%), Postives = 544/939 (57.93%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDI---SLDSVDVGIIPRGVQYLFNRIDKIR---TDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI--DSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESD-EIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANL-GEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRL--LQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEI 2953
            D+SV+VAVR+RPQN+RE + M +IC +VT  EPQI++G DKAFT+D+VF+  S Q +I++   + L+D  L GYNAT+LAYGQTGSGKT+TMG+GFD    S DSV +GIIPR V+++F+ I+++    T         P F +  Q++ELYNE++ DLLD     +K S+ KIHE+  G I ++G S + +    D LK L+ G L R+TAST MN  SSRSHA+FT+ +++QR++    N+ DN       D ETLT+KFHFVDLAGSERLKRT ATGERA+EGISINCGLLALGN IS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ INQD++S+ ++ +R +I +LQ ELLEY+Q    GK   D + +   SD + EN +L SE +  + ++K+L  TI  L  RNA +    +   W               D  SD EI KV+ +Y                M+ + +    +  + E  K   +  +        ++DS +      I   K+         D E     + S S  G   Q ++S  ++V   S + +AEEV                         + L  + ++I+++ +LI +L+    + +++R HYE +L  L  KI+ T+ ERD VLAN+   V   +++ ++KVK +YE K+S +++E+ +LQ A+REH  +   QQ K HE+R+  L+ ELNELK  KV+L KK+ +++ R +  E+ ++KEI QL KE+R   N +  LE +   K QILKRK EEV ALR+ Q        KS Q         P  + S+   +       +    +  R +W ++   +      R  I   E+++   + ERE L  +   +EN ++      R TDE 
Sbjct:   11 DSSVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLD---PFNKNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDN-------DLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKINQDQSSRTISQLRREIAALQLELLEYKQ----GKLIVDCEGNTTISDTFNENKLLLSEIKRLQQRLKSLQSTIATLTQRNADLKTNLDLNKWTS-------------DDNSDVEIAKVVGQY----------------MLEIEELQTKLIESEEHRKQMEIKATTSPRNAKPVYDSDI------ITKAKK---------DLERERELLMSRSLPGIQNQNVSSEETEV--ASSDSEAEEVV------------------------KDLEAIDNDIEMRTKLIEQLELTNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVSTPSKDSLKKVKTDYESKISHMQTEIRKLQNAQREH--IRSKQQLKSHEVRIGTLRNELNELKFAKVKLMKKMSQQSNRHKQEESRKSKEIAQLLKEQRRQKNAVLTLEAKVSAKEQILKRKTEEVIALRKSQR------GKSGQ-------RAPAHLTSKIATL-------DGFSTRSARHRWENLYRNILHAARNRQLITQLEKELERLILEREDLSRELNIMENGQTA----DRQTDEF 839          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0080018)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 381/939 (40.58%), Postives = 544/939 (57.93%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDI---SLDSVDVGIIPRGVQYLFNRIDKIR---TDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI--DSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESD-EIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANL-GEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRL--LQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEI 2953
            D+SV+VAVR+RPQN+RE + M +IC +VT  EPQI++G DKAFT+D+VF+  S Q +I++   + L+D  L GYNAT+LAYGQTGSGKT+TMG+GFD    S DSV +GIIPR V+++F+ I+++    T         P F +  Q++ELYNE++ DLLD     +K S+ KIHE+  G I ++G S + +    D LK L+ G L R+TAST MN  SSRSHA+FT+ +++QR++    N+ DN       D ETLT+KFHFVDLAGSERLKRT ATGERA+EGISINCGLLALGN IS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ INQD++S+ ++ +R +I +LQ ELLEY+Q    GK   D + +   SD + EN +L SE +  + ++K+L  TI  L  RNA +    +   W               D  SD EI KV+ +Y                M+ + +    +  + E  K   +  +        ++DS +      I   K+         D E     + S S  G   Q ++S  ++V   S + +AEEV                         + L  + ++I+++ +LI +L+    + +++R HYE +L  L  KI+ T+ ERD VLAN+   V   +++ ++KVK +YE K+S +++E+ +LQ A+REH  +   QQ K HE+R+  L+ ELNELK  KV+L KK+ +++ R +  E+ ++KEI QL KE+R   N +  LE +   K QILKRK EEV ALR+ Q        KS Q         P  + S+   +       +    +  R +W ++   +      R  I   E+++   + ERE L  +   +EN ++      R TDE 
Sbjct:   11 DSSVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLD---PFNKNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDN-------DLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKINQDQSSRTISQLRREIAALQLELLEYKQ----GKLIVDCEGNTTISDTFNENKLLLSEIKRLQQRLKSLQSTIATLTQRNADLKTNLDLNKWTS-------------DDNSDVEIAKVVGQY----------------MLEIEELQTKLIESEEHRKQMEIKATTSPRNAKPVYDSDI------ITKAKK---------DLERERELLMSRSLPGIQNQNVSSEETEV--ASSDSEAEEVV------------------------KDLEAIDNDIEMRTKLIEQLELTNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVSTPSKDSLKKVKTDYESKISHMQTEIRKLQNAQREH--IRSKQQLKSHEVRIGTLRNELNELKFAKVKLMKKMSQQSNRHKQEESRKSKEIAQLLKEQRRQKNAVLTLEAKVSAKEQILKRKTEEVIALRKSQR------GKSGQ-------RAPAHLTSKIATL-------DGFSTRSARHRWENLYRNILHAARNRQLITQLEKELERLILEREDLSRELNIMENGQTA----DRQTDEF 839          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0302038)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 381/939 (40.58%), Postives = 544/939 (57.93%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDI---SLDSVDVGIIPRGVQYLFNRIDKIR---TDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI--DSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESD-EIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANL-GEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRL--LQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEI 2953
            D+SV+VAVR+RPQN+RE + M +IC +VT  EPQI++G DKAFT+D+VF+  S Q +I++   + L+D  L GYNAT+LAYGQTGSGKT+TMG+GFD    S DSV +GIIPR V+++F+ I+++    T         P F +  Q++ELYNE++ DLLD     +K S+ KIHE+  G I ++G S + +    D LK L+ G L R+TAST MN  SSRSHA+FT+ +++QR++    N+ DN       D ETLT+KFHFVDLAGSERLKRT ATGERA+EGISINCGLLALGN IS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ INQD++S+ ++ +R +I +LQ ELLEY+Q    GK   D + +   SD + EN +L SE +  + ++K+L  TI  L  RNA +    +   W               D  SD EI KV+ +Y                M+ + +    +  + E  K   +  +        ++DS +      I   K+         D E     + S S  G   Q ++S  ++V   S + +AEEV                         + L  + ++I+++ +LI +L+    + +++R HYE +L  L  KI+ T+ ERD VLAN+   V   +++ ++KVK +YE K+S +++E+ +LQ A+REH  +   QQ K HE+R+  L+ ELNELK  KV+L KK+ +++ R +  E+ ++KEI QL KE+R   N +  LE +   K QILKRK EEV ALR+ Q        KS Q         P  + S+   +       +    +  R +W ++   +      R  I   E+++   + ERE L  +   +EN ++      R TDE 
Sbjct:   11 DSSVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLD---PFNKNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDN-------DLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKINQDQSSRTISQLRREIAALQLELLEYKQ----GKLIVDCEGNTTISDTFNENKLLLSEIKRLQQRLKSLQSTIATLTQRNADLKTNLDLNKWTS-------------DDNSDVEIAKVVGQY----------------MLEIEELQTKLIESEEHRKQMEIKATTSPRNAKPVYDSDI------ITKAKK---------DLERERELLMSRSLPGIQNQNVSSEETEV--ASSDSEAEEVV------------------------KDLEAIDNDIEMRTKLIEQLELTNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVSTPSKDSLKKVKTDYESKISHMQTEIRKLQNAQREH--IRSKQQLKSHEVRIGTLRNELNELKFAKVKLMKKMSQQSNRHKQEESRKSKEIAQLLKEQRRQKNAVLTLEAKVSAKEQILKRKTEEVIALRKSQR------GKSGQ-------RAPAHLTSKIATL-------DGFSTRSARHRWENLYRNILHAARNRQLITQLEKELERLILEREDLSRELNIMENGQTA----DRQTDEF 839          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0331642)

HSP 1 Score: 481.871 bits (1239), Expect = 3.083e-147
Identity = 252/461 (54.66%), Postives = 330/461 (71.58%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDI---SLDSVDVGIIPRGVQYLFNRIDKIR---TDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI--DSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNW 1531
            D+SV+VAVR+RPQN+RE + M +IC +VT  EPQI++G DKAFT+D+VF+  S Q +I++   + L+D  L GYNAT+LAYGQTGSGKT+TMG+GFD    S DSV +GIIPR V+++F+ I+++    T         P F +  Q++ELYNE++ DLLD     +K S+ KIHE+  G I ++G S + +    D LK L+ G L R+TAST MN  SSRSHA+FT+ +++QR++    N+ DN       D ETLT+KFHFVDLAGSERLKRT ATGERA+EGISINCGLLALGN IS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ INQD++S+ ++ +R +I +LQ ELLEY+Q    GK   D + +   SD + EN +L SE +  + ++K+L  TI  L  RNA +    +   W
Sbjct:   11 DSSVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLD---PFNKNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDN-------DLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKINQDQSSRTISQLRREIAALQLELLEYKQ----GKLIVDCEGNTTISDTFNENKLLLSEIKRLQQRLKSLQSTIATLTQRNADLKTNLDLNKW 457          

HSP 2 Score: 134.42 bits (337), Expect = 3.682e-31
Identity = 101/303 (33.33%), Postives = 165/303 (54.46%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLG-EVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRL--LQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEI 2953
            L  + ++I+++ +LI +L+    + +++R HYE +L  L  KI+ T+ ERD VLAN+   V   +++ ++KVK +YE K+S +++E+ +LQ A+REH  +   QQ K HE+R+  L+ ELNELK  KV+L KK+ +++ R +  E+ ++KEI QL KE+R   N +  LE +   K QILKRK EEV ALR+ Q        KS Q         P  + S+   +       +    +  R +W ++   +      R  I   E+++   + ERE L  +   +EN ++      R TDE 
Sbjct:  562 LEAIDNDIEMRTKLIEQLELTNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVSTPSKDSLKKVKTDYESKISHMQTEIRKLQNAQREH--IRSKQQLKSHEVRIGTLRNELNELKFAKVKLMKKMSQQSNRHKQEESRKSKEIAQLLKEQRRQKNAVLTLEAKVSAKEQILKRKTEEVIALRKSQR------GKSGQ-------RAPAHLTSKIATL-------DGFSTRSARHRWENLYRNILHAARNRQLITQLEKELERLILEREDLSRELNIMENGQTA----DRQTDEF 838          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp3A (gene:FBgn0011606 transcript:FBtr0340093)

HSP 1 Score: 269.24 bits (687), Expect = 5.012e-73
Identity = 176/445 (39.55%), Postives = 259/445 (58.20%), Query Frame = 2
Query:  167 SSDAS-VKVAVRVRPQNARERMQMNQICASVTPN-EPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARN 1495
            S D S V VA+RVRP    E  +  +I    + +  PQ+ + +++++TY++VF+I   Q ++F T  +  +   L GYN TILAYGQTGSGKT+TMG+ F+  LD   VG+IPR V  +F  I +++++++        F +   F+ELY E+  DL   +  +DK + + I E     I + G++  +V+S +     L  G+  R+ A+T MN  SSRSHAIFTL      ++ + LD              T++F+ VDLAGSER  +T A+G+R KEG++IN GLLALGNVI+ LG     G ++PYR SKLTRLLQDSLGGNS T+MIAC+SP+D +  ETL+TL YA+RA  IKNK  +N D  + ++  ++  I+ L+ ELL      K+      +    G   I  E ++  S       +I+ L E +  L+ RN
Sbjct:    3 SEDPSCVAVALRVRPLVQSELDRGCRIAVERSADGAPQVTVNRNESYTYNYVFDIDDSQKDLFETCVQAKVKKLLNGYNVTILAYGQTGSGKTYTMGTAFNGVLDD-HVGVIPRAVHDIFTAIAEMQSEFR--------FAVTCSFVELYQEQFYDLFSSK-TRDKAT-VDIRE-VKNRIIMPGLTELVVTSAQQVTDHLIRGSAGRAVAATAMNETSSRSHAIFTLT-----LVATKLDGK--------QSVTTSRFNLVDLAGSERCSKTLASGDRFKEGVNINKGLLALGNVINALGSGQAAG-YIPYRQSKLTRLLQDSLGGNSITLMIACVSPADYNVAETLSTLRYADRALQIKNKPVVNLDPHAAEVNMLKDVIQKLRVELLS---GGKMSSSLISAVGAAGLGAIPCEESLAGSMANAA--EIQRLKEQVRTLQDRN 416          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif21b (kinesin family member 21B [Source:ZFIN;Acc:ZDB-GENE-130530-537])

HSP 1 Score: 541.191 bits (1393), Expect = 2.113e-163
Identity = 270/455 (59.34%), Postives = 352/455 (77.36%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQR------MIDSNLDDNLNGE-TETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVL 1507
            D SVKV++R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFTYDFVF++ + Q +I++     LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+S+   + GIIPR V  LF  I K R + +   +P PDFK+ AQFLELYNEE++DL D     + + +KS+IKIHE+  G IY TGV++RLVSS ++ L+CLK G L R+TAST MN+ SSRSHAIFT+H+ Q R      +++  L+   +G  ++++YETL+AKFHFVDLAGSERLKRTGATGERA+EGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNS+T+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q++A+R +I  LQ E++EY    K GK+ A  +   G+SD++ EN++LQ EN   R+++KA+ ETI+ L  R  Q+L
Sbjct:    6 DCSVKVSLRIRPQMAKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDAHQQQIYSACVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVSVSEDEQGIIPRAVHQLFQGIQKRRLEAQSADIPPPDFKVSAQFLELYNEEILDLFDSTRDPEARGRKSNIKIHEDGSGGIYTTGVTSRLVSSEDELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQPQLVNGELNGVSDGSMSQSEYETLSAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKRAGHVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVIVNQDKTSQQISALRAEIARLQMEIMEY----KAGKRVACDEGSEGFSDLFQENSMLQRENDTLRMRVKAMQETIDHLNTRVTQLL 456          

HSP 2 Score: 302.753 bits (774), Expect = 9.946e-83
Identity = 168/409 (41.08%), Postives = 233/409 (56.97%), Query Frame = 2
Query: 3728 SMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPT--------------KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            S T SL +  ++   D+ +     TPP SP         R  N  NVF RLTS +S  +                +G IT         T  PLQCV++A+GH KP+L LD +D +L TGSKDR  K+W+L    EI +L  H N+V  VK   +++L FTV T +IK+WDIRD  KC++T  SSG    G      T+R      GE  I  IA + +G+ ++ A  N+V+ WD+ R  A GKL G H   VM L           ++TGSKDHY+K+F+V+ G+ G I P+   +PPHYDG+E LA++  +L SGSRD  IKKWDL   + +     AH+DW+ AL F   +   LS CR+G+LK+WN +N   IGD++ H+S I A+ ++S +IF+ASSD +VKIW
Sbjct: 1225 SRTISLPIRGHTLSPDVGY-----TPPPSP-------PLRQRNDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGVITPTGGLKGGRT-APLQCVAMAEGHTKPVLCLDATDELLFTGSKDRTCKMWNLVTGQEIVTLRGHPNNVVSVKYCCNSSLVFTVSTSFIKVWDIRDSAKCVRTFTSSGQVVSGDACAGTTTRTITTAQGEYQINQIALNPSGSVLYAAAGNTVRTWDLNRMQATGKLTG-HIGSVMCLTVGYSAGGKDQVITGSKDHYVKIFDVAEGAQGNIGPAHNFEPPHYDGIECLAVHGDVLFSGSRDNGIKKWDLRQQELIQQIPNAHKDWVCALAFVPGRPMLLSACRAGMLKVWNVDNFTPIGDIKGHDSPINAICTNSKQIFTASSDMRVKIW 1619          

HSP 3 Score: 173.326 bits (438), Expect = 9.825e-43
Identity = 91/193 (47.15%), Postives = 137/193 (70.98%), Query Frame = 2
Query: 2042 LHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR 2620
            L   LA L+ EI++K+RLI EL+  Q++L  ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  KVK+EYE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K+++EE +R R+++  RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR
Sbjct:  660 LQADLADLTCEIEIKQRLIDELENSQRRLLTLKSQYEEKLILLQNKIRDTQLERDRVLHNLMSMENYTEEKASKVKSEYEKRLKEMNRDLLKLQAAQKEHARLLKNQGRYERELKKLQSEVAEMKKAKVALMKQMKEEQQRRRMIDAKRNREIAQLKKEQRRQEYQIRALESQKRQQELVLRRKTQEVTALRR 852          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif21b (kinesin family member 21B [Source:ZFIN;Acc:ZDB-GENE-130530-537])

HSP 1 Score: 529.25 bits (1362), Expect = 1.289e-162
Identity = 262/441 (59.41%), Postives = 339/441 (76.87%), Query Frame = 2
Query:  215 ARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI---QDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSN--LDDNLNG-----ETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVL 1507
            A+E+++   IC SVTP EPQ+ +GKDKAFTYDFVF++ + Q +I++     LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+S+   + GIIPR V  LF  I K R + +   +P PDFK+ AQFLELYNEE++DL D     + + +KS+IKIHE+  G IY TGV++RLVSS ++ L+CLK G L R+TAST MN+ SSRSHAIFT+H+ Q R+      ++  LNG      ++++YETL+AKFHFVDLAGSERLKRTGATGERA+EGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNS+T+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q++A+R +I  LQ E++EY    K GK+ A  +   G+SD++ EN++LQ EN   R+++KA+ ETI+ L  R  Q+L
Sbjct:    2 AKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDAHQQQIYSACVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVSVSEDEQGIIPRAVHQLFQGIQKRRLEAQSADIPPPDFKVSAQFLELYNEEILDLFDSTRDPEARGRKSNIKIHEDGSGGIYTTGVTSRLVSSEDELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQPQLVNGELNGVSDGSMSQSEYETLSAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKRAGHVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVIVNQDKTSQQISALRAEIARLQMEIMEY----KAGKRVACDEGSEGFSDLFQENSMLQRENDTLRMRVKAMQETIDHLNTRVTQLL 438          

HSP 2 Score: 166.392 bits (420), Expect = 7.721e-41
Identity = 91/193 (47.15%), Postives = 137/193 (70.98%), Query Frame = 2
Query: 2042 LHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR 2620
            L   LA L+ EI++K+RLI EL+  Q++L  ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  KVK+EYE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K+++EE +R R+++  RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR
Sbjct:  642 LQADLADLTCEIEIKQRLIDELENSQRRLLTLKSQYEEKLILLQNKIRDTQLERDRVLHNLMSMENYTEEKASKVKSEYEKRLKEMNRDLLKLQAAQKEHARLLKNQGRYERELKKLQSEVAEMKKAKVALMKQMKEEQQRRRMIDAKRNREIAQLKKEQRRQEYQIRALESQKRQQELVLRRKTQEVTALRR 834          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif21a (kinesin family member 21A [Source:ZFIN;Acc:ZDB-GENE-110411-237])

HSP 1 Score: 534.643 bits (1376), Expect = 3.118e-161
Identity = 273/464 (58.84%), Postives = 353/464 (76.08%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI---QDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI---------DSNLDDNLNGETET--DYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D++V+VA+R+RPQ A+E+++   IC  V P+EPQ+ +GKDKAFTYD+VF++ S QD I++   + LI+GC EGYNATI AYGQTGSGKT+TMG+GFD+++   D+GIIPR V +LF  I++ R    ++  PVP+FKI AQFLELYNEE++DL D     + + +KSHIKIHE+  G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+HI Q R+          D+  D+ L G +    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNS+T+MIACISPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q++A+R +I  LQ EL+EY    + GK+     EDG    +D++ EN++LQ EN   R+++KA+ E I+A  AR  Q+L+++
Sbjct:    3 DSTVRVALRIRPQLAKEKIEGCHICTFVMPDEPQVVLGKDKAFTYDYVFDMDSTQDNIYSNCTEKLIEGCFEGYNATIFAYGQTGSGKTYTMGTGFDVAIPDEDLGIIPRAVTHLFKGIEQRRQQAAEQSRPVPEFKISAQFLELYNEEVLDLFDTTRDMESRKQKSHIKIHEDASGGIYTVGVTTRNVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHICQIRVCAPADSPPEQDNETDNRLAGSSSEMEEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDRSKRSTHVPYRDSKLTRLLQDSLGGNSRTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQDRASQQISALRTEIARLQMELMEY----RTGKRMVG--EDGLESINDMFHENSMLQVENNNLRMRVKAMQEAIDAQGARLTQLLSQQ 460          

HSP 2 Score: 303.523 bits (776), Expect = 5.562e-83
Identity = 147/317 (46.37%), Postives = 202/317 (63.72%), Query Frame = 2
Query: 3965 LQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            LQCV +A+GH K +L ++ +D+++ TGSKDR  K+W+L    EI SL  H N+V  V+ SSS  L FTV T YIK+WDIRD  KCI+TL SSGL   G    + T+R    P GEN I  I  + +G  ++ A  NSV++WD+RR+   GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G I+P+   +PPHYDG+ESL +    L SGSRD  IKKWDL     +     AHRDW+ AL         LSGCR+GVLKLW+T+  + +G+++ HES I ++ ++S  +F+A+ D  VKIW+
Sbjct: 1264 LQCVHVAEGHSKAVLCVESTDDLMFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVRYSSS--LVFTVSTSYIKVWDIRDSAKCIRTLTSSGLVNTGDMCAASTNRTVTIPAGENQINQIYLNPSGTVLYAAAGNSVRVWDLRRFVCTGKLTG-HLGPVMCLTVDQTGNGQDLVITGSKDHYIKMFDVTEGAMGSISPTHNFEPPHYDGIESLVVQGDCLFSGSRDNGIKKWDLTRKDLLQQVPNAHRDWVCALGVVPASAILLSGCRAGVLKLWHTDTLSPLGEIRGHESPINSISTNSTHLFTAADDRTVKIWR 1577          

HSP 3 Score: 207.994 bits (528), Expect = 2.467e-53
Identity = 135/387 (34.88%), Postives = 244/387 (63.05%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVV---VSAHSNPPV--TVKSQSKPMPKNHVRRNSLL--AKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDE----IVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  Q++L  ++Q YE +L  LQ+KI++T+ ERD+VL ++G VE  +E++ +++K EYE+KLS +  EL +LQ A++EH  +LKNQ + + +L+ LQ +L E+K  KV+L K+++E+ +++R+ E+ RN+EI  L+K++R  ++Q++ LE +K ++  IL+RK EEV ALRR+   I   +++   +          PP   T  S +    + + RR + +   ++ R KW S+E  +   I++R TI++ E DMN  +K+RE+L  +  K+  +R     D    ++    +  E++++ + I+ + + IS+CQ+NI+++EE++ E    D   +I +C+L EA++LL+    +A+NKG+ A   E Q
Sbjct:  656 LANITCEIAIKQKLIDELENSQRRLHTLKQQYEHKLMMLQSKIRDTQLERDRVLHSMGSVESCSEDKTKRIKAEYEKKLSVMNKELQKLQAAQKEHARLLKNQSQYEKQLKKLQLDLTEMKKTKVRLMKQMKEQQEKSRMAESRRNREIATLKKDQRKQEHQLKLLEAQKRQQELILRRKTEEVTALRRQVRPISGKVTRKANLSEPNFDLSHRPPAGRTYGSGAPNGTRLYHRRAAGIYSTRVARGKWQSLERRISDIIMQRMTISNMEADMNRLLKQREELTRRRDKISRKRERLLADDPEVEKHLQPVNEELESLLANIDYINDSISDCQANIMQMEEAKEEGDAVDVSAVISSCTLAEARFLLDHFMSMALNKGLQAAQKESQ 1042          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif21a (kinesin family member 21A [Source:ZFIN;Acc:ZDB-GENE-110411-237])

HSP 1 Score: 523.857 bits (1348), Expect = 6.349e-158
Identity = 268/453 (59.16%), Postives = 345/453 (76.16%), Query Frame = 2
Query:  197 RVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI---QDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI------DSNLDDNLNGETET--DYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++RPQ A+E+++   IC  V P+EPQ+ +GKDKAFTYD+VF++ S QD I++   + LI+GC EGYNATI AYGQTGSGKT+TMG+GFD+++   D+GIIPR V +LF  I++ R    ++  PVP+FKI AQFLELYNEE++DL D     + + +KSHIKIHE+  G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+HI Q R+       D+  D+ L G +    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNS+T+MIACISPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q++A+R +I  LQ EL+EY    + GK+     EDG    +D++ EN++LQ EN   R+++KA+ E I+A  AR  Q+L+++
Sbjct:   15 KIRPQLAKEKIEGCHICTFVMPDEPQVVLGKDKAFTYDYVFDMDSTQDNIYSNCTEKLIEGCFEGYNATIFAYGQTGSGKTYTMGTGFDVAIPDEDLGIIPRAVTHLFKGIEQRRQQAAEQSRPVPEFKISAQFLELYNEEVLDLFDTTRDMESRKQKSHIKIHEDASGGIYTVGVTTRNVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHICQIRVCAPADSQDNETDNRLAGSSSEMEEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDRSKRSTHVPYRDSKLTRLLQDSLGGNSRTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQDRASQQISALRTEIARLQMELMEY----RTGKRMVG--EDGLESINDMFHENSMLQVENNNLRMRVKAMQEAIDAQGARLTQLLSQQ 461          

HSP 2 Score: 295.049 bits (754), Expect = 2.015e-80
Identity = 146/323 (45.20%), Postives = 201/323 (62.23%), Query Frame = 2
Query: 3965 LQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTL------WSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            LQCV +A+GH K +L ++ +D+++ TGSKDR  K+W+L    EI SL  H N+V  V+ SSS  L FTV T YIK+WDIRD  KCI+TL        SGL   G    + T+R    P GEN I  I  + +G  ++ A  NSV++WD+RR+   GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G I+P+   +PPHYDG+ESL +    L SGSRD  IKKWDL     +     AHRDW+ AL         LSGCR+GVLKLW+T+  + +G+++ HES I ++ ++S  +F+A+ D  VKIW+
Sbjct: 1187 LQCVHVAEGHSKAVLCVESTDDLMFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVRYSSS--LVFTVSTSYIKVWDIRDSAKCIRTLTCCYHNLCSGLVNTGDMCAASTNRTVTIPAGENQINQIYLNPSGTVLYAAAGNSVRVWDLRRFVCTGKLTG-HLGPVMCLTVDQTGNGQDLVITGSKDHYIKMFDVTEGAMGSISPTHNFEPPHYDGIESLVVQGDCLFSGSRDNGIKKWDLTRKDLLQQVPNAHRDWVCALGVVPASAILLSGCRAGVLKLWHTDTLSPLGEIRGHESPINSISTNSTHLFTAADDRTVKIWR 1506          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 338.576 bits (867), Expect = 2.785e-95
Identity = 195/432 (45.14%), Postives = 277/432 (64.12%), Query Frame = 2
Query:  182 VKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDS-VDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETI 1474
            V+VA+R RP   +E  +  Q C +  P+EPQ+ +G DKAFT+D+VF+  ++Q+E+FNT   PL+ G  +GY+AT+LAYGQTGSGKTF+MG  +    ++   VG+IPR ++ +F    K RTD         +F +   +LE+YNEE++DLL     KDK   I I E+    I + G++ R V +  + + CL+ G   R+  ST MN+ASSRSHAIFT+ ++Q+R          NG+ +TD   + +K H VDLAGSER K+T A G+R KEGISIN GLL+LGNVIS LGD++K+G  VPYR+SKLTRLLQDSLGGNS T+MIAC+SP+D +  ET+NTL YA+RAR IKNK  +N D  + ++  ++ Q++ LQ  LL  +    +    + S+     S +  +N  LQ +N       + LSE++
Sbjct:   11 VRVALRCRPLVPKEINEGCQCCLNFVPSEPQVIVGNDKAFTFDYVFDPTTEQEEVFNTAVSPLLSGLFKGYHATVLAYGQTGSGKTFSMGGTYTSEQENEPTVGVIPRVIRRIFQEKAK-RTDC--------EFVLAVSYLEIYNEEILDLLCT--SKDKPV-ISIREDPKDGIKIVGLTERDVLNAHEMVCCLEMGNSARTVGSTAMNAASSRSHAIFTISLEQRR----------NGD-KTD--VMVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESKKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNIEETINTLRYADRARKIKNKPVLNVDPRAAEMKRLKQQVQELQVMLLHAR--GGVAPVLSGSEPAENVSKVLEQNRSLQDQNSKLS---RELSESV 412          

HSP 2 Score: 55.8398 bits (133), Expect = 6.019e-7
Identity = 40/195 (20.51%), Postives = 111/195 (56.92%), Query Frame = 2
Query: 2042 LHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEV-TNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRR 2623
            + + L  L+  + +K+  + ++      L+ ++  Y+  +++LQ  +   + E++ ++  L   +  TN+    K+  +  ++L EL+ ++ +L+   ++ + +LK ++     +  L +E+  +KS +VQL +++++++++ R+ +  ++KE++QL+++ R    ++  LE++  ++  +L+RK EE  A  +R
Sbjct:  546 MSKELIELNKVLALKEAFVKKMCQNDSHLEPMQTQYQESIQSLQAAVGSLQKEKEDLVQTLQSAKKDTNQA---KLSEQRRKRLQELEGQMTELKKKLQDQSKLLKLKESSVRNVAKLNQEIQAMKSQRVQLMRQMKDDSEKFRLWKQKKDKEVLQLKEKDRKRQYEMLKLERDFQKQASVLRRKTEEAAAANKR 737          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kif21a (kinesin family member 21A [Source:NCBI gene;Acc:100485713])

HSP 1 Score: 540.036 bits (1390), Expect = 4.002e-164
Identity = 272/457 (59.52%), Postives = 360/457 (78.77%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRM---IDSN-LDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D++V+VA+R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFT+D+VF+I S+Q+EI+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GIIPR V +LF RI++ +    ++ LP PDFK+ AQFLELYNEE++DL D     D ++KKS+I+IHE++ G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+   ID+N LD+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+K+  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+ S+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ETI+AL++R  Q+++++
Sbjct:    7 DSAVRVALRIRPQLAKEKIEGCHICTSVTPGEPQVVLGKDKAFTFDYVFDIDSRQEEIYMQCTEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNISEEEHGIIPRAVTHLFRRIEEKKQFALEQGLPPPDFKVNAQFLELYNEEVLDLFDTTRDIDARNKKSNIRIHEDSSGGIYTVGVTTRNVSSETEMIQCLKIGALSRTTASTQMNVQSSRSHAIFTIHLCQNRVCPKIDNNDLDNRMASESNQINEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKKATHVPYRDSKLTRLLQDSLGGNSQTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRTSQQINALRNEIARLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETIDALRSRITQLMSDQ 459          

HSP 2 Score: 296.59 bits (758), Expect = 7.629e-81
Identity = 144/317 (45.43%), Postives = 199/317 (62.78%), Query Frame = 2
Query: 3965 LQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            LQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG            SR    PPGEN I  IA +  G  ++ A  NSV++WD++R+ + GKL G H  PVM L           +++GSKDHYIK+F+++ G++G ++P+   +PPHYDG+E+L ++   L SGSRD  IKKWDL+    +     AH+DW+ AL         LSGCR G+LKLWN +    IG+++ H+S I A+ ++S  IF+AS D  V+IWK
Sbjct: 1131 LQCIHIAEGHNKAVLCVDATDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVMTWDSCAGSQSRTVTIPPGENQINQIALNPTGTFLYAAAGNSVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQSANGQDLIISGSKDHYIKMFDITEGALGSVSPTYCFEPPHYDGIEALIISGDNLFSGSRDNGIKKWDLSRKDLLQQVPNAHKDWVCALGLVPGCPVLLSGCRGGILKLWNVDTFFAIGEIKGHDSPINAICTNSSHIFTASDDQTVRIWK 1446          

HSP 3 Score: 204.527 bits (519), Expect = 2.814e-52
Identity = 123/335 (36.72%), Postives = 206/335 (61.49%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISK--SRQVV----VSAH-SNPPVTVKS-----QSKP-MP----------------KNHVRR--NSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEM 2965
            LA ++ EI +K++LI EL+  Q++L  ++Q YE +L  LQNKIK+T+ ERD+VL N+G +E   EE+ +K+K EYE+KL  +  EL +LQ A++EH  +LKNQ + + +++ LQ+E+ E+K  KV+L K+++EE ++ RV ET RN+EI QL+K++R  D+Q+R LE +K ++  +L+RK EEV ALRR+   +   ++    R++     ++ H SN P  + S     Q KP +P                K + R+  +S  +K  R KW S+E  +   +++R TI++ E DMN  +K+RE+L  + +K+  +R    K+    D+ ++ +
Sbjct:  539 LANITCEIAIKQKLIDELENSQRRLHTLKQQYEEKLMTLQNKIKDTQLERDRVLQNMGSMETCTEEKAKKIKVEYEKKLQTMNKELQKLQAAQKEHARLLKNQSQYEKQMKKLQQEVVEMKKTKVRLMKQMKEEQEKARVTETRRNREIAQLKKDQRKRDSQLRLLEAQKKQQEVVLRRKTEEVTALRRQVRPMSDRVAGRVGRKISLPEPIAEHISNMPEELDSTKHGLQQKPRIPVARVQPATSTALNGTRKKYQRKGVSSYTSKAARQKWQSLERRITDIVMQRMTISNMEVDMNRLLKQREELTKRKEKVSKKRDRILKESGDADKNIHSL 873          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kif21a (kinesin family member 21A [Source:NCBI gene;Acc:100485713])

HSP 1 Score: 541.191 bits (1393), Expect = 1.026e-163
Identity = 272/457 (59.52%), Postives = 360/457 (78.77%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRM---IDSN-LDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D++V+VA+R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFT+D+VF+I S+Q+EI+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GIIPR V +LF RI++ +    ++ LP PDFK+ AQFLELYNEE++DL D     D ++KKS+I+IHE++ G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+   ID+N LD+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+K+  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+ S+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ETI+AL++R  Q+++++
Sbjct:    7 DSAVRVALRIRPQLAKEKIEGCHICTSVTPGEPQVVLGKDKAFTFDYVFDIDSRQEEIYMQCTEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNISEEEHGIIPRAVTHLFRRIEEKKQFALEQGLPPPDFKVNAQFLELYNEEVLDLFDTTRDIDARNKKSNIRIHEDSSGGIYTVGVTTRNVSSETEMIQCLKIGALSRTTASTQMNVQSSRSHAIFTIHLCQNRVCPKIDNNDLDNRMASESNQINEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKKATHVPYRDSKLTRLLQDSLGGNSQTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRTSQQINALRNEIARLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETIDALRSRITQLMSDQ 459          

HSP 2 Score: 305.449 bits (781), Expect = 1.901e-83
Identity = 155/356 (43.54%), Postives = 216/356 (60.67%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSP--NPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            N++NVF RLT +++       KG I          T + LQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG            SR    PPGEN I  IA +  G  ++ A  NSV++WD++R+ + GKL G H  PVM L           +++GSKDHYIK+F+++ G++G ++P+   +PPHYDG+E+L ++   L SGSRD  IKKWDL+    +     AH+DW+ AL         LSGCR G+LKLWN +    IG+++ H+S I A+ ++S  IF+AS D  V+IWK
Sbjct: 1192 NEKNVFSRLTVSQADTAFQQDKGVINPFPAAKSSKTSL-LQCIHIAEGHNKAVLCVDATDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVMTWDSCAGSQSRTVTIPPGENQINQIALNPTGTFLYAAAGNSVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQSANGQDLIISGSKDHYIKMFDITEGALGSVSPTYCFEPPHYDGIEALIISGDNLFSGSRDNGIKKWDLSRKDLLQQVPNAHKDWVCALGLVPGCPVLLSGCRGGILKLWNVDTFFAIGEIKGHDSPINAICTNSSHIFTASDDQTVRIWK 1545          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kif21a (kinesin family member 21A [Source:NCBI gene;Acc:100485713])

HSP 1 Score: 540.421 bits (1391), Expect = 2.589e-163
Identity = 269/458 (58.73%), Postives = 359/458 (78.38%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D++V+VA+R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFT+D+VF+I S+Q+EI+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GIIPR V +LF RI++ +    ++ LP PDFK+ AQFLELYNEE++DL D     D ++KKS+I+IHE++ G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      +++LD+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+K+  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+ S+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ETI+AL++R  Q+++++
Sbjct:    7 DSAVRVALRIRPQLAKEKIEGCHICTSVTPGEPQVVLGKDKAFTFDYVFDIDSRQEEIYMQCTEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNISEEEHGIIPRAVTHLFRRIEEKKQFALEQGLPPPDFKVNAQFLELYNEEVLDLFDTTRDIDARNKKSNIRIHEDSSGGIYTVGVTTRNVSSETEMIQCLKIGALSRTTASTQMNVQSSRSHAIFTIHLCQNRVCPKIDNENDLDNRMASESNQINEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKKATHVPYRDSKLTRLLQDSLGGNSQTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRTSQQINALRNEIARLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETIDALRSRITQLMSDQ 460          

HSP 2 Score: 298.13 bits (762), Expect = 3.659e-81
Identity = 162/396 (40.91%), Postives = 224/396 (56.57%), Query Frame = 2
Query: 3731 MTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQ-ENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            M  S I SR  +       +    P  SP   RRV  +      +N  ++L      P   K + TSL           LQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG            SR    PPGEN I  IA +  G  ++ A  NSV++WD++R+ + GKL G H  PVM L           +++GSKDHYIK+F+++ G++G ++P+   +PPHYDG+E+L ++   L SGSRD  IKKWDL+    +     AH+DW+ AL         LSGCR G+LKLWN +    IG+++ H+S I A+ ++S  IF+AS D  V+IWK
Sbjct: 1182 MLHSGIPSRTGSISKPVTLTDKRIPEQSPATRRRVYDKGGDKSIKNKEQKLGVINPFP-AAKSSKTSL-----------LQCIHIAEGHNKAVLCVDATDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVMTWDSCAGSQSRTVTIPPGENQINQIALNPTGTFLYAAAGNSVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQSANGQDLIISGSKDHYIKMFDITEGALGSVSPTYCFEPPHYDGIEALIISGDNLFSGSRDNGIKKWDLSRKDLLQQVPNAHKDWVCALGLVPGCPVLLSGCRGGILKLWNVDTFFAIGEIKGHDSPINAICTNSSHIFTASDDQTVRIWK 1564          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kif21a (kinesin family member 21A [Source:NCBI gene;Acc:100485713])

HSP 1 Score: 539.265 bits (1388), Expect = 3.391e-163
Identity = 269/458 (58.73%), Postives = 359/458 (78.38%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D++V+VA+R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFT+D+VF+I S+Q+EI+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GIIPR V +LF RI++ +    ++ LP PDFK+ AQFLELYNEE++DL D     D ++KKS+I+IHE++ G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      +++LD+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+K+  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+ S+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ETI+AL++R  Q+++++
Sbjct:    7 DSAVRVALRIRPQLAKEKIEGCHICTSVTPGEPQVVLGKDKAFTFDYVFDIDSRQEEIYMQCTEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNISEEEHGIIPRAVTHLFRRIEEKKQFALEQGLPPPDFKVNAQFLELYNEEVLDLFDTTRDIDARNKKSNIRIHEDSSGGIYTVGVTTRNVSSETEMIQCLKIGALSRTTASTQMNVQSSRSHAIFTIHLCQNRVCPKIDNENDLDNRMASESNQINEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKKATHVPYRDSKLTRLLQDSLGGNSQTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRTSQQINALRNEIARLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETIDALRSRITQLMSDQ 460          

HSP 2 Score: 297.36 bits (760), Expect = 5.802e-81
Identity = 144/317 (45.43%), Postives = 199/317 (62.78%), Query Frame = 2
Query: 3965 LQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            LQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG            SR    PPGEN I  IA +  G  ++ A  NSV++WD++R+ + GKL G H  PVM L           +++GSKDHYIK+F+++ G++G ++P+   +PPHYDG+E+L ++   L SGSRD  IKKWDL+    +     AH+DW+ AL         LSGCR G+LKLWN +    IG+++ H+S I A+ ++S  IF+AS D  V+IWK
Sbjct: 1211 LQCIHIAEGHNKAVLCVDATDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVMTWDSCAGSQSRTVTIPPGENQINQIALNPTGTFLYAAAGNSVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQSANGQDLIISGSKDHYIKMFDITEGALGSVSPTYCFEPPHYDGIEALIISGDNLFSGSRDNGIKKWDLSRKDLLQQVPNAHKDWVCALGLVPGCPVLLSGCRGGILKLWNVDTFFAIGEIKGHDSPINAICTNSSHIFTASDDQTVRIWK 1526          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kif21a (kinesin family member 21A [Source:NCBI gene;Acc:100485713])

HSP 1 Score: 539.65 bits (1389), Expect = 1.371e-162
Identity = 269/458 (58.73%), Postives = 359/458 (78.38%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D++V+VA+R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFT+D+VF+I S+Q+EI+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GIIPR V +LF RI++ +    ++ LP PDFK+ AQFLELYNEE++DL D     D ++KKS+I+IHE++ G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      +++LD+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+K+  HVPYR+SKLTRLLQDSLGGNSQT+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+ S+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ETI+AL++R  Q+++++
Sbjct:    7 DSAVRVALRIRPQLAKEKIEGCHICTSVTPGEPQVVLGKDKAFTFDYVFDIDSRQEEIYMQCTEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNISEEEHGIIPRAVTHLFRRIEEKKQFALEQGLPPPDFKVNAQFLELYNEEVLDLFDTTRDIDARNKKSNIRIHEDSSGGIYTVGVTTRNVSSETEMIQCLKIGALSRTTASTQMNVQSSRSHAIFTIHLCQNRVCPKIDNENDLDNRMASESNQINEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKKATHVPYRDSKLTRLLQDSLGGNSQTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRTSQQINALRNEIARLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETIDALRSRITQLMSDQ 460          

HSP 2 Score: 305.834 bits (782), Expect = 1.849e-83
Identity = 155/356 (43.54%), Postives = 216/356 (60.67%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSP--NPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            N++NVF RLT +++       KG I          T + LQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG            SR    PPGEN I  IA +  G  ++ A  NSV++WD++R+ + GKL G H  PVM L           +++GSKDHYIK+F+++ G++G ++P+   +PPHYDG+E+L ++   L SGSRD  IKKWDL+    +     AH+DW+ AL         LSGCR G+LKLWN +    IG+++ H+S I A+ ++S  IF+AS D  V+IWK
Sbjct: 1254 NEKNVFSRLTVSQADTAFQQDKGVINPFPAAKSSKTSL-LQCIHIAEGHNKAVLCVDATDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVMTWDSCAGSQSRTVTIPPGENQINQIALNPTGTFLYAAAGNSVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQSANGQDLIISGSKDHYIKMFDITEGALGSVSPTYCFEPPHYDGIEALIISGDNLFSGSRDNGIKKWDLSRKDLLQQVPNAHKDWVCALGLVPGCPVLLSGCRGGILKLWNVDTFFAIGEIKGHDSPINAICTNSSHIFTASDDQTVRIWK 1607          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21a (kinesin family member 21A [Source:MGI Symbol;Acc:MGI:109188])

HSP 1 Score: 541.191 bits (1393), Expect = 8.244e-164
Identity = 272/460 (59.13%), Postives = 359/460 (78.04%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            + ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GII R V++LF  ID+ +T   K  LP P+FK+ AQFLELYNEE++DL D     D K+KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      ++  D+ L  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL+AR  Q+++E+
Sbjct:    5 ADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRARITQLVSEQ 460          

HSP 2 Score: 303.908 bits (777), Expect = 3.871e-83
Identity = 148/324 (45.68%), Postives = 205/324 (63.27%), Query Frame = 2
Query: 3962 PLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            PLQCV IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIR+  KCI+TL SSG    G    + TSR    P GE+ I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+LA+    L SGSRD  IKKWDLA    +     AH+DW+ AL         LSGCR G+LKLWN +    +G+++ H+S I A+  +S  +F+A+ D  V+IWK  NL D
Sbjct: 1235 PLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGVHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRESAKCIRTLTSSGQVTLGEACSASTSRTVAIPSGESQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALAIQGDNLFSGSRDNGIKKWDLAQKGLLQQVPNAHKDWVCALGLVPGHPVLLSGCRGGILKLWNVDTFVPVGEMRGHDSPINAICVNSTHVFTAADDRTVRIWKAHNLQD 1557          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21a (kinesin family member 21A [Source:MGI Symbol;Acc:MGI:109188])

HSP 1 Score: 540.806 bits (1392), Expect = 1.008e-163
Identity = 272/460 (59.13%), Postives = 359/460 (78.04%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            + ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GII R V++LF  ID+ +T   K  LP P+FK+ AQFLELYNEE++DL D     D K+KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      ++  D+ L  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL+AR  Q+++E+
Sbjct:    5 ADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRARITQLVSEQ 460          

HSP 2 Score: 304.294 bits (778), Expect = 2.844e-83
Identity = 153/351 (43.59%), Postives = 213/351 (60.68%), Query Frame = 2
Query: 3896 SPNPTKGTITSLSKKNPLST-----HVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            +P+     I S+   NP          PLQCV IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIR+  KCI+TL SSG    G    + TSR    P GE+ I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+LA+    L SGSRD  IKKWDLA    +     AH+DW+ AL         LSGCR G+LKLWN +    +G+++ H+S I A+  +S  +F+A+ D  V+IWK  NL D
Sbjct: 1202 APSGLPSKIGSIGIINPFPACKGVRASPLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGVHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRESAKCIRTLTSSGQVTLGEACSASTSRTVAIPSGESQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALAIQGDNLFSGSRDNGIKKWDLAQKGLLQQVPNAHKDWVCALGLVPGHPVLLSGCRGGILKLWNVDTFVPVGEMRGHDSPINAICVNSTHVFTAADDRTVRIWKAHNLQD 1551          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21a (kinesin family member 21A [Source:MGI Symbol;Acc:MGI:109188])

HSP 1 Score: 542.732 bits (1397), Expect = 1.453e-163
Identity = 272/460 (59.13%), Postives = 359/460 (78.04%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            + ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GII R V++LF  ID+ +T   K  LP P+FK+ AQFLELYNEE++DL D     D K+KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      ++  D+ L  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL+AR  Q+++E+
Sbjct:    5 ADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRARITQLVSEQ 460          

HSP 2 Score: 306.99 bits (785), Expect = 6.772e-84
Identity = 158/374 (42.25%), Postives = 220/374 (58.82%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSPNPTKGTITSLSKK---------NPLST-----HVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            N+ NVF RLT  + +P+  +                  NP          PLQCV IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIR+  KCI+TL SSG    G    + TSR    P GE+ I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+LA+    L SGSRD  IKKWDLA    +     AH+DW+ AL         LSGCR G+LKLWN +    +G+++ H+S I A+  +S  +F+A+ D  V+IWK  NL D
Sbjct: 1284 NELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHRGIINPFPACKGVRASPLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGVHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRESAKCIRTLTSSGQVTLGEACSASTSRTVAIPSGESQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALAIQGDNLFSGSRDNGIKKWDLAQKGLLQQVPNAHKDWVCALGLVPGHPVLLSGCRGGILKLWNVDTFVPVGEMRGHDSPINAICVNSTHVFTAADDRTVRIWKAHNLQD 1656          

HSP 3 Score: 219.935 bits (559), Expect = 5.397e-57
Identity = 148/415 (35.66%), Postives = 248/415 (59.76%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNIS-KSRQVVVSAHSNPPVTVKS------------------------QSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDE----IVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KVK EYE+KL  +  EL +LQTA++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++ K  + + S+ S  P T  S                        Q+ P P  +  R              +K  R KW  +E  +   I+++ TI++ E DMN  +++RE+L  + +KL  RR +  K+    D+    I+ EM+++ + I+ + + I++CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  649 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVKCEYEKKLHAMNKELQRLQTAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSESPAPDTGSSAASGEADTSRPGTQQKMRIPVARVQALPTPTTNGTRKKYQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELTKRREKLSKRREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1063          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21a (kinesin family member 21A [Source:MGI Symbol;Acc:MGI:109188])

HSP 1 Score: 541.576 bits (1394), Expect = 1.574e-163
Identity = 272/460 (59.13%), Postives = 359/460 (78.04%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            + ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GII R V++LF  ID+ +T   K  LP P+FK+ AQFLELYNEE++DL D     D K+KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      ++  D+ L  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL+AR  Q+++E+
Sbjct:    5 ADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRARITQLVSEQ 460          

HSP 2 Score: 305.449 bits (781), Expect = 1.471e-83
Identity = 160/379 (42.22%), Postives = 224/379 (59.10%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSPNPTKG----------TITSLSKK----NPLST-----HVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            N+ NVF RLT  + +P+  +            + S S +    NP          PLQCV IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIR+  KCI+TL SSG    G    + TSR    P GE+ I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+LA+    L SGSRD  IKKWDLA    +     AH+DW+ AL         LSGCR G+LKLWN +    +G+++ H+S I A+  +S  +F+A+ D  V+IWK  NL D
Sbjct: 1235 NELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHSRSTRRGIINPFPACKGVRASPLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGVHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRESAKCIRTLTSSGQVTLGEACSASTSRTVAIPSGESQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALAIQGDNLFSGSRDNGIKKWDLAQKGLLQQVPNAHKDWVCALGLVPGHPVLLSGCRGGILKLWNVDTFVPVGEMRGHDSPINAICVNSTHVFTAADDRTVRIWKAHNLQD 1612          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21a (kinesin family member 21A [Source:MGI Symbol;Acc:MGI:109188])

HSP 1 Score: 542.347 bits (1396), Expect = 2.081e-163
Identity = 272/460 (59.13%), Postives = 359/460 (78.04%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            + ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GII R V++LF  ID+ +T   K  LP P+FK+ AQFLELYNEE++DL D     D K+KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      ++  D+ L  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL+AR  Q+++E+
Sbjct:    5 ADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRARITQLVSEQ 460          

HSP 2 Score: 306.605 bits (784), Expect = 8.560e-84
Identity = 158/374 (42.25%), Postives = 220/374 (58.82%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSPNPTKGTITSLSKK---------NPLST-----HVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            N+ NVF RLT  + +P+  +                  NP          PLQCV IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIR+  KCI+TL SSG    G    + TSR    P GE+ I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+LA+    L SGSRD  IKKWDLA    +     AH+DW+ AL         LSGCR G+LKLWN +    +G+++ H+S I A+  +S  +F+A+ D  V+IWK  NL D
Sbjct: 1284 NELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHRGIINPFPACKGVRASPLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGVHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRESAKCIRTLTSSGQVTLGEACSASTSRTVAIPSGESQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALAIQGDNLFSGSRDNGIKKWDLAQKGLLQQVPNAHKDWVCALGLVPGHPVLLSGCRGGILKLWNVDTFVPVGEMRGHDSPINAICVNSTHVFTAADDRTVRIWKAHNLQD 1656          

HSP 3 Score: 220.705 bits (561), Expect = 3.467e-57
Identity = 148/415 (35.66%), Postives = 248/415 (59.76%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNIS-KSRQVVVSAHSNPPVTVKS------------------------QSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDE----IVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KVK EYE+KL  +  EL +LQTA++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++ K  + + S+ S  P T  S                        Q+ P P  +  R              +K  R KW  +E  +   I+++ TI++ E DMN  +++RE+L  + +KL  RR +  K+    D+    I+ EM+++ + I+ + + I++CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  649 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVKCEYEKKLHAMNKELQRLQTAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSESPAPDTGSSAASGEADTSRPGTQQKMRIPVARVQALPTPTTNGTRKKYQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELTKRREKLSKRREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1063          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q9QXL2|KI21A_MOUSE (Kinesin-like protein KIF21A OS=Mus musculus OX=10090 GN=Kif21a PE=1 SV=2)

HSP 1 Score: 542.347 bits (1396), Expect = 1.455e-162
Identity = 272/460 (59.13%), Postives = 359/460 (78.04%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            + ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   + GII R V++LF  ID+ +T   K  LP P+FK+ AQFLELYNEE++DL D     D K+KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      ++  D+ L  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL+AR  Q+++E+
Sbjct:    5 ADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRARITQLVSEQ 460          

HSP 2 Score: 306.605 bits (784), Expect = 5.988e-83
Identity = 158/374 (42.25%), Postives = 220/374 (58.82%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSPNPTKGTITSLSKK---------NPLST-----HVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            N+ NVF RLT  + +P+  +                  NP          PLQCV IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIR+  KCI+TL SSG    G    + TSR    P GE+ I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+LA+    L SGSRD  IKKWDLA    +     AH+DW+ AL         LSGCR G+LKLWN +    +G+++ H+S I A+  +S  +F+A+ D  V+IWK  NL D
Sbjct: 1284 NELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHRGIINPFPACKGVRASPLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGVHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRESAKCIRTLTSSGQVTLGEACSASTSRTVAIPSGESQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALAIQGDNLFSGSRDNGIKKWDLAQKGLLQQVPNAHKDWVCALGLVPGHPVLLSGCRGGILKLWNVDTFVPVGEMRGHDSPINAICVNSTHVFTAADDRTVRIWKAHNLQD 1656          

HSP 3 Score: 220.705 bits (561), Expect = 2.425e-56
Identity = 148/415 (35.66%), Postives = 248/415 (59.76%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNIS-KSRQVVVSAHSNPPVTVKS------------------------QSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDE----IVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KVK EYE+KL  +  EL +LQTA++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++ K  + + S+ S  P T  S                        Q+ P P  +  R              +K  R KW  +E  +   I+++ TI++ E DMN  +++RE+L  + +KL  RR +  K+    D+    I+ EM+++ + I+ + + I++CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  649 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVKCEYEKKLHAMNKELQRLQTAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSESPAPDTGSSAASGEADTSRPGTQQKMRIPVARVQALPTPTTNGTRKKYQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELTKRREKLSKRREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1063          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q7Z4S6|KI21A_HUMAN (Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2)

HSP 1 Score: 537.339 bits (1383), Expect = 1.082e-160
Identity = 269/458 (58.73%), Postives = 357/458 (77.95%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE--TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VAVR+RPQ A+E+++   IC SVTP EPQ+++GKDKAFT+D+VF+I S+Q++I+    + LI+GC EGYNAT+ AYGQTG+GKT+TMG+GFD+++   ++GII R V++LF  I++ +    K  LP PDFK+ AQFLELYNEE++DL D     D K KKS+I+IHE++ G IY  GV+TR V++  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      D+  D+ +  E+    ++ETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q+ A+R +I  LQ EL+EY    K GK+  D +     +D++ EN +LQ+EN   R++IKA+ ET++AL++R  Q+++++
Sbjct:    7 ESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYIQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKHLFKSIEEKKHIAIKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQIDADNATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEY----KTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALRSRITQLVSDQ 460          

HSP 2 Score: 307.76 bits (787), Expect = 2.662e-83
Identity = 149/324 (45.99%), Postives = 205/324 (63.27%), Query Frame = 2
Query: 3962 PLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK-RNLPD 4930
            PLQC+ IA+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  VK  + T+L FTV T YIK+WDIRD  KCI+TL SSG    G    + TSR    P GEN I  IA +  G  ++ A+ N+V++WD++R+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G ++P+   +PPHYDG+E+L +    L SGSRD  IKKWDL     +     AH+DW+ AL    D    LSGCR G+LK+WN +    +G+++ H+S I A+  +S  IF+A+ D  V+IWK RNL D
Sbjct: 1336 PLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTG-HLGPVMCLTVDQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKARNLQD 1658          

HSP 3 Score: 216.853 bits (551), Expect = 3.285e-55
Identity = 146/416 (35.10%), Postives = 246/416 (59.13%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNP--------------------------PVTVKSQSKPMPKNHVRRNS----------LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVY----EMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  QK+L+ +++ YE +L  LQ+KI++T+ ERDQVL NLG VE  +EE+ +KV++EYE+KL  +  EL +LQ A++EH  +LKNQ + + +L+ LQ+++ E+K  KV+L K+++EE ++ R+ E+ RN+EI QL+K++R  D+Q+R LE +K  +  +L+RK EEV ALRR+   +   ++      +S+   P                          PV  + Q+ P P  +  R             ++K  R KW  +E  +   I+++ TI++ E DMN  +K+RE+L  + +KL  RR +  K+    D+ V     EM+++ + I+ + + IS+CQ+NI+++EE++ E    D   +I  C+L EA+YLL+    + +NKG+ A   E Q
Sbjct:  647 LANITCEIAIKQKLIDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQAMNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGKVTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPV-ARVQALPTPATNGNRKKYQRKGLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKRREKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQ 1061          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q9QXL1|KI21B_MOUSE (Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2)

HSP 1 Score: 535.798 bits (1379), Expect = 2.760e-160
Identity = 269/459 (58.61%), Postives = 350/459 (76.25%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSN--LDDNLNG------ETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D  VKVAVR+RPQ ++E+++   IC SVTP EPQ+ +GKDKAFTYDFVF++ + Q++I++T    LI+GC EGYNAT+LAYGQTG+GKT+TMG+GFD      + GIIPR + +LF  ID+ +   ++K +  P+FK+ AQFLELYNEE++DL D     D + ++S+IKIHE+  G IY TGV++RL++S E+ ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+      +++ + G       T T+YETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGD++K+  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q++A+R +I  LQ EL+EY    K GK+        GYSD++ EN +LQ EN   RL++KA+ E I+A+  R  Q+++++
Sbjct:    6 DCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDTVTSEEEQGIIPRAIAHLFRGIDERKRRAQEKGVTGPEFKVSAQFLELYNEEILDLFDSTRDPDARHRRSNIKIHEDANGGIYTTGVTSRLINSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCAQPDLVNETVTGLPDGAAPTGTEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEY----KAGKRVIGEDGTEGYSDLFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQE 460          

HSP 2 Score: 308.916 bits (790), Expect = 9.487e-84
Identity = 155/367 (42.23%), Postives = 222/367 (60.49%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSPNPT--------------KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            N  NVF RLTS +S  +                +G IT +       T  PLQC+S+A+GH KPIL LD +D +L TGSKDR  K+W+L    EI++L  H N+V  +K  S + L F+V + YIK+WDIRD  KCI+TL SSG    G    + ++R      GE+ I  +A S +G+ +++A+ N+V++W++ R+  +GKL G H  PVM L  +        +VTGSKDHY+K+F++     G I P+   +PPHYDG+E LA+   IL SGSRD  IKKWDL   + +     AH+DW+ AL F   +   LS CR+G +K+WN +N   IG+++ H+S I A+ ++S  IF+ASSDC+VK+W
Sbjct: 1250 NDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGIITPIGGAKGART-APLQCISMAEGHTKPILCLDATDELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSSSYIKVWDIRDSAKCIRTLTSSGQVISGDACIATSTRAITSAQGEHQINQMALSPSGSMLYVASGNAVRIWELNRFQPIGKLTG-HIGPVMCLTVTQTSNQHDLVVTGSKDHYVKMFQLGDCVTGTIGPTHNFEPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFVPGRPMLLSACRAGFIKVWNVDNFTPIGEIKGHDSPINAICTNSKHIFTASSDCRVKLW 1614          

HSP 3 Score: 201.06 bits (510), Expect = 2.153e-50
Identity = 144/420 (34.29%), Postives = 241/420 (57.38%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR-----RQHVIG------TNISKSRQVVVSAHSN---------------------------PPVTVKSQSKPMPKNHVRRNS--LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRR----SEYAKDGRTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA L+ EI++K++LI EL+  Q++L+ ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  K+K +YE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K++REE +R R+VET RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR      + V G       N+    +V  S  S+                           P  TV    +P  K   ++ +    +K  R KW S+E  +   +++R TI + E DM   +K+RE+L +  + L  +R    +E  ++ +   E+  E++ + + I+ + + I++CQ+ I+++EE++ E   +D   +I +CSL EA+ LL+   + +++KG+     E Q
Sbjct:  637 LADLTCEIEIKQKLIDELENSQRRLQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIAQLKKEQRRQEFQIRALESQKRQQEIVLRRKTQEVSALRRLAKPMSERVAGRVGLKPPNMDSGAEVSASTTSSEAESGARSVSSIVRQWNRKIDHFLGDRPTATVNG-GRPARKKFQKKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRKREHLQAESPEEEKGLQELAEEIEVLAANIDYINDSITDCQATIVQLEETKEELDSTDTSVVISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQ 1055          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|F1M5N7|KI21B_RAT (Kinesin-like protein KIF21B OS=Rattus norvegicus OX=10116 GN=Kif21b PE=1 SV=2)

HSP 1 Score: 535.028 bits (1377), Expect = 3.763e-160
Identity = 272/462 (58.87%), Postives = 351/462 (75.97%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMID---------SNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D  VKVAVR+RPQ ++E+++   IC SVTP EPQ+ +GKDKAFTYDFVF++ + Q++I++T    LI+GC EGYNAT+LAYGQTG+GKT+TMG+GFD      + GIIPR + +LF  ID+ +   +++ +  P+FK+ AQFLELYNEE++DL D     D + ++S+IKIHE+  G IY TGV++RL++S E+ ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+           + L D     T T+YETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGD++K+  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q++A+R +I  LQ EL+EY    K GK+     EDG  GYSD++ EN +LQ EN   RL++KA+ E I+A+  R  Q+++++
Sbjct:    6 DCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDTVTSEEEQGIIPRAIAHLFRGIDERKRRAQEQGVTGPEFKVSAQFLELYNEEILDLFDSTRDPDARHRRSNIKIHEDANGGIYTTGVTSRLINSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCAQPDLVNETVTGLPDG-TAPTGTEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEY----KAGKRVIG--EDGAEGYSDLFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQE 460          

HSP 2 Score: 308.531 bits (789), Expect = 1.150e-83
Identity = 155/367 (42.23%), Postives = 221/367 (60.22%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSPNPT--------------KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            N  NVF RLTS +S  +                +G IT +       T  PLQCVS+A+GH KPIL LD +D +L TGSKDR  K+W+L    EI++L  H N+V  +K  S + L F+V + Y+K+WDIRD  KCI+TL SSG    G    + ++R      GE+ I  +A S +G  +++A+ N+V++W++ R+  +GKL G H  PVM L  +        +VTGSKDHY+K+F++     G I P+   +PPHYDG+E LA+   IL SGSRD  IKKWDL   + +     AH+DW+ AL F   +   LS CR+G +K+WN +N   IG+++ H+S I A+ ++S  IF+ASSDC+VK+W
Sbjct: 1245 NDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGIITPIGGAKGART-APLQCVSMAEGHTKPILCLDATDELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSSSYVKVWDIRDSAKCIRTLTSSGQVISGDACMATSTRAITSSQGEHQINQMALSPSGTMLYVASGNAVRIWELNRFQPIGKLTG-HIGPVMCLTVTQTSNQHDLVVTGSKDHYVKMFQLGDCVTGTIGPTHNFEPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFVPGRPMLLSACRAGFIKVWNVDNFTPIGEIKGHDSPINAICTNSKHIFTASSDCRVKLW 1609          

HSP 3 Score: 201.445 bits (511), Expect = 1.545e-50
Identity = 144/420 (34.29%), Postives = 242/420 (57.62%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR-----RQHVIG------TNISKSRQVVVSAHS---------------------------NPPVTVKSQSKPMPKNHVRRNSL--LAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRR----SEYAKDGRTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA L+ EI++K++LI EL+  Q++L+ ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  K+K +YE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K++REE +R R+VET RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR      + V G       N+    +V  S  S                           +P  TV   ++P  K   ++ +    +K  R KW S+E  +   +++R TI + E DM   +K+RE+L +  + L  +R    +E  ++ +   E+  E++ + + I+ + + I++CQ+ I+++EE++ E   +D   +I +CSL EA+ LL+   + +++KG+     E Q
Sbjct:  632 LADLTCEIEIKQKLIDELENSQRRLQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQSRYERELKKLQTEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIAQLKKEQRRQEFQIRALESQKRQQEIVLRRKTQEVSALRRLAKPMSERVAGRVGLKPPNMDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPTATVNG-ARPARKKFQKKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRKRERLQAESPEEEKGLQELAEEIEVLAANIDYINDSITDCQATIMQLEETKEELDSTDTSVVISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQ 1050          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|O75037|KI21B_HUMAN (Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2)

HSP 1 Score: 532.717 bits (1371), Expect = 2.070e-159
Identity = 269/460 (58.48%), Postives = 352/460 (76.52%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSN--LDDNLNG-----ETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            D  VKVAVR+RPQ ++E+++   IC SVTP EPQ+ +GKDKAFTYDFVF++ + Q++I++T    LI+GC EGYNAT+LAYGQTG+GKT+TMG+GFD++    + GIIPR + +LF  I + +   +++ +  P+FK+ AQFLELYNEE++DL D     D + ++S+IKIHE+  G IY TGV++RL+ S E+ ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q RM      +++ + G        ++YETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGD++K+  HVPYR+SKLTRLLQDSLGGNSQTIMIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q++A+R +I  LQ EL+EY    K GK+     EDG  GYSD++ EN +LQ EN   RL++KA+ E I+A+  R  Q+++++
Sbjct:    6 DCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHLFGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDANGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCTQPDLVNEAVTGLPDGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEY----KAGKRVIG--EDGAEGYSDLFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQE 459          

HSP 2 Score: 311.997 bits (798), Expect = 1.134e-84
Identity = 159/367 (43.32%), Postives = 221/367 (60.22%), Query Frame = 2
Query: 3854 NQENVFKRLTSTRSSPNPT--------------KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            N  NVF RLTS +S  +                +G I+ +       T  PLQCVS+A+GH KPIL LD +D +L TGSKDR  K+W+L    EI++L  H N+V  +K  S + L F+V T YIK+WDIRD  KCI+TL SSG    G    + ++R      GE+ I  IA S +G  ++ A+ N+V++W++ R+  VGKL G H  PVM L  +        +VTGSKDHY+K+FE+     G I P+   +PPHYDG+E LA+   IL SGSRD  IKKWDL   + +     AH+DW+ AL F   +   LS CR+GV+K+WN +N   IG+++ H+S I A+ +++  IF+ASSDC+VK+W
Sbjct: 1248 NDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGIISPVGGAKGART-APLQCVSMAEGHTKPILCLDATDELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSTSYIKVWDIRDSAKCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALSPSGTMLYAASGNAVRIWELSRFQPVGKLTG-HIGPVMCLTVTQTASQHDLVVTGSKDHYVKMFELGECVTGTIGPTHNFEPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALAFIPGRPMLLSACRAGVIKVWNVDNFTPIGEIKGHDSPINAICTNAKHIFTASSDCRVKLW 1612          

HSP 3 Score: 200.29 bits (508), Expect = 3.878e-50
Identity = 142/420 (33.81%), Postives = 241/420 (57.38%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVI-----------------GTNISKS---------------------RQVVVSAHSNPPVTVKSQSKPMPKNHVRRNS--LLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRR----SEYAKDGRTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA L+ EI++K++LI EL+  Q++L+ ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  K+K +YE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K++REE +R R+VET RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR    +                 G  +S S                     R++      +P  TV   ++P  K   ++ +    +K  R KW S+E  +   +++R TI + E DM   +K+RE+L +  + L  +R    +E  ++ +   E+  E++ + + I+ + + I++CQ+ I+++EE++ E   +D   +I +CSL EA+ LL+   + +++KG+     E Q
Sbjct:  636 LADLTCEIEIKQKLIDELENSQRRLQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRDLQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIAQLKKEQRRQEFQIRALESQKRQQEMVLRRKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNG-TRPARKKFQKKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRKRERLQAESPEEEKGLQELAEEIEVLAANIDYINDGITDCQATIVQLEETKEELDSTDTSVVISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQ 1054          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A2T7PKG5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_05156 PE=3 SV=1)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 674/1664 (40.50%), Postives = 952/1664 (57.21%), Query Frame = 2
Query:  161 NESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI---QDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-DSNL--DDNLNGETE----TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSN-----------TISSAVEFSKHTHVSMSGEF-----PEE--DALFDSTLSEWDSFIVHPKRRKTKKSEVG-DNEN---GSTFICSISETGDIIQQI----------------------------ASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDG-------RTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIF----ANXXXXXXXXXXXPIDTDIPGNLS-------NQXXXXXXXXXXXXXXXXKKTISKRKPATPEELLGVNKNAADRXXXXXXXXXXXXXXXXXXIKRTIHTVQTPT----------ETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSM----TTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLT--STRSSPNPTKGTI-TSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIR-DCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSST---LVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITAL 4855
            N+  D+SV+VA+R+RPQN RE+++M Q+C SV P+EPQ+ +GKDK FT+D V ++ + Q+ I+NT  + LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+++D+ +VGIIPR V++LF  I++ R    +  LP PDFK+ AQF+ELYNEE+IDLLD     D + +KS I+IHE+  G IY+             TL+CLK G L R+TASTNMN  SSRSHAIFTLHIKQ R++ D +L  DD  + ++     T++ETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGDKAK+G HVPYR+SKLTRLLQDSLGGNS+T+MIACISPSD DF+ETLNTL YANRARNIKNK+  NQDKAS+Q+A++R +I++LQ EL EY    K GK++ D++     +D+YTEN +LQ+EN+  R ++K LSE IE+LKA NAQ+LAE   F+  ++  N         ++ +++++  I+KY  E E+L+A+LAE+EA V  L+R N           +++S       +  S  G F     PE    +L D    E         R +++ S  G D EN   G+     + E+ D+ + +                             SGS   D D+                               +H+ LA L+ EI +K+RLI EL+  QK+L  ++  YE ++  LQ +IKETE ERD VL+N+G++E T  E+ +K+  EYE+KLS L+SEL ++Q AK+EH  ++KNQ   + +LR LQ EL E+K  KV+L K+++EEA R +  E  RN+E+ Q+++E+   +N I+NLE+EK +K  IL+RKQEEVEALR+RQ  +      +R     A  + PVT         + H RR     K  ++KW  +E  +   I ++ T++  E+DMN  +K+R+K   K +  + +R + A DG       R  D+I+  ++   +  +    E       + E ++             CSL+EA+YLLE   Q++ ++G+   T E +   L  +L           D+LR  +Q   V  + D +     A++ + E     SP D+    N S            +S  + S +   ++K  ++RK ATPE+LL      A +  L               I        TP           E    LL+    A    + N   +   I S    +   RR  +       M    T S I  R          S+  TPP+SP   RR  S RS + +NVF RL+  S   S N  +G I T+ S KN  S    L C  IA+GH K +L +D +D+ + TGSKDR AK+WDL    E+ SLA H N+V +VK    + L FTV    +++WD+R     C++TL SSGL+  G    S ++RQ      E+ I D+A +  G T++ A  + V++WD+RRY  +G+L G HQA VMVLA  +RD  +S    +++GSKDHYIKVFEV   + G+++P   L PPHYDG++S+A+   IL SGSRD CIKKWDLA+ Q   S + AH+DW+ AL F  D +  LSGCR GVLK W  +  + + +++AH S I A+
Sbjct:    7 NKEDDSSVRVALRIRPQNGREKVEMCQVCTSVVPDEPQVLLGKDKPFTFDHVCDMHATQESIYNTCVRSLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNIDAEEVGIIPRAVEHLFIGIEERRRQAFENGLPPPDFKVNAQFMELYNEEIIDLLDATRDPDARGRKSFIRIHEDAAGGIYVV------------TLQCLKIGALSRTTASTNMNVQSSRSHAIFTLHIKQHRLVRDESLAADDGKDADSTVSSVTEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDKAKKGSHVPYRDSKLTRLLQDSLGGNSRTLMIACISPSDRDFMETLNTLKYANRARNIKNKVIANQDKASRQIASLRAEIQALQQELAEY----KTGKRTVDAEGQESINDMYTENTMLQTENEKLRQRLKVLSEAIESLKADNAQLLAEAATFS--LMGPNG--------EVSNEDVVNQIKKYLQEIEDLKAKLAESEATVEQLKRRNLRSPHSPIRPSSVNSMSLSLMSSMTSSMGGFEAPVSPEALTSSLLDVARREVKKMKKIRNRSESQTSSHGSDKENQSIGNKHNGHVHESSDLPENVEMQEKSDDNEDETSLLDEEDDEEDTEESDSGSESRDSDN-------------------------------IHEDLAELTCEISIKQRLIEELEASQKKLHAMKMQYEEKVLQLQIRIKETEVERDTVLSNIGQIESTTTEKTKKITAEYEKKLSNLQSELKKMQAAKKEHAKLVKNQSHYEKQLRTLQHELAEMKKTKVKLMKQVKEEADRNKQTEARRNREVGQMKREQLRNENIIKNLEREKQQKELILRRKQEEVEALRKRQKPMS-----NRAAGRVAKYDKPVTEPEAPLSSMRRH-RRVEFSPKAAKNKWERLEKYMNAVITKKQTVSLMERDMNIWLKQRDKTIKKMEHYQKKRKDLA-DGLKDDETVRELDDIIQGLQQQVAFAQDNINECQMGIMQVEESKDEAESLDTGQFFNCCSLEEARYLLEHCLQMSTDRGLQLATKEAECRELLAKLHQTELNNTLQQDLLRHMMQ-DNVCIETDDLMTYSDADDIESESSSSSSPADSMFESNGSALHPPHFTGIIPTSDAHSSAAAIAARKEKARRKTATPEDLLYAGNTEACKPLLPVLETPEEEKRNKPGIIDAQDDDGTPVKQKGAGDEGLELQDKLLMPPPKALPKPTANRTVSTLPIPSPTIKRRELRRSPSSPEASPVMQRKNTPSNITDRQGGQSSSLDTSSDTTPPSSPPMLRR--SGRSSD-DNVFSRLSGNSQTFSHNSNRGNIVTTNSIKNVGSKSPFLTCTHIAEGHTKAVLSVDATDDRIFTGSKDRTAKVWDLASGKEVQSLAGHPNTVLRVKYCPISRLIFTVSQSAVRVWDVRVSPASCLRTLSSSGLTTAGTTS-SVSNRQVESAYREHNISDVALNAEGTTLYCAAGSVVQIWDLRRYGQMGRLSG-HQAQVMVLAV-ERDGGASGNDLVISGSKDHYIKVFEVMKDAAGILSPKYNLDPPHYDGIQSMAIQGHILFSGSRDTCIKKWDLASQQLQQSVNSAHKDWVCALEFLPDSSVLLSGCRGGVLKAWAVDTFSQLAEIRAHASPINAI 1599          
BLAST of Kinesin protein vs. TrEMBL
Match: V5HJ08 (Putative kinesin-like protein kif21a OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 644/1612 (39.95%), Postives = 949/1612 (58.87%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI-QDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNL------DDNLNGETET--DYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNTISSAVEFSKHTHVSMSGEF--PEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVT--NEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRN---SLLA--KLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSE---YAKDGRTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXX-XXDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANXXXXXXXXXXXPIDTDIPGNLSNQXXXXXXXXXXXXXXXXKKTISKRKPATPEELLGVNKNAADRXXXXXXXXXXXXXXXXXXIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSR---NSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRD-CKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTH---FLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            D SV+VAVRVRP   RE + M   C SV   EPQI++GKDKAFT+D VF+  + Q+++++T  K L++GC +GYNAT+LAYGQTGSGKT+TMG+G+ ++L+  + G+IPR V +LF  I + + + ++K  PVPDFK+  QF+ELYNEE+ DLL+  +D +  KS IKIHE+  G IY  GV+T+ V S E  +KCL+ G L R+TAST MN  SSRSHAIFTLHIKQQR++   L      +D   GE  T  ++ETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGD + +  HVPYR+SKLTRLLQDSLGGNS+T+MIAC+SP D DF+ETLNTL YANRA+NIKNK+T+NQDK+S+ +A +R +I+ LQ EL+EY+Q  +L        EDG    +D++ EN +LQ+EN  FR ++KAL ET+E L  +N ++LAE+ A  W + +  S+   + +L          I+ Y  E EELR +L E+E M   L++    S A      T V++SG +    E+A  D  L++     V    RKTK       E          E G+         SD D+D+   +  + S+  ++  D+DE  +          Q L  L+ EI  K++LI +L+  Q++L  +R HYE +L  LQ +I+ETE ERD++L+++G    +  +EE+VRK++ ++ER+L +L+ EL ++Q A+REH  ++KNQ   + ++R L++++ ++K  KV L  K++EE++R +  E  R +E+ Q+RKE R  +N+IR+LE +   K  +LKR+ EEV ALRR                             Q++PM      R    +LL   ++ + KW ++E  + K ++ +  I + E+DM   + EREKL     KL  +R +     KD R   ++  +++ +++ ++ V  EI++CQ+NIL++EE + E   V  ++      +A+YL++++  +A+N+ + A     Q   +  +LEA+ Q+ E    M +  L+HS     MDG+        ++   +P    +   L+  +  S   +   SN   +++ ++RK ATP+ELL  +   A ++  +         ++   +  +            G L   S A   +     E    +         A R+ T + P      S ++ R   N+  + ++  S   TPP+SP   RR        +ENVF RLT T     P +G I+  + K  L+   PL C  +A+GH K +L L V+D++L + SKDR  KIW+L+   EI SL  H ++V  V+    T L F+V T YIK+WD+R+   KC+ TL+SSG  ++GP      SR    P  E  I  I  +  G  +F A +N V++WD+RR+  VGKL G HQA VM +A  D    SS LVTGSKDHYIKVFE+     G++TP + L+PPHYDG++SLAL +  L SGSRD CIKKWDL++   + S +QAH+DWI AL F  +       LS CR G+LKLWN +NC+ +G ++AH S I A+ ++S  +F+AS+D  V++W+
Sbjct:    4 DTSVRVAVRVRPLIPREVIDMCHACTSVASREPQIWVGKDKAFTFDHVFDCPTHQEQVYDTCVKALVEGCFDGYNATVLAYGQTGSGKTYTMGTGYGLNLNEHERGVIPRAVDHLFAGIAQRQAEAREKGAPVPDFKVHVQFMELYNEEIFDLLNSGKDDRGNKSGIKIHEDVKGEIYTIGVATKTVQSAEQVIKCLESGALSRTTASTAMNVQSSRSHAIFTLHIKQQRVVTVPLLEGADEEDGGEGEASTLSEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDASGKISHVPYRDSKLTRLLQDSLGGNSRTLMIACVSPCDRDFMETLNTLRYANRAKNIKNKITVNQDKSSQTIALLRREIQDLQLELMEYKQGKRL------VGEDGVEQVNDMFYENTMLQTENGNFRTRVKALQETVERLTVKNTELLAEQAAAAW-IGRDGSDAGDVKVL----------IQGYLKEVEELRTKLMESEEMCGQLRKQLQRSQARLLPSPTTVAVSGVYDVGAEEASVDDVLAQAKR-DVECLTRKTKHLSRAQREE---------EEGE-------KKSDADEDTAEANGNDESSESEAEADEDERYS----------QDLVNLTMEISCKQKLIEQLEQSQRRLHTMRMHYEEKLVQLQARIRETELERDRILSSVGSAGPSKDSEEKVRKIRGDFERRLGQLQGELKKMQAARREHAQLMKNQAEYERQVRKLKQDVADMKKTKVSLMTKMKEESRRHQEAEKRRQREVAQMRKENRQQENRIRSLEAQNRTKEMVLKRRHEEVAALRR-----------------------------QARPMSSRVAGRGNGKALLVSPRVAKQKWQTLEKNIDKLVLSKQNIYTLERDMERWLMEREKLTRHLDKLIRKRDKARLAGKDERYVHDLEEQVEGLQANVQYVNMEITDCQANILQLEEPKEELLDVGSLLDGTESPQARYLIDKLLHMAINQSVQAN----QHQAVVQELEARLQQVEANNAMHQDLLEHSLYAMQMDGL------ATEEAGSTPSSRSVSPTLTF-TAASEVGSLDTSNVTFRRSKARRKTATPQELLYASSMDAPQTEEALTDPPRALPAMEDVMAMSHPDGACFDLGPDGNLTRVSSAPGSLK----EVGVDMRPVPRGHLGAHRKFTGRLPA---ELSPLLRRKFANTNSNQLRKESVDATPPSSPPGGRRA-------RENVFSRLTGTAPPAKPDRGVISVFTGKPILNKSSPLVCTHVAEGHSKAVLSLAVTDDVLFSSSKDRTVKIWNLHTGQEIQSLRGHPDNVVAVRYCEYTRLTFSVSTAYIKVWDVRENPAKCVHTLFSSGNCENGPVVADSASRSLQIPQNETRINAIELNQYGTLLFSAASNIVRIWDLRRFACVGKLAGGHQAAVMCMAVDDPGVDSSLLVTGSKDHYIKVFEIPESGNGVLTPKMNLEPPHYDGIQSLALCNDYLFSGSRDYCIKKWDLSSQSHIVSLNQAHKDWICALSFMPNPGGPPVLLSSCRGGMLKLWNADNCSLVGQLRAHTSPINAIATNSSCVFTASNDHTVRVWQ 1517          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A0L8H2L9 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22023793mg PE=3 SV=1)

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 651/1621 (40.16%), Postives = 944/1621 (58.24%), Query Frame = 2
Query:  200 VRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDD-NLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNT-ISSAVEFSKHTHVSMS-GEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDN-ENGSTFICS-----------------ISE-TGDIIQQIASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLA---KLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGI---KYQKLENRRSEYAKDGRTTDE---IVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANXXXXXXXX--XXXPIDTDIPGNLSNQXXXXXXXXXXXXXXXXKKTISKRKPATPEELL-GVNKNAADRXXXXXXXXXXXXXXXXXXIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSR------NSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTR--SSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCK--KCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTE-NCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWKR 4918
            +RPQ  RER+ M QIC  V   E Q+ +GKDKAFT+D+VF+  + Q +++ T  + L++GC EGYNAT+ AYGQTGSGKT+TMGSGFD+ +   D+GIIPR + +LF+ IDK + +  +   P P FK+  QF+ELYNEE++DLLD     D ++KKSHIK+HE+  G IY+ GV+TR V SL  TL+ LK G L R+TAST MN  SSRSHAIF+LHIKQ R+    LD+   +  ++  +ETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGDK K+GCHVPYR+SKLTRLLQDSLGGNS+T+MIACISPSD DF+ETLNTL YANRA+NI+N +  NQDKASK LA +R +   LQ ELLEY    K GK+  DS    G +D + EN +LQSEN+  R ++KA+++T++ L+ RN Q+  E   F      + SN   LN     ++++  VI+ YT ETE LRA+LAEAE+   + Q S +   S +  S    +S S  E P    + +  L +  +  +   + K K    GD  E+    IC                  +S+ TG++ ++  +G   V++DS   D            + D++D E     + +H++LA L+ E+ +K+RLI  L+  Q +L  ++ HYE +++ LQ KI+ETE ERD++++N+ +VE   +++V+ V  +Y++KL+ L+ EL +LQ AK+EH  +++NQ   + +L+  Q EL E+K +KV+L K+++EEA++ ++ +  ++KEI QLRK     + +I+NLE EK +K  +LKRKQEEVEALR+RQ  +    +      V  ++  P    S   PM   H R++ + +   +L + KW++I+  ++  I +R T++  E+DM T +KER KLG    KY K +    E  +     DE   ++  ++      +    EI E    + E + +   E +  I+   +  E+QYL   + +  + KG L    E +   L+ +L           D+L+  +    +  DM+    N+++ E       SP+D     N+ ++ R +       +    KK  ++R+ ATP+ELL  V  +  D                         T+    ETS+       +   D S N+           + KSL +   T +  G S  T L +S       NS  +  +    +E  P SPL   +   +RS+   +VFKRLTS    SSP   +GTIT LS+ N      P+ C  I +GH KP+L +  ++++L T SKDR AK+WDLN   E+    +H N+V  +K +  ++  +TV    +K+WDIRD     C+    SSGL+   P   S  +RQ+     EN I  I+ S++G T+F A  N V++WD+R    + KL G HQA VMVLA++     S  +V+GSKDHYIK+FEV+  +  + +P+  L+PPH+DGV+SL + DQIL SGSRD CIKKW+L   + + S   AH+DWI  L    +    LSGCRSG LKLW TE NC+ IG+++AH   ITAL ++   IF+AS+DC V IWK+
Sbjct:    1 IRPQCGRERIDMCQICTDVIYAESQLILGKDKAFTFDYVFDRDTVQKDVYETCVQMLVEGCFEGYNATVFAYGQTGSGKTYTMGSGFDVDVPLEDIGIIPRAIGHLFSGIDKRKKEAMENNQPPPTFKVSVQFMELYNEEILDLLDPAKDLDSRNKKSHIKVHEDASGGIYVVGVNTRPVDSLNATLQLLKGGALSRATASTKMNVQSSRSHAIFSLHIKQDRITTEILDEEGKDDSSQPTFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDKTKKGCHVPYRDSKLTRLLQDSLGGNSRTLMIACISPSDRDFMETLNTLKYANRAKNIRNVVVANQDKASKLLAQLRAENNLLQKELLEY----KTGKRVVDSDGVEGMNDFFAENTMLQSENEKLRQRLKAMTKTVDGLRERNIQLATENNLF------KQSNSEPLN-----NEQLTTVIQNYTKETESLRAKLAEAESRCKIAQNSASRAQSRLALSPRVPMSSSLTEVPNSPEINNYDLLKEANEDLRSLKEKIKYRTGGDGQESDKENICEGNIQLKNNCGDVPCDPLLSDITGEVFEEFYAGEEMVEEDSECFD-----------FNTDDTDEEEGMGSDNVHENLAELTCEMTLKERLIEALEKNQNKLNAMKTHYEQKVQQLQQKIRETEVERDKIISNIEKVEADKKDKVKNVNEKYQQKLNTLQQELKKLQEAKKEHAKLIRNQAVHEKQLKTYQHELQEMKRIKVRLMKQIKEEAEKNKLNDAKKHKEITQLRKAHLKKEQRIKNLETEKHQKEIVLKRKQEEVEALRKRQRPMSDRAAGR----VGRYNTYPAQ-SSHYIPMSP-HERQSQISSRSDRLAKRKWDAIQKKVEGIINKRQTLSLIEKDMETWLKERRKLGQNIEKYTKKKETLIETQQSQEAIDECVDVIESLEGQLQLCQEHITEIQEQIMQLEENKNNDELEKLQVILSKSNALESQYLFRHLMESVLLKGTLCANKETELKELQAKLHQCMVNNNLQQDILK-HMMADRIDIDMEEFVQNDAETESISSGSTSPVD-----NMFDRQRTNQLSPNMATGESLKKAKARRRTATPKELLYSVESSCLD------------------------STLTPLQETSQ------EETSPDKSPNS-----------SPKSLVKSVDTLEKIGLSNETELQLSPLPLRRVNSASEATRPNKYSE--PVSPLRSPQAPRKRSN---DVFKRLTSKSMISSPESNRGTITQLSRINSGGRSSPVFCSHIVEGHAKPVLSVCATEDLLFTSSKDRTAKVWDLNTGHELQVFPDHPNNVVALKYNEPSHRLYTVSLSEVKVWDIRDVATPNCVIAFNSSGLA-SAP--ISYQTRQSEVSRHENLINAISLSDDGQTLFTAVGNLVRMWDLRNLSCINKLTG-HQAQVMVLASTSNAE-SQLVVSGSKDHYIKIFEVNSMTSNVASPTYNLEPPHFDGVQSLVIQDQILFSGSRDRCIKKWNLKDKKTIQSLYCAHKDWINGLAIMPEHQILLSGCRSGYLKLWQTEGNCSAIGEIKAHNFPITALTTNKSAIFTASNDCTVGIWKK 1532          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A0L8H2I0 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22023793mg PE=3 SV=1)

HSP 1 Score: 978.008 bits (2527), Expect = 0.000e+0
Identity = 651/1630 (39.94%), Postives = 946/1630 (58.04%), Query Frame = 2
Query:  200 VRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDD-NLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNT-ISSAVEFSKHTHVSMS-GEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDN-ENGSTFICS-----------------ISE-TGDIIQQIASGSSDVDKDS--LNGDAEEVXXXXXXXXXXXXXXXXXXXXXXY-------LHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLA---KLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGI---KYQKLENRRSEYAKDGRTTDE---IVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANXXXXXXXX--XXXPIDTDIPGNLSNQXXXXXXXXXXXXXXXXKKTISKRKPATPEELL-GVNKNAADRXXXXXXXXXXXXXXXXXXIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSR------NSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTR--SSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCK--KCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTE-NCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWKR 4918
            +RPQ  RER+ M QIC  V   E Q+ +GKDKAFT+D+VF+  + Q +++ T  + L++GC EGYNAT+ AYGQTGSGKT+TMGSGFD+ +   D+GIIPR + +LF+ IDK + +  +   P P FK+  QF+ELYNEE++DLLD     D ++KKSHIK+HE+  G IY+ GV+TR V SL  TL+ LK G L R+TAST MN  SSRSHAIF+LHIKQ R+    LD+   +  ++  +ETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGDK K+GCHVPYR+SKLTRLLQDSLGGNS+T+MIACISPSD DF+ETLNTL YANRA+NI+N +  NQDKASK LA +R +   LQ ELLEY    K GK+  DS    G +D + EN +LQSEN+  R ++KA+++T++ L+ RN Q+  E   F      + SN   LN     ++++  VI+ YT ETE LRA+LAEAE+   + Q S +   S +  S    +S S  E P    + +  L +  +  +   + K K    GD  E+    IC                  +S+ TG++ ++  +G   V++DS   + + ++    ED    D    A      ++       +H++LA L+ E+ +K+RLI  L+  Q +L  ++ HYE +++ LQ KI+ETE ERD++++N+ +VE   +++V+ V  +Y++KL+ L+ EL +LQ AK+EH  +++NQ   + +L+  Q EL E+K +KV+L K+++EEA++ ++ +  ++KEI QLRK     + +I+NLE EK +K  +LKRKQEEVEALR+RQ  +    +      V  ++  P    S   PM   H R++ + +   +L + KW++I+  ++  I +R T++  E+DM T +KER KLG    KY K +    E  +     DE   ++  ++      +    EI E    + E + +   E +  I+   +  E+QYL   + +  + KG L    E +   L+ +L           D+L+  +    +  DM+    N+++ E       SP+D     N+ ++ R +       +    KK  ++R+ ATP+ELL  V  +  D                         T+    ETS+          ++ S +   N S        KSL +   T +  G S  T L +S       NS  +  +    +E  P SPL   +   +RS+   +VFKRLTS    SSP   +GTIT LS+ N      P+ C  I +GH KP+L +  ++++L T SKDR AK+WDLN   E+    +H N+V  +K +  ++  +TV    +K+WDIRD     C+    SSGL+   P   S  +RQ+     EN I  I+ S++G T+F A  N V++WD+R    + KL G HQA VMVLA++     S  +V+GSKDHYIK+FEV+  +  + +P+  L+PPH+DGV+SL + DQIL SGSRD CIKKW+L   + + S   AH+DWI  L    +    LSGCRSG LKLW TE NC+ IG+++AH   ITAL ++   IF+AS+DC V IWK+
Sbjct:    1 IRPQCGRERIDMCQICTDVIYAESQLILGKDKAFTFDYVFDRDTVQKDVYETCVQMLVEGCFEGYNATVFAYGQTGSGKTYTMGSGFDVDVPLEDIGIIPRAIGHLFSGIDKRKKEAMENNQPPPTFKVSVQFMELYNEEILDLLDPAKDLDSRNKKSHIKVHEDASGGIYVVGVNTRPVDSLNATLQLLKGGALSRATASTKMNVQSSRSHAIFSLHIKQDRITTEILDEEGKDDSSQPTFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDKTKKGCHVPYRDSKLTRLLQDSLGGNSRTLMIACISPSDRDFMETLNTLKYANRAKNIRNVVVANQDKASKLLAQLRAENNLLQKELLEY----KTGKRVVDSDGVEGMNDFFAENTMLQSENEKLRQRLKAMTKTVDGLRERNIQLATENNLF------KQSNSEPLN-----NEQLTTVIQNYTKETESLRAKLAEAESRCKIAQNSASRAQSRLALSPRVPMSSSLTEVPNSPEINNYDLLKEANEDLRSLKEKIKYRTGGDGQESDKENICEGNIQLKNNCGDVPCDPLLSDITGEVFEEFYAGEEMVEEDSECFDFNTDDTDEEEDLSSSDIALTASLYTLWSFTGMGSDNVHENLAELTCEMTLKERLIEALEKNQNKLNAMKTHYEQKVQQLQQKIRETEVERDKIISNIEKVEADKKDKVKNVNEKYQQKLNTLQQELKKLQEAKKEHAKLIRNQAVHEKQLKTYQHELQEMKRIKVRLMKQIKEEAEKNKLNDAKKHKEITQLRKAHLKKEQRIKNLETEKHQKEIVLKRKQEEVEALRKRQRPMSDRAAGR----VGRYNTYPAQ-SSHYIPMSP-HERQSQISSRSDRLAKRKWDAIQKKVEGIINKRQTLSLIEKDMETWLKERRKLGQNIEKYTKKKETLIETQQSQEAIDECVDVIESLEGQLQLCQEHITEIQEQIMQLEENKNNDELEKLQVILSKSNALESQYLFRHLMESVLLKGTLCANKETELKELQAKLHQCMVNNNLQQDILK-HMMADRIDIDMEEFVQNDAETESISSGSTSPVD-----NMFDRQRTNQLSPNMATGESLKKAKARRRTATPKELLYSVESSCLD------------------------STLTPLQETSQ----------EETSPDKSPNSS-------PKSLVKSVDTLEKIGLSNETELQLSPLPLRRVNSASEATRPNKYSE--PVSPLRSPQAPRKRSN---DVFKRLTSKSMISSPESNRGTITQLSRINSGGRSSPVFCSHIVEGHAKPVLSVCATEDLLFTSSKDRTAKVWDLNTGHELQVFPDHPNNVVALKYNEPSHRLYTVSLSEVKVWDIRDVATPNCVIAFNSSGLA-SAP--ISYQTRQSEVSRHENLINAISLSDDGQTLFTAVGNLVRMWDLRNLSCINKLTG-HQAQVMVLASTSNAE-SQLVVSGSKDHYIKIFEVNSMTSNVASPTYNLEPPHFDGVQSLVIQDQILFSGSRDRCIKKWNLKDKKTIQSLYCAHKDWINGLAIMPEHQILLSGCRSGYLKLWQTEGNCSAIGEIKAHNFPITALTTNKSAIFTASNDCTVGIWKK 1552          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A1B6CPU2 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.14882 PE=3 SV=1)

HSP 1 Score: 972.23 bits (2512), Expect = 0.000e+0
Identity = 638/1611 (39.60%), Postives = 946/1611 (58.72%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI-QDGK--DKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDD------NLNG-ETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWD--SFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDV---DKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLG----IKYQKLENRRSEYAKDGRTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNCS-LDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANXXXXXXXXXXXPIDTD-IPGNLSNQXXXXXXXXXXXXXXXXKKTISKRKPATPEELLGVNKNAADRXXXXXXXXXXXXXXXXXXIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCV-NSKSLARRQLTWKHPGGSMTTSLIVSRN-----STDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTR---SSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            ++SV+VAVR+RPQ ARE + M ++C +VTP+EPQ+ +G DK+FTYD+VF++   Q+ ++   AK LI+G LEGYNATILAYGQTGSGKT+TMG+GFD+ L+   VGIIPR + +LF+ I++I    K+     P FK+ AQFLELYNEE+IDL D  QD      KS IKIHE+   SIY+TGV++R + +  + L+CL+ G L R+TAST MNS SSRSHAIFTLHIKQQR++    DD      +L+  E   ++ TL+AKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVIS LGDK+KR  HVPYR+SKLTRLLQDSLGGNS+T+MIAC+SPSD DF+ETLNTL YANRARNI+N++ INQDK+S+ ++ +R +I+ LQ EL+EY+Q    GK+      +   +D++ EN +LQ+E    R ++KA+ +TI+AL A+N Q+LAEK   +W           LN       ++ ++I+ Y  E EELRA+L E+E++   L+R+        F+++T  S S   P  + LF+ +++  +  + I   KR   K  E                       +A G   V   D +  NG  +E S+  +S ++ D      +    Y  Q LA L+SEI++K++LI EL+  Q++L  ++QHYE +L  LQ KIK T+ ERD VLA+         E+V+KVK EYERKL+ ++ E+  LQ+AKREH  +L++Q + + +++ L+ E+ ++K +KV+L  K++EEA + + VE  RNKEI QLRKE R  +N IR+LE EK  K+ +L+RKQEEV ALR+   V  + +S+      +    P +T      P P           ++ + KWN++E  +    + + ++   E++M   + ER+ L      K  KL +   +  ++     ++  E++ +++ +E V++ I E Q+NI++VEES+     S+++   S + EA Y++E++Y + ++   LA   EM       +LEAK Q+ E+  +  R  L+H       + I    S+  +    S   TD + GN +    N +A     +         +RK A P+ELL V KN+A                       +   +  P       L     A   +   N +++  I S V N K+ +R+  T   P  +   ++++S       ST   ++       P  SP  +RR+ S+    +ENVF RLTS+    S  +   G ITS   K  ++   PL C  +A+GH + +L +  +D +L T S+DR  K+WDL +  E  +L+ H N V  VK    + L ++  + YI++WD+R   KCI+TL SSG + +GP    Q       P GE  + DIA ++NG  ++ A ++ V++WD+RR+   GKL G HQA VM LA          +VTGSKDH IKVF+V+    G+ +P   L PPHYDG++ LA+    L SGSRD  IKKWDL   + + S S AH+DW+  L F   +   +SGCR G+LKLW+TE CA +G+++AH++ I A+ +++  IF+ ++  ++++W+
Sbjct:    5 ESSVRVAVRIRPQIAREVIDMCRVCTAVTPDEPQVTLGSDKSFTYDYVFDMDQMQEPVYEACAKSLIEGSLEGYNATILAYGQTGSGKTYTMGTGFDVDLEPEQVGIIPRAINHLFDGIERIVNQAKEAGEAPPQFKVSAQFLELYNEEVIDLFDASQDYSLTKCKSGIKIHEDANHSIYVTGVTSRSIHNTTEALQCLRQGALSRTTASTQMNSQSSRSHAIFTLHIKQQRVVKLEGDDIEQSTESLDSNEASQEFVTLSAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIQNRVMINQDKSSRTISLLRQEIQQLQLELMEYKQ----GKRVIGEDGEESVNDMFHENTMLQNELTNLRTRVKAMQDTIDALSAKNIQLLAEKATGDW-----------LNSAAGADGDMTEMIQNYLKEIEELRAKLVESESVCQQLRRN--------FTRNTITSKSPISPSNN-LFEGSINSGNVGTLIAQAKRDLQKDMEA----------------------LARGKEAVLSPDMNKKNGHVQEDSDNSESEEEIDSETESEEKDSEY-SQELAELTSEINLKQKLIEELELSQRRLHSMKQHYEDKLLQLQAKIKATQEERDTVLASFTGQSSEPSEKVKKVKEEYERKLNGMQKEMKTLQSAKREHAKLLRSQSQYESQIKTLRNEVTDMKRVKVKLINKMKEEAAKHKEVELKRNKEIAQLRKESRKHENVIRSLEAEKRAKDVVLRRKQEEVVALRK---VARSGMSQK----AAGRVRPKIT-----GPSP-----------RVAKQKWNALEKNISANTLNKQSVIFLEREMERLLAERKSLHSDLEFKLHKLSDVHLQQPRNKEFIQDLEEEIETLRANLEYVEDSIRESQNNIIQVEESKSVMDCSELVSGLSDIAEAGYIIEKLYSMTLHHSCLAAQKEMTMK----ELEAKNQQLERESETQRQLLEHIVGNPSQENIPPGSSNSSNASSRSTSPTDAVNGNSTTSGNNMTATQRLGNQEKH-----RRKTALPQELLYV-KNSAPLL--------------------SPELMPPPVRA----LTRVPSAPSTLKQQNVKSEPPIPSPVFNRKTFSRQDST--SPRLTRRGTIVLSSGNILGKSTSTSMEQGLDVSPP-TSPPPYRRMTSR----EENVFSRLTSSTTQLSDQHVGNGIITSFQGK--VALKAPLICTHVAEGHSRAVLAIAATDELLFTASRDRTVKVWDLTEGRESQTLSGHPNIVVAVKYDEESRLLYSASSVYIRVWDLR-TSKCIQTLCSSGTTSNGPLNTLQ------IPAGECQVNDIALNHNGRILYTAASDRVRVWDIRRFGVTGKLSGGHQAAVMCLAVGKLSSNEDIVVTGSKDHTIKVFDVAGEEGGIYSPRANLAPPHYDGIQKLAIRGHELFSGSRDCIIKKWDLNKQELITSVSNAHKDWVCGLAFLPGQPLIVSGCRGGILKLWSTETCAQLGEMKAHDTSINAITTNTTHIFTGANYGELRMWR 1495          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21a (kinesin family member 21A [Source:ZFIN;Acc:ZDB-GENE-110411-237])

HSP 1 Score: 533.872 bits (1374), Expect = 3.123e-161
Identity = 281/485 (57.94%), Postives = 362/485 (74.64%), Query Frame = 2
Query:  179 SVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYS--DIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKY 1618
            S  ++VR+RPQ ARE+++   IC  VTP EPQ+ +GKDKAFT+D+VF++ S+QD I++   + LI+GC EGYNATI AYGQTGSGKT+TMG+GFD+S+   ++GIIPR V +LF  I++ R     +  PVP+FKI AQFLELYNEE++DL D     + + +KSHIKIHE+  G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+  ++  DN+     T++ETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNSQT+MIAC SPSD DF+ETLNTL YANRARNIKNK+ +NQDKAS+Q++A+R +I  LQ EL+EY    + GK+     EDG  S  D+Y EN++LQ+EN   R+++KA+ ETI+A +AR  Q+L+++   N  + K              S+EI K+I+ Y
Sbjct:    4 SFSLSVRIRPQLAREKIEGCHICTFVTPGEPQVILGKDKAFTFDYVFDMDSQQDTIYSNCTEKLIEGCFEGYNATIFAYGQTGSGKTYTMGTGFDVSIPDDELGIIPRAVSHLFKGIEQRRQAATDQGRPVPEFKISAQFLELYNEEVLDLFDSTRDLEVRKQKSHIKIHEDATGGIYTVGVTTRTVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCTTS--DNVRSVCLTEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSKRTTHVPYRDSKLTRLLQDSLGGNSQTVMIACTSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKASQQISALRTEIARLQMELMEY----RTGKRMIG--EDGMESINDMYHENSMLQTENNNLRVRVKAMQETIDAQRARLTQLLSDQA--NQVLAKVGEG----------SEEIGKMIQNY 468          

HSP 2 Score: 293.508 bits (750), Expect = 5.859e-80
Identity = 140/297 (47.14%), Postives = 187/297 (62.96%), Query Frame = 2
Query: 3965 LQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITAL 4855
            LQCV +A+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  V+ SSS  L FTV T YIK+WDIRD  KCI+TL SSG    G    + T+R    P GEN I  I+ +  G  ++ A  NSV++WD+RR+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G I+P+   +PPHYDG+ES+ +    L SGSRD  IKKWDLA          AHRDW+ AL         LSGCR GVLKLW+T+  + +G+++ HES I ++
Sbjct: 1140 LQCVHVAEGHSKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVRYSSS--LVFTVSTSYIKVWDIRDSAKCIRTLASSGQVSSGDACAATTNRTVTIPTGENQINQISLNPTGTVLYAAAGNSVRMWDLRRFVSTGKLTG-HLGPVMCLTVDHSGNGQDLVITGSKDHYIKMFDVTEGALGSISPTHNFEPPHYDGIESVVVQGDCLFSGSRDNGIKKWDLAHKDLQQQVPNAHRDWVCALGVVPGSPALLSGCRGGVLKLWHTDTLSALGELRGHESPINSI 1433          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21a (kinesin family member 21A [Source:ZFIN;Acc:ZDB-GENE-110411-237])

HSP 1 Score: 532.332 bits (1370), Expect = 5.043e-161
Identity = 279/492 (56.71%), Postives = 364/492 (73.98%), Query Frame = 2
Query:  179 SVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDN------LNGETETD-YETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYS--DIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKY 1618
            S  ++VR+RPQ ARE+++   IC  VTP EPQ+ +GKDKAFT+D+VF++ S+QD I++   + LI+GC EGYNATI AYGQTGSGKT+TMG+GFD+S+   ++GIIPR V +LF  I++ R     +  PVP+FKI AQFLELYNEE++DL D     + + +KSHIKIHE+  G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+  ++ ++N       NG ++ + +ETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNSQT+MIAC SPSD DF+ETLNTL YANRARNIKNK+ +NQDKAS+Q++A+R +I  LQ EL+EY+   ++        EDG  S  D+Y EN++LQ+EN   R+++KA+ ETI+A +AR  Q+L+++   N  + K              S+EI K+I+ Y
Sbjct:    4 SFSLSVRIRPQLAREKIEGCHICTFVTPGEPQVILGKDKAFTFDYVFDMDSQQDTIYSNCTEKLIEGCFEGYNATIFAYGQTGSGKTYTMGTGFDVSIPDDELGIIPRAVSHLFKGIEQRRQAATDQGRPVPEFKISAQFLELYNEEVLDLFDSTRDLEVRKQKSHIKIHEDATGGIYTVGVTTRTVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCTTSDNENETDNRLANGSSDMEEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSKRTTHVPYRDSKLTRLLQDSLGGNSQTVMIACTSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKASQQISALRTEIARLQMELMEYRTGKRM------IGEDGMESINDMYHENSMLQTENNNLRVRVKAMQETIDAQRARLTQLLSDQA--NQVLAKVGEG----------SEEIGKMIQNY 477          

HSP 2 Score: 306.22 bits (783), Expect = 4.444e-84
Identity = 155/345 (44.93%), Postives = 211/345 (61.16%), Query Frame = 2
Query: 3905 PTKG---TITSLSKKNPL-----STHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            PT G    + S+   NP+     S    LQCV +A+GH K +L +D +D++L TGSKDR  K+W+L    EI SL  H N+V  V+ SSS  L FTV T YIK+WDIRD  KCI+TL SSG    G    + T+R    P GEN I  I+ +  G  ++ A  NSV++WD+RR+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ G++G I+P+   +PPHYDG+ES+ +    L SGSRD  IKKWDLA          AHRDW+ AL         LSGCR GVLKLW+T+  + +G+++ HES I ++ +++  +F+AS D  VKIW+
Sbjct: 1156 PTAGFSSRMGSIGVINPVPVSKSSRGATLQCVHVAEGHSKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVRYSSS--LVFTVSTSYIKVWDIRDSAKCIRTLASSGQVSSGDACAATTNRTVTIPTGENQINQISLNPTGTVLYAAAGNSVRMWDLRRFVSTGKLTG-HLGPVMCLTVDHSGNGQDLVITGSKDHYIKMFDVTEGALGSISPTHNFEPPHYDGIESVVVQGDCLFSGSRDNGIKKWDLAHKDLQQQVPNAHRDWVCALGVVPGSPALLSGCRGGVLKLWHTDTLSALGELRGHESPINSISTNNSLVFTASDDRTVKIWR 1497          

HSP 3 Score: 219.164 bits (557), Expect = 6.651e-57
Identity = 138/389 (35.48%), Postives = 246/389 (63.24%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVV------SAHSNPPVTVKSQSKPMPKNHVRRNSL---LAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVY----EMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQ 3172
            LA ++ EI +K++LI EL+  Q++L  ++Q YE +L  LQ+KI++T+ ERD+VL N+G +E  +E++ +++K EYE+KLS +  EL +LQ A++EH  +LKNQ + + +L+ LQ+E+ E+K  KV+L K+++E+ ++ R+ E+ RN+EI  L+K++R  ++Q++ LE +K ++  IL+RK EEV ALRR+   +   +  +R+V +      SAH  P   +     P       R  +     ++ R KW S+E  +   I++R TI++ E DMN  +K+RE L  + +KL  ++   A +G   ++ V     E++++ + I+ + + I++CQ+NI+++EE++ E    D   +IG+C+L EA++LL+    +A+NKG+ A   E Q
Sbjct:  629 LANITCEIAIKQKLIDELENSQRRLHTLKQQYEQKLMMLQSKIRDTQLERDRVLHNMGYMESGSEDKAKRIKAEYEKKLSVMNKELQKLQAAQKEHARLLKNQSQYEKQLKKLQQEVTEMKKTKVRLMKQMKEQQEKNRMAESRRNREIATLKKDQRKREHQLKLLEAQKRQQELILRRKTEEVTALRRQVRPMSGKV--NRKVSLPETLSDSAHRPPTGRIHGSGAPNGTRLYHRRPVGVYSTRVARVKWQSLERRISDIIMQRMTISNMEADMNRLLKQREDLTRRREKLSRKKERLAAEGPEGEKAVQTLSEELESLLANIDYINDSIADCQANIMQMEEAKEEGETVDVSAVIGSCTLSEARFLLDHFMTMAINKGLQAAQKESQ 1015          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21b (kinesin family member 21B [Source:NCBI gene;Acc:103045846])

HSP 1 Score: 534.258 bits (1375), Expect = 1.042e-160
Identity = 268/457 (58.64%), Postives = 348/457 (76.15%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLD---IQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQR----MIDSNLDDNLNGET-----ETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVL 1507
            D  VKV++R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFTYDFVF+I + Q +I+ +    LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+++   + GIIPR V  LF  I + R D +++    P+FK+ AQFLELYNEE++DL D     + + +KS+IKIHE+  G IY +GV++RLVSS E+ L+CLK G L R+TAST MN+ SSRSHAIFT+H+ Q R    + + +  D++N  T     + +YETLTAKFHFVDLAGSERLKRTGATGERA+EGISINCGLLALGNVIS LGD++K+  HVPYR+SKLTRLLQDSLGGNS+T+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q+ A+R +I  LQ EL+EY    K GK+ A      G+SD++ EN++LQ EN   R+++KA+ +TI+ L  R  Q+L
Sbjct:    6 DCCVKVSLRIRPQMAKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDIDAHQQQIYGSCVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNVGEEEQGIIPRAVHQLFQGIQRRRQDAQERSTNPPEFKVSAQFLELYNEEILDLFDNTRDPEARGRKSNIKIHEDGNGGIYTSGVTSRLVSSEEELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQLANGSASDDVNEVTDGPISQPEYETLTAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKKAGHVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQINALRAEIARLQMELMEY----KAGKRVAGEDGSEGFSDLFQENSMLQRENDTLRMRVKAMQDTIDHLNTRVTQLL 458          

HSP 2 Score: 298.901 bits (764), Expect = 1.625e-81
Identity = 160/385 (41.56%), Postives = 223/385 (57.92%), Query Frame = 2
Query: 3800 TPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPT--------------KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            TPP+SP         R+ N  NVF RLTS +S  +                +G I+ +S      T  PLQCV++A+GH KP+L LD +D +L TGSKDR  K+W+L    EI +L  H N+V  VK   ++ L FTV T YIK+WDIRD  KC++T  SSG    G       +R      GE  I  I+ + +G+ ++ A  N+V+ WD+ R  A GKL G H   VM L           ++TGSKDHY+K+F+V+ G+ G I P+   +PPHYDG+E LA++  +L SGSRD  IKKWDL   + +     AH+DW+ AL +   +   LS CR G+LK+WN +N   IG+++ H+S I A+ ++S +IF+ASSD  VKIW
Sbjct: 1268 TPPSSP-------PLRTRNDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGVISPISGLKGGRT-APLQCVAMAEGHSKPVLCLDATDELLFTGSKDRTCKMWNLVTGQEIVTLRGHPNNVVSVKYCVNSGLVFTVSTSYIKVWDIRDSAKCVRTFTSSGQVVSGDACAGTITRTITTTQGEYQINQISLNPSGSVLYAAAGNTVRTWDLNRMQATGKLTG-HIGSVMCLTVGYSGGGKDQVITGSKDHYVKIFDVAEGAQGNIGPAHNFEPPHYDGIECLAVHGDVLFSGSRDNGIKKWDLEQQELIQQIPNAHKDWVCALAYVPGRPMLLSACRGGMLKVWNVDNFTPIGEIKGHDSPINAICTNSKQIFTASSDRMVKIW 1643          

HSP 3 Score: 184.111 bits (466), Expect = 3.966e-46
Identity = 136/432 (31.48%), Postives = 245/432 (56.71%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR-----RQHVIG--------------------------------TNISKSRQVVVSAHSNPPVTVKSQSK-PMPKNHVRRNSLLAKLTRS---KWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDG-------RTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQL 3196
            LA L+ EI++K+RLI EL+  Q++L  ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  K+K +YE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K+++EE +R R++E  RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR      + V G                                ++I +     ++ +     + +  S+ P  +   +R  + +  +++   KW ++E  +   +++R TI++ E DM+  +K+RE+L ++ + L  +R +   +G       R   E+  E++ + + ++ + + +S+CQ+ I+++EE++ E    D   +I +CSL EA++LL+   + +++K +     E Q   L+ QL
Sbjct:  663 LADLTCEIEIKQRLIDELENSQRRLLTLKLQYEEKLILLQNKIRDTQLERDRVLHNLMSMENYTEEKASKIKADYEKRLKEMNRDLAKLQAAQKEHARLLKNQGRYERELKKLQAEVAEMKKAKVALMKQMKEEQQRRRMIEAKRNREIAQLKKEQRRQEYQIRALESQKRQQEIVLRRKTQEVTALRRMAKPMSERVAGRVSRRQPSLDSGAELSASTTTTSSEPETSRSVSSIVRQWNTKLNGYLGESESNRGGSRLPSSRKKFQRKGVSSSFSKTARQKWQALERRVMDIVMQRMTISNVEADMDRLIKKREELSMQQEALLCKREKLLSEGPREEEDERVLQEMNEEIEVLNANVDYISDSLSDCQATIVQIEETKDELDSVDTSVVISSCSLAEARHLLDHFLKASIDKNLQVAQKEAQIRLLEGQL 1094          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21b (kinesin family member 21B [Source:NCBI gene;Acc:103045846])

HSP 1 Score: 533.102 bits (1372), Expect = 2.468e-160
Identity = 268/457 (58.64%), Postives = 348/457 (76.15%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLD---IQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQR----MIDSNLDDNLNGET-----ETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVL 1507
            D  VKV++R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFTYDFVF+I + Q +I+ +    LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+++   + GIIPR V  LF  I + R D +++    P+FK+ AQFLELYNEE++DL D     + + +KS+IKIHE+  G IY +GV++RLVSS E+ L+CLK G L R+TAST MN+ SSRSHAIFT+H+ Q R    + + +  D++N  T     + +YETLTAKFHFVDLAGSERLKRTGATGERA+EGISINCGLLALGNVIS LGD++K+  HVPYR+SKLTRLLQDSLGGNS+T+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q+ A+R +I  LQ EL+EY    K GK+ A      G+SD++ EN++LQ EN   R+++KA+ +TI+ L  R  Q+L
Sbjct:    6 DCCVKVSLRIRPQMAKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDIDAHQQQIYGSCVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNVGEEEQGIIPRAVHQLFQGIQRRRQDAQERSTNPPEFKVSAQFLELYNEEILDLFDNTRDPEARGRKSNIKIHEDGNGGIYTSGVTSRLVSSEEELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQLANGSASDDVNEVTDGPISQPEYETLTAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKKAGHVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQINALRAEIARLQMELMEY----KAGKRVAGEDGSEGFSDLFQENSMLQRENDTLRMRVKAMQDTIDHLNTRVTQLL 458          

HSP 2 Score: 310.071 bits (793), Expect = 5.311e-85
Identity = 161/372 (43.28%), Postives = 225/372 (60.48%), Query Frame = 2
Query: 3800 TPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPT-KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            TPP+SP         R+ N  NVF RLTS +S  +   KG I+ +S      T  PLQCV++A+GH KP+L LD +D +L TGSKDR  K+W+L    EI +L  H N+V  VK   ++ L FTV T YIK+WDIRD  KC++T  SSG    G       +R      GE  I  I+ + +G+ ++ A  N+V+ WD+ R  A GKL G H   VM L           ++TGSKDHY+K+F+V+ G+ G I P+   +PPHYDG+E LA++  +L SGSRD  IKKWDL   + +     AH+DW+ AL +   +   LS CR G+LK+WN +N   IG+++ H+S I A+ ++S +IF+ASSDC+VK+W
Sbjct: 1268 TPPSSP-------PLRTRNDRNVFSRLTSNQSQGSALDKGVISPISGLKGGRT-APLQCVAMAEGHSKPVLCLDATDELLFTGSKDRTCKMWNLVTGQEIVTLRGHPNNVVSVKYCVNSGLVFTVSTSYIKVWDIRDSAKCVRTFTSSGQVVSGDACAGTITRTITTTQGEYQINQISLNPSGSVLYAAAGNTVRTWDLNRMQATGKLTG-HIGSVMCLTVGYSGGGKDQVITGSKDHYVKIFDVAEGAQGNIGPAHNFEPPHYDGIECLAVHGDVLFSGSRDNGIKKWDLEQQELIQQIPNAHKDWVCALAYVPGRPMLLSACRGGMLKVWNVDNFTPIGEIKGHDSPINAICTNSKQIFTASSDCRVKLW 1630          

HSP 3 Score: 184.496 bits (467), Expect = 3.413e-46
Identity = 136/432 (31.48%), Postives = 245/432 (56.71%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR-----RQHVIG--------------------------------TNISKSRQVVVSAHSNPPVTVKSQSK-PMPKNHVRRNSLLAKLTRS---KWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDG-------RTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQL 3196
            LA L+ EI++K+RLI EL+  Q++L  ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  K+K +YE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K+++EE +R R++E  RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR      + V G                                ++I +     ++ +     + +  S+ P  +   +R  + +  +++   KW ++E  +   +++R TI++ E DM+  +K+RE+L ++ + L  +R +   +G       R   E+  E++ + + ++ + + +S+CQ+ I+++EE++ E    D   +I +CSL EA++LL+   + +++K +     E Q   L+ QL
Sbjct:  663 LADLTCEIEIKQRLIDELENSQRRLLTLKLQYEEKLILLQNKIRDTQLERDRVLHNLMSMENYTEEKASKIKADYEKRLKEMNRDLAKLQAAQKEHARLLKNQGRYERELKKLQAEVAEMKKAKVALMKQMKEEQQRRRMIEAKRNREIAQLKKEQRRQEYQIRALESQKRQQEIVLRRKTQEVTALRRMAKPMSERVAGRVSRRQPSLDSGAELSASTTTTSSEPETSRSVSSIVRQWNTKLNGYLGESESNRGGSRLPSSRKKFQRKGVSSSFSKTARQKWQALERRVMDIVMQRMTISNVEADMDRLIKKREELSMQQEALLCKREKLLSEGPREEEDERVLQEMNEEIEVLNANVDYISDSLSDCQATIVQIEETKDELDSVDTSVVISSCSLAEARHLLDHFLKASIDKNLQVAQKEAQIRLLEGQL 1094          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21b (kinesin family member 21B [Source:NCBI gene;Acc:103045846])

HSP 1 Score: 533.102 bits (1372), Expect = 2.711e-160
Identity = 268/457 (58.64%), Postives = 348/457 (76.15%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLD---IQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQR----MIDSNLDDNLNGET-----ETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVL 1507
            D  VKV++R+RPQ A+E+++   IC SVTP EPQ+ +GKDKAFTYDFVF+I + Q +I+ +    LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+++   + GIIPR V  LF  I + R D +++    P+FK+ AQFLELYNEE++DL D     + + +KS+IKIHE+  G IY +GV++RLVSS E+ L+CLK G L R+TAST MN+ SSRSHAIFT+H+ Q R    + + +  D++N  T     + +YETLTAKFHFVDLAGSERLKRTGATGERA+EGISINCGLLALGNVIS LGD++K+  HVPYR+SKLTRLLQDSLGGNS+T+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q+ A+R +I  LQ EL+EY    K GK+ A      G+SD++ EN++LQ EN   R+++KA+ +TI+ L  R  Q+L
Sbjct:    6 DCCVKVSLRIRPQMAKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDIDAHQQQIYGSCVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNVGEEEQGIIPRAVHQLFQGIQRRRQDAQERSTNPPEFKVSAQFLELYNEEILDLFDNTRDPEARGRKSNIKIHEDGNGGIYTSGVTSRLVSSEEELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQLANGSASDDVNEVTDGPISQPEYETLTAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKKAGHVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQINALRAEIARLQMELMEY----KAGKRVAGEDGSEGFSDLFQENSMLQRENDTLRMRVKAMQDTIDHLNTRVTQLL 458          

HSP 2 Score: 303.523 bits (776), Expect = 5.973e-83
Identity = 160/385 (41.56%), Postives = 225/385 (58.44%), Query Frame = 2
Query: 3800 TPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPT--------------KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            TPP+SP         R+ N  NVF RLTS +S  +                +G I+ +S      T  PLQCV++A+GH KP+L LD +D +L TGSKDR  K+W+L    EI +L  H N+V  VK   ++ L FTV T YIK+WDIRD  KC++T  SSG    G       +R      GE  I  I+ + +G+ ++ A  N+V+ WD+ R  A GKL G H   VM L           ++TGSKDHY+K+F+V+ G+ G I P+   +PPHYDG+E LA++  +L SGSRD  IKKWDL   + +     AH+DW+ AL +   +   LS CR G+LK+WN +N   IG+++ H+S I A+ ++S +IF+ASSDC+VK+W
Sbjct: 1268 TPPSSP-------PLRTRNDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGVISPISGLKGGRT-APLQCVAMAEGHSKPVLCLDATDELLFTGSKDRTCKMWNLVTGQEIVTLRGHPNNVVSVKYCVNSGLVFTVSTSYIKVWDIRDSAKCVRTFTSSGQVVSGDACAGTITRTITTTQGEYQINQISLNPSGSVLYAAAGNTVRTWDLNRMQATGKLTG-HIGSVMCLTVGYSGGGKDQVITGSKDHYVKIFDVAEGAQGNIGPAHNFEPPHYDGIECLAVHGDVLFSGSRDNGIKKWDLEQQELIQQIPNAHKDWVCALAYVPGRPMLLSACRGGMLKVWNVDNFTPIGEIKGHDSPINAICTNSKQIFTASSDCRVKLW 1643          

HSP 3 Score: 184.496 bits (467), Expect = 3.469e-46
Identity = 136/432 (31.48%), Postives = 245/432 (56.71%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR-----RQHVIG--------------------------------TNISKSRQVVVSAHSNPPVTVKSQSK-PMPKNHVRRNSLLAKLTRS---KWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDG-------RTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXD---IIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQL 3196
            LA L+ EI++K+RLI EL+  Q++L  ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  K+K +YE++L E+  +L +LQ A++EH  +LKNQ R + EL+ LQ E+ E+K  KV L K+++EE +R R++E  RN+EI QL+KE+R  + QIR LE +K ++  +L+RK +EV ALRR      + V G                                ++I +     ++ +     + +  S+ P  +   +R  + +  +++   KW ++E  +   +++R TI++ E DM+  +K+RE+L ++ + L  +R +   +G       R   E+  E++ + + ++ + + +S+CQ+ I+++EE++ E    D   +I +CSL EA++LL+   + +++K +     E Q   L+ QL
Sbjct:  663 LADLTCEIEIKQRLIDELENSQRRLLTLKLQYEEKLILLQNKIRDTQLERDRVLHNLMSMENYTEEKASKIKADYEKRLKEMNRDLAKLQAAQKEHARLLKNQGRYERELKKLQAEVAEMKKAKVALMKQMKEEQQRRRMIEAKRNREIAQLKKEQRRQEYQIRALESQKRQQEIVLRRKTQEVTALRRMAKPMSERVAGRVSRRQPSLDSGAELSASTTTTSSEPETSRSVSSIVRQWNTKLNGYLGESESNRGGSRLPSSRKKFQRKGVSSSFSKTARQKWQALERRVMDIVMQRMTISNVEADMDRLIKKREELSMQQEALLCKREKLLSEGPREEEDERVLQEMNEEIEVLNANVDYISDSLSDCQATIVQIEETKDELDSVDTSVVISSCSLAEARHLLDHFLKASIDKNLQVAQKEAQIRLLEGQL 1094          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: KIF27 (kinesin family member 27 [Source:HGNC Symbol;Acc:HGNC:18632])

HSP 1 Score: 325.479 bits (833), Expect = 3.051e-91
Identity = 197/467 (42.18%), Postives = 279/467 (59.74%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQD-GKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-DSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKAR-NAQVLAEKEAFNWQM-VKQNSNCT 1561
            D  V+VAVR+RP    E +   Q C  V P   QI +GKD+AFT+D VF     Q+E++ T  +PL+   ++GYN T+ AYGQTGSGKTFT+G     S    + GIIPR +  LF         +  K     DF +   ++E+Y EEL DLLDI+   KD    + I E+  G+  + G    +V + ++ L  L+ G   R T +T MN  SSRSH IFTL + Q+R    SN  DNLN E+E+    L++KFHFVDLAGSER+ +TG TGER KE I IN GLLALGNVIS LGD  ++  H+PYR++K+TR+L+DSLGGN++T+MIACISPS  +F ET+N+L YANRA+NI+NK  +N +    ++  M  +I++L+  L  + Q S L  +++   +D    D               RL++K+L + + +L+   N       EA+ + M +++ SN T
Sbjct:    3 DTLVRVAVRIRPLLRNEILYSQQTCVRVVPGNQQILLGKDRAFTFDHVFGSKVAQEEVYKTCIQPLVKSFVDGYNVTVFAYGQTGSGKTFTIGGANIASSIEDERGIIPRAIADLF---------FAMKESHNTDFSVGVSYIEVYKEELRDLLDIETLSKD----MHIREDDKGNTVIIGTKESVVETEDEVLSLLEAGNAARHTGTTQMNEHSSRSHTIFTLTVTQRRPYGSSNSGDNLNNESES----LSSKFHFVDLAGSERVSKTGNTGERFKESIQINSGLLALGNVISALGDPKRKSSHIPYRDAKITRILKDSLGGNAKTLMIACISPSSGNFDETINSLKYANRAKNIRNKPVVNYNPDWDRIDEMEQEIKTLREAL--HNQRSTLVTRASHVSQDFQAQD---------------RLRMKSLEDQVGSLQTECNHYRNCTDEAYRFLMELRRASNIT 435          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 266.929 bits (681), Expect = 6.846e-76
Identity = 173/406 (42.61%), Postives = 236/406 (58.13%), Query Frame = 2
Query:  152 NESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKD-------KAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIK-QQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSS 1345
            +E ++S   +VKV VR RP N +E    +++   V     QI + +        K FT+D VF   SKQ +++N  A+P++D  LEGYN TI AYGQTG+GKTFTM     I       GIIP    ++F  I K   D +        F +   +LE+YNEE+ DLL    GKD+   +++ E     +Y+  +S  +V++ +D  + +  G   RS  STNMN  SSRSHAIFT+ I+  ++ +D N+   +             K H VDLAGSER  +TGATG+R KE   IN  L  LGNVIS L D   +  HVPYRNSKLTRLLQDSLGGNS+T+M A I P+D ++ ET++TL YANRA+NIKNK  IN+D     L   + +IE L+ +L E ++ S
Sbjct:    6 SEKSDSGGDNVKVVVRCRPINGKETGAGHRMAVLVDEMRGQIAVQRPDCNDEPPKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEG---IRAVPELRGIIPNSFAHIFGHIAKAEGDTR--------FLVRVSYLEIYNEEVKDLL----GKDQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRM------------GKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDG--KSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEDLKKKLAEGEEVS 382          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 231.106 bits (588), Expect = 8.494e-65
Identity = 150/396 (37.88%), Postives = 220/396 (55.56%), Query Frame = 2
Query:  158 SNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKA-------FTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAEL 1324
            S   S  +V+V VR RP N RE     +   ++     Q+ I   +A       FT+D V+   +KQ +I+    +PL+D  L G+N TI AYGQTG+GKT+TM     +  D    G+IP   +++F  I + +        PVP+ +  A +LE+Y EE+ DLL     +D+   +++ E     I++  +S+ +  S  +    +  G   RS  +TNMN  SSRSHAIF + ++   +         +GE+         K + VDLAGSER  +TGA GER KE   IN  L ALGNVIS L D   +  HVPYR+SKLTRLLQDSLGGN++T+M+A + P+  ++ E+L TL YANRA+NI+N+  +N+D     L   + +I  L+ +L
Sbjct:   12 SRAKSAETVRVVVRCRPMNPRESAASYESVITIDVRAGQVAIRNPRANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEG---VRSDPERRGVIPNSFEHIFTHISRSQNQ------PVPEVR--ASYLEIYQEEIRDLL----SRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSEL-------GADGESHI----RVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDG--KSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRPRVNEDPKDALLREFQEEIARLKEQL 379          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif16bb (kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GENE-070424-241])

HSP 1 Score: 228.794 bits (582), Expect = 8.097e-61
Identity = 172/430 (40.00%), Postives = 238/430 (55.35%), Query Frame = 2
Query:  176 ASVKVAVRVRPQNARER-------MQMNQICASVTP-NEPQIYIG-----KDKAFTYDFVFNILSK-------QDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKA---------KRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKE 1378
            ASVKVAVRVRP N RE+       +QM      +T    P+   G     + K FTYD+ +  + K       Q+ ++  +   ++D   EGYNA I AYGQTGSGK++TM        +  D+G+IPR  + L+  + +        +     ++    +LE+YNE + DLL  +  K     ++ H   G   Y+  +S  LV +  D  + ++ G + R+TA+T MN  SSRSHAIFT+   Q     +  D  +  ET        +K H VDLAGSER   TGATG R KEG +IN  L+ LGNVIS+L D +         K+   VPYR+S LT LL+DSLGGNS+TIMIA ISP+D ++ ETL+TL YANRA+NI NK TIN+D   K +  +R +I  L+A L +  Q+S L   +A S E
Sbjct:    2 ASVKVAVRVRPMNQREKGLEAKFIIQMEGKKTVITNLKTPEGSTGDVSRERLKEFTYDYSYFSVDKRSPQFASQEMVYKDIGMDVLDAAFEGYNACIFAYGQTGSGKSYTMMG------NPGDLGLIPRICEGLYRGVSQ-------HISSGASYRTEVSYLEIYNERVRDLLRRKSSKSFNLRVREHPKEGP--YVEDLSKHLVQNYSDVEELMEAGNINRTTAATGMNDVSSRSHAIFTIKFTQ-----AKFDAEMPRET-------VSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISSLADLSLSSSSPQGRKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINEDSNVKLIRELRAEIVRLKALLTQGNQNSLLDSPTALSME 404          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010617.1 (pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 gene:ENSPMAG00000009612.1 transcript:ENSPMAT00000010617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.631 bits (566), Expect = 1.076e-59
Identity = 141/320 (44.06%), Postives = 196/320 (61.25%), Query Frame = 2
Query:  377 GCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQ 1336
            G +EGYN T+ AYGQTG GK+FTM     +S  S   G+IPR  +++F   + I+     K L    F+  A +LE+YNEE+ DLL    GKD K  +++ E+    +Y+  +S   V S+ +  + ++ G   R+T +T MN  SSRSH+IF++H++     D   D    G           K + VDLAGSER  +TGA G+R KE   IN  L ALGNVIS L D   R  HVPYR+SKLTRLLQDSLGGN++T+M+ACISP+D ++ E+L+TL YANRA++I+N+  +N+D     L   R +I  L+A LL+ Q
Sbjct:    2 GVVEGYNGTVFAYGQTGCGKSFTMQG---VSEPSAQRGVIPRAFEHIF---ESIQCAENTKFL----FR--ASYLEIYNEEIRDLL----GKDTKQRLELKEHPERGVYVRDLSMHTVHSVAECERIMQAGWSNRATGATLMNKDSSRSHSIFSIHLEMCTTDDQGEDHIRAG-----------KLNLVDLAGSERQSKTGAQGDRLKEATKINLSLSALGNVISALVDG--RSKHVPYRDSKLTRLLQDSLGGNTKTLMVACISPADNNYEESLSTLRYANRAKSIRNRPRVNEDPKDAMLREYREEITRLKA-LLQGQ 291          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 205.297 bits (521), Expect = 6.644e-55
Identity = 137/353 (38.81%), Postives = 198/353 (56.09%), Query Frame = 2
Query:  284 GKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQ-QRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLG-DKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAA-------MRMQIESLQ 1315
            G +  F +D +F+  S Q  ++     PL+D  L+G+N+T+ AYG TG GKT+T      +S      GII   ++ LFN+I    TD K +     DF+I   +LE+YNE + DLL  +    +   + I E+T   I +  +S    +++ED +  +  G + R+T+ T  N  SSRSHA+  +HI Q  +++D          ++  + TL+     +DLAGSER   T   G R  EG +IN  LLALGN I+ L  +   R CH+PYR+SKLTRLL+ SLGGN +T+MI CISPS   + ETLNTL YANRA+ IK K+  NQ   S+ + +        + QIE L+
Sbjct:  148 GGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYT------VSGTPSQPGIIFLAMEELFNKI----TDLKDEK----DFEISLSYLEIYNERIRDLLKPETPSKR---LVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLT--------SQHTFATLS----IIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQSLSRHVGSYLKMITEQKRQIEELR 471          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 200.29 bits (508), Expect = 2.622e-52
Identity = 171/469 (36.46%), Postives = 235/469 (50.11%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICAS----------VTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDI--SLDSVD-------VGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDG-----KDKKSHIKI--HENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTL--HIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQ-LAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALK 1486
            +SD+++ V VR R +N RE  + + +  S          ++    Q Y    K + +D VF   S Q+ +FN  AK  I   L GYN TI AYGQTG+GKT+TM    +I   + S D        GIIPR +  LF  +  +  +Y  K+           FLELYNE L DLL   +       D K  I+I  + N   SI + G+    ++S  + L  L  G+L R  A+T  N  SSRSH +FT+  +I +Q   D   + N              K + VDLAGSE + R+GA  +RA+E   IN  LL LG VI+ L D +    H+PYR SKLTRLLQDSLGG ++T +IA ISP+     ET +TL YA RA++IKN   +NQ  +    L     +IE L+ +L      +   K+     +D    D+Y  N+IL  E     LKI  L E I+  K
Sbjct:   48 TSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKI----------SFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNF---------VKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN---HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDL-----KNSRNKQGIFITQDQL--DLYESNSILIDEQ---NLKIHNLREQIKKFK 484          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 157.147 bits (396), Expect = 1.212e-39
Identity = 148/502 (29.48%), Postives = 231/502 (46.02%), Query Frame = 2
Query:  299 FTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLD--IQDGKDKKS-----------------HIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATG--ERAKEGISINCGLLALGNVISTL-GDK---------------------------AKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIK---NKLTI-----NQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENN-------ILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIE 1612
            F +D VF       E++   +KP+ID  L G+NATI AYG TGSGKTFTM      S +  ++G+IP  V YLF  I +   +  KK      F ++  +LE+YNE + DLL+  +++   + S                  +KI +++   + + G++ R   S E+ L+ +  G   R    T+ N+ SSRSHAI  +     R+  +N+    NG +       ++     DLAGSER     ATG  ER KEG  IN  LLALG VIS L  DK                                H+PYR+SKLTRLLQ +L G+S    I  +   +    ET+NTL +A+RA+N+    +K +I     N     + +  +R Q+E  +  + E +  S +G+    S  +  Y DI    N       ++++EN+  + K++            N + L +K+                 ++D++  EIM+++E
Sbjct:  163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTM------SGNEQELGLIPLSVSYLFTNIMEQSMNGDKK------FDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLI-----RLTSTNVK---NGTSR------SSTLSLCDLAGSER-----ATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVALHVSKKSIISNGNNDGDKDRTIELLRRQLEEQRRMISELKNRSNIGEPLTKSSNESTYKDIKATGNDGDPNLALMRAENRVLKYKLE------------NCEKLLDKD-----------------VVDLQDSEIMEIVE 604          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 155.221 bits (391), Expect = 5.049e-39
Identity = 118/316 (37.34%), Postives = 171/316 (54.11%), Query Frame = 2
Query:  299 FTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKI-----HENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGET-ETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRA 1228
            F +D +F+      ++F  + + L+   L+GYN  I AYGQTGSGKTFTM +  D        GIIP  + ++FN I+K++T          D+K+  +F+E+YNE ++DLL   +   + + I +     H+    +  +T V++  + S E     LK     RSTAST  N  SSRSH+IF +H+              N +T    Y TL    + VDLAGSER+  +   G+R +E  +IN  L  LG+VI  LG       H+P+RNSKLT LLQ SL G+S+T+M   ISPS     ETLN+L +A++ 
Sbjct:  436 FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD--------GIIPSTISHIFNWINKLKTKG-------WDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGS-----------NAKTGAHSYGTL----NLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 126.331 bits (316), Expect = 1.541e-29
Identity = 86/215 (40.00%), Postives = 126/215 (58.60%), Query Frame = 2
Query:  926 AKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLT----INQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNC 1558
            +K + VDLAGSE + R+GA  +RAKE  SIN  LL LG VI+ L DK+    H+P+R SKLTRLLQDSLGGN++T +IA ISP+     ET +TL YA++A+NIKNK      I +D   K +    M++  ++++LL           S  SKE    S  + +N  L S+ + ++ +++     IE+L ++NA  L  K+    +   Q+ NC
Sbjct:  377 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNIT---MELAKIKSDLL-----------STKSKEGIYMSQDHYKN--LNSDLESYKNEVQECKREIESLTSKNA--LLVKDKLKSKETIQSQNC 570          

HSP 2 Score: 88.1965 bits (217), Expect = 7.127e-18
Identity = 69/201 (34.33%), Postives = 97/201 (48.26%), Query Frame = 2
Query:   95 SINNLVLNWKYKIS*MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKD-----------------KAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSG---FDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLD 637
            S N++  N   ++   TV NE     + ++ VAVR R +N RE      + +SV  N P I   K+                 K +T D VF   + QD IF+ +A PL    ++GYN T+L YG T +GKT+TM      ++  L     GIIPR +  LF+ ++  + DY  K            F+ELYNEEL DLLD
Sbjct:   13 SSNSISKNGNSQVGCHTVPNE-----ELNITVAVRCRGRNEREI----SMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA-AGIIPRVLLKLFDTLELQQNDYVVK----------CSFIELYNEELKDLLD 193          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO49629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFN0])

HSP 1 Score: 338.961 bits (868), Expect = 9.131e-101
Identity = 192/392 (48.98%), Postives = 259/392 (66.07%), Query Frame = 2
Query:  155 ESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDI--SLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQ-RMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKR-GCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQA 1318
            E N      VKVAVR+RP   +E  +  Q C SVTP EPQ+ +G +KAFTYD+VF   S Q E++  +  PL+DG  +GYNAT+LAYGQTGSGKT +MG+ F +  S D    G+IPR +Q LF  I++ + +Y  K+           FLE++NEE+ DLL+     ++   I I E+  G I + G+  + V S++D ++CL+ G+  R T +T MNS SSRSHAI+T+ ++Q+ + IDS++                AKFH VDLAGSER+K+T A GER KEG++IN GLL LGNVIS L D+ +    HVPYR+SKLTRLLQDSLGGNS T+M+AC+SP+D ++ ETLNTL YA+RAR+IKNK  IN+D    ++  +R QIE LQA
Sbjct:    3 EENSDKTIPVKVAVRIRPLLHKEISEACQECISVTPGEPQVIMGTNKAFTYDYVFGKSSSQKELYTDVVTPLLDGFFKGYNATVLAYGQTGSGKTHSMGTSFTVCTSDDEDSQGVIPRLIQDLFRHIEQDKCEYSLKV----------SFLEIHNEEIHDLLNPSSTDER---ITIRESCEGGIKIAGLMEKKVDSVQDMVQCLELGSASRVTGATAMNSRSSRSHAIYTIIMEQRGKGIDSDVRK--------------AKFHLVDLAGSERVKKTNAQGERFKEGVNINKGLLCLGNVISALSDEQRNPSTHVPYRDSKLTRLLQDSLGGNSNTLMLACVSPADSNYEETLNTLRYADRARHIKNKPIINRDPQLAEIMRLRQQIEMLQA 367          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO49990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX9])

HSP 1 Score: 271.166 bits (692), Expect = 4.171e-81
Identity = 171/365 (46.85%), Postives = 229/365 (62.74%), Query Frame = 2
Query:  215 ARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDIS-LDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ-DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQI 1303
             +E++     C     N+PQ+ +GKD+ FT+D+VF   + Q E++ +  +PL+  CLEGYNAT+ AYGQTGSGKT+T+G G D   L     GIIPR V+ +F   +      K+K++    F++   ++E+Y EEL DLLD+    KD    I I E+  G+   TG   + V SL++ + CL  G+  R T +TNMN  SSRSHAIFT++I                    DY+   +KFHFVDLAGSER+ RTG  G+R KE + IN GLLALGNVIS L D  K+  HVPYR SK+TRLL+DSLGGN++T MI C+SP+  DF E LNTL +A RARNI+NK  IN+D  + +LA M+ QI
Sbjct:   17 GQEKVHQVPQCVEFVANKPQLILGKDRGFTFDYVFQPDASQVEVYESCIEPLVKSCLEGYNATVFAYGQTGSGKTYTIG-GLDTGGLMDDQYGIIPRAVKQIFQAFES-----KQKIV----FEVHVSYIEIYLEELRDLLDLDTSSKD----IHIREDDKGN---TGAMEQPVQSLDEVMSCLDTGSAARHTGATNMNEQSSRSHAIFTMYIDYM-----------------DYKY--SKFHFVDLAGSERVDRTGNVGDRFKESVQINTGLLALGNVISALADARKKILHVPYRESKVTRLLKDSLGGNARTTMITCLSPAAADFAENLNTLKFATRARNIRNKPVINRDPQNTKLAEMQNQI 345          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO37529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFN7])

HSP 1 Score: 252.677 bits (644), Expect = 2.185e-74
Identity = 168/394 (42.64%), Postives = 234/394 (59.39%), Query Frame = 2
Query:  179 SVKVAVRVRPQNARER-------MQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIY---LTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGD-KAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELL 1327
            +V+V VR RP N RE+       ++M+        ++P       KAFT+D  + I S  + I+N +  PL++G LEGYN T+ AYGQTG GK+F+M     I+      GIIPR  +++F  I+ +  D K        F + A +LE+YNEE+ DLL    GKD K+ + + E+    +Y   LT +    VS +E  +     G+  RS  +T MN+ SSRSH+IF+++++        LDD    ++E +      K + VDLAGSER  +TGATG R KE   IN  L ALGNVIS L D KAK   H+PYR+SKLTRLLQDSLGGN++T+M+AC+SP+D ++ ETL+TL YANRA+NIKNK  IN+D     L     +IE L+  L+
Sbjct:    4 AVRVIVRCRPLNKREKDLKCETVLEMDSDTGQCRLHKPGDKTQPPKAFTFDGAYFIDSTTENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSM---MGITDPPTQRGIIPRAFEHIFESIN-VADDSK--------FLVHASYLEIYNEEIRDLL----GKDHKAKLDLKEHPDKGVYVKDLTMIPVNCVSEIEHVMDL---GSKNRSVGATLMNADSSRSHSIFSINLEI-------LDD----DSEGNEHIRAGKLNLVDLAGSERQSKTGATGGRLKEATKINLSLSALGNVISALVDGKAK---HIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPKINEDPKDALLRQYSEEIERLKKMLM 364          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO39610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N5])

HSP 1 Score: 238.039 bits (606), Expect = 3.320e-69
Identity = 162/391 (41.43%), Postives = 227/391 (58.06%), Query Frame = 2
Query:  170 SDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKD-------KAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTM-GSGFDISLDSVDVGIIPRGVQYLFNRID-KIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQ 1315
            SD  V+V  R RP +  E     +I  S+  +  Q  + K        K FT+D V+      +++++ +  P++DG LEGYN T+ AYGQT  GKTFTM GS    S     VGI PR  +++ N +  K R   ++ +L V        +LE+YNEE+ DLL     K+ +S+++I E+    +Y+ G+S+  V   ED  + L+ G+  RS  ST MN+ SSRSH+IF        +ID  ++ N  GE E        K + VDLAGSER  ++GATGER +E   IN  L ALGNVIS L D   +  H+PYR+SKLTRLLQDSLGGNS+T+M+ACISP   ++ ETL+TL YA RA+NIKN+  IN+D     +     +I+ L+
Sbjct:    2 SDECVRVIARCRPLDYNEIKMKTEIIVSIDSSLRQCSLRKPGDPAKMRKVFTFDGVYGSQCNTEKLYSEIVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQGSAQPES----QVGITPRCCRHILNSMQGKGRRRNREYLLHV-------SYLEIYNEEIRDLLV----KNTRSNLEIKEHPDKGMYVKGLSSITVDCYEDMAEILEIGSANRSVGSTCMNTDSSRSHSIF--------IIDLQVNVNKGGEGEC---VRNGKLNLVDLAGSERQSKSGATGERFREATKINLSLSALGNVISALVDGKSK--HIPYRDSKLTRLLQDSLGGNSKTLMVACISPGSNNYEETLSTLRYAKRAKNIKNRPRINEDPKDSLIRKYLEEIQQLK 364          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO47818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL82])

HSP 1 Score: 226.098 bits (575), Expect = 1.102e-65
Identity = 129/319 (40.44%), Postives = 186/319 (58.31%), Query Frame = 2
Query: 3965 LQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIR-DCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLV-TGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            L C   A GH   +L +DV+++ + TGSKD+  K+WDLN   EI SL+ H+  V  VK   +TN  ++V    IKMWD+R D  KCIKTL         P   S  S        +  I D+  S++   +F A  NSV++WD++ +   GKL G H APVM +    R+  S TLV TGS+DH++K++E+S  +VG+ +P+  L PPHYDGV+ + +    L SGSRD  IKKWD  T Q     + AH+DW+ A+     +   LSGCR G LKLW  + C  I +++AH   I A+ ++S  +F+AS+D  V++W+
Sbjct:   14 LVCTYAATGHNSAVLSVDVTEDFMFTGSKDKTVKVWDLNTGEEILSLSGHKRDVVAVKYCHNTNCVYSVAQNLIKMWDVRQDSGKCIKTL--------TPQAGSTISGFISGITSDTQINDLQISDH--QLFAAMGNSVRIWDLKTFSMTGKLSG-HAAPVMTIKLKKRE--SDTLVFTGSRDHFVKIYELSESNVGVQSPTYSLAPPHYDGVQCITIRGTSLYSGSRDNSIKKWDYETHQLQQHVTGAHKDWVCAIDHLPKREVLLSGCRGGYLKLWTVDTCQPICEIRAHRHPINAIATNSSCVFTASNDRLVRLWR 319          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif21a (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101173385])

HSP 1 Score: 553.132 bits (1424), Expect = 2.481e-168
Identity = 281/456 (61.62%), Postives = 357/456 (78.29%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDS-NLDDNLN----GETETD-YETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VA+R+RPQ ARE+++   IC  V P EPQ+ +GKDKAFTYDFVF++ S+QD I++T  + LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+++   ++GIIPR V +LF  I++ R   +++  PVP+FKI AQFLELYNEE++DL D      +K+HIKIHE+  G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+  S N +D  N    G  E D YETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNSQT+MIACISPSD DF+ETLNTL YANRARNIKNK+ +NQDKAS+Q++A+R +I  LQ EL+EY    K GK+     EDG   +SD+Y EN++LQ+EN   R+++KA+ ETI+A +AR  Q+L+++
Sbjct:    7 ESSVRVALRIRPQLAREKIEGCHICTYVMPGEPQVILGKDKAFTYDFVFDMDSQQDAIYSTCTEKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNIADEELGIIPRAVHHLFKGIEERREAAQEQGRPVPEFKINAQFLELYNEEVLDLFDSTRDMKQKAHIKIHEDANGGIYTVGVTTRTVSSKAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCASDNQEDETNRVSNGNPEMDEYETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSKRSSHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQDKASQQISALRTEIARLQIELMEY----KTGKRMIG--EDGVESFSDMYHENSMLQTENSNLRVRVKAMQETIDAQRARLTQLLSDQ 456          

HSP 2 Score: 316.62 bits (810), Expect = 2.799e-87
Identity = 165/370 (44.59%), Postives = 224/370 (60.54%), Query Frame = 2
Query: 3812 SPLNFRRVV--SQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            SPL+ R++   +Q + ++  V K +T    SP P+  +          S   PLQCV +A+GH K +L +D +D++L TGSKDR  K+W+L    EI SLA H N+V  V+ SSS  L FTV T+YIK+WDIRD  KCI+TL S G    G      T+R    P GEN I  IA + NG  ++ A  NSV++WD+RR+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ GS+G I+P+   +PPHYDG+ESL +   +L SGSRD  IKKWDL     +     AHRDW+ AL         LSGCR GVLKLW+T+    +G+++ HES I ++  +S  +F+AS D  VKIW+
Sbjct: 1184 SPLSRRKMYDKAQAAADRAKV-KEITQGVISPVPSTKS----------SRMAPLQCVHVAEGHNKAVLCVDCTDDLLFTGSKDRTCKVWNLVTGQEIMSLAAHPNNVVSVRYSSS--LVFTVSTYYIKVWDIRDSAKCIRTLTSMGQVNIGDICAPNTNRTVAIPAGENQINQIALNPNGTVLYAAAGNSVRVWDLRRFASTGKLMG-HLGPVMCLTVDQSGNNQDLVITGSKDHYIKLFDVTEGSLGSISPTHNFEPPHYDGIESLVVQSDMLFSGSRDNGIKKWDLDRRDLLQQVPNAHRDWVCALGVVPGSPALLSGCRGGVLKLWHTDTLGALGELKGHESPINSITVNSSHLFTASDDRTVKIWR 1539          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif21a (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101173385])

HSP 1 Score: 552.362 bits (1422), Expect = 3.047e-168
Identity = 281/456 (61.62%), Postives = 357/456 (78.29%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDS-NLDDNLN----GETETD-YETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VA+R+RPQ ARE+++   IC  V P EPQ+ +GKDKAFTYDFVF++ S+QD I++T  + LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+++   ++GIIPR V +LF  I++ R   +++  PVP+FKI AQFLELYNEE++DL D      +K+HIKIHE+  G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+  S N +D  N    G  E D YETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNSQT+MIACISPSD DF+ETLNTL YANRARNIKNK+ +NQDKAS+Q++A+R +I  LQ EL+EY    K GK+     EDG   +SD+Y EN++LQ+EN   R+++KA+ ETI+A +AR  Q+L+++
Sbjct:    7 ESSVRVALRIRPQLAREKIEGCHICTYVMPGEPQVILGKDKAFTYDFVFDMDSQQDAIYSTCTEKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNIADEELGIIPRAVHHLFKGIEERREAAQEQGRPVPEFKINAQFLELYNEEVLDLFDSTRDMKQKAHIKIHEDANGGIYTVGVTTRTVSSKAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCASDNQEDETNRVSNGNPEMDEYETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSKRSSHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQDKASQQISALRTEIARLQIELMEY----KTGKRMIG--EDGVESFSDMYHENSMLQTENSNLRVRVKAMQETIDAQRARLTQLLSDQ 456          

HSP 2 Score: 315.079 bits (806), Expect = 8.344e-87
Identity = 154/322 (47.83%), Postives = 203/322 (63.04%), Query Frame = 2
Query: 3950 STHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            S   PLQCV +A+GH K +L +D +D++L TGSKDR  K+W+L    EI SLA H N+V  V+ SSS  L FTV T+YIK+WDIRD  KCI+TL S G    G      T+R    P GEN I  IA + NG  ++ A  NSV++WD+RR+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ GS+G I+P+   +PPHYDG+ESL +   +L SGSRD  IKKWDL     +     AHRDW+ AL         LSGCR GVLKLW+T+    +G+++ HES I ++  +S  +F+AS D  VKIW+
Sbjct: 1186 SRMAPLQCVHVAEGHNKAVLCVDCTDDLLFTGSKDRTCKVWNLVTGQEIMSLAAHPNNVVSVRYSSS--LVFTVSTYYIKVWDIRDSAKCIRTLTSMGQVNIGDICAPNTNRTVAIPAGENQINQIALNPNGTVLYAAAGNSVRVWDLRRFASTGKLMG-HLGPVMCLTVDQSGNNQDLVITGSKDHYIKLFDVTEGSLGSISPTHNFEPPHYDGIESLVVQSDMLFSGSRDNGIKKWDLDRRDLLQQVPNAHRDWVCALGVVPGSPALLSGCRGGVLKLWHTDTLGALGELKGHESPINSITVNSSHLFTASDDRTVKIWR 1504          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif21a (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101173385])

HSP 1 Score: 552.747 bits (1423), Expect = 4.927e-168
Identity = 281/456 (61.62%), Postives = 357/456 (78.29%), Query Frame = 2
Query:  173 DASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDS-NLDDNLN----GETETD-YETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDG--GYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEK 1516
            ++SV+VA+R+RPQ ARE+++   IC  V P EPQ+ +GKDKAFTYDFVF++ S+QD I++T  + LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD+++   ++GIIPR V +LF  I++ R   +++  PVP+FKI AQFLELYNEE++DL D      +K+HIKIHE+  G IY  GV+TR VSS  + ++CLK G L R+TAST MN  SSRSHAIFT+H+ Q R+  S N +D  N    G  E D YETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGD++KR  HVPYR+SKLTRLLQDSLGGNSQT+MIACISPSD DF+ETLNTL YANRARNIKNK+ +NQDKAS+Q++A+R +I  LQ EL+EY    K GK+     EDG   +SD+Y EN++LQ+EN   R+++KA+ ETI+A +AR  Q+L+++
Sbjct:    7 ESSVRVALRIRPQLAREKIEGCHICTYVMPGEPQVILGKDKAFTYDFVFDMDSQQDAIYSTCTEKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNIADEELGIIPRAVHHLFKGIEERREAAQEQGRPVPEFKINAQFLELYNEEVLDLFDSTRDMKQKAHIKIHEDANGGIYTVGVTTRTVSSKAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCASDNQEDETNRVSNGNPEMDEYETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSKRSSHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQDKASQQISALRTEIARLQIELMEY----KTGKRMIG--EDGVESFSDMYHENSMLQTENSNLRVRVKAMQETIDAQRARLTQLLSDQ 456          

HSP 2 Score: 316.62 bits (810), Expect = 3.317e-87
Identity = 165/370 (44.59%), Postives = 224/370 (60.54%), Query Frame = 2
Query: 3812 SPLNFRRVV--SQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWK 4915
            SPL+ R++   +Q + ++  V K +T    SP P+  +          S   PLQCV +A+GH K +L +D +D++L TGSKDR  K+W+L    EI SLA H N+V  V+ SSS  L FTV T+YIK+WDIRD  KCI+TL S G    G      T+R    P GEN I  IA + NG  ++ A  NSV++WD+RR+ + GKL G H  PVM L           ++TGSKDHYIK+F+V+ GS+G I+P+   +PPHYDG+ESL +   +L SGSRD  IKKWDL     +     AHRDW+ AL         LSGCR GVLKLW+T+    +G+++ HES I ++  +S  +F+AS D  VKIW+
Sbjct: 1191 SPLSRRKMYDKAQAAADRAKV-KEITQGVISPVPSTKS----------SRMAPLQCVHVAEGHNKAVLCVDCTDDLLFTGSKDRTCKVWNLVTGQEIMSLAAHPNNVVSVRYSSS--LVFTVSTYYIKVWDIRDSAKCIRTLTSMGQVNIGDICAPNTNRTVAIPAGENQINQIALNPNGTVLYAAAGNSVRVWDLRRFASTGKLMG-HLGPVMCLTVDQSGNNQDLVITGSKDHYIKLFDVTEGSLGSISPTHNFEPPHYDGIESLVVQSDMLFSGSRDNGIKKWDLDRRDLLQQVPNAHRDWVCALGVVPGSPALLSGCRGGVLKLWHTDTLGALGELKGHESPINSITVNSSHLFTASDDRTVKIWR 1546          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: KIF21A (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101157410])

HSP 1 Score: 505.368 bits (1300), Expect = 5.337e-162
Identity = 271/483 (56.11%), Postives = 352/483 (72.88%), Query Frame = 2
Query:  197 RVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMI-----DSNLDDNLNGETE-TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKY 1618
            R+RPQ A+E+++   IC  V P EPQ+ +GKDKAFT+D+VF++ S+Q+ I+    + LI+GC EGYNATI AYGQTGSGKTFTMG+GFDI++   ++GIIPR + +LF  I++ R    ++  PVP+FKI AQFLELYNEE++DL D     + + +KS IKIHE+  G IY  GV+TR V+S  + ++CLK G L RSTAST MN  SSRSHAIFT+H+ Q R+      ++  D+ L   +E  ++ETLTAKFHFVDLAGSERLKRTGATG+RAKEGISINCGLLALGNVIS LGD+ KR  HVPYR+SKLTRLLQDSLGGNSQT+MIACISPSD DF+ETLNTL YANRARNIKNK+ +NQD+AS+Q++ +R +I  LQ EL+EY    K GK+        G +D+  EN++LQ+EN   R+++KA+ ETI+A +AR  Q+L+++   N  + K              S+EI  +IE Y
Sbjct:    1 RIRPQLAKEKIESCHICTYVMPGEPQVVLGKDKAFTFDYVFDMESQQETIYTHCTEKLIEGCFEGYNATIFAYGQTGSGKTFTMGTGFDINIGEEELGIIPRAINHLFRGIEERRQAAAEQGTPVPEFKINAQFLELYNEEVLDLFDSTRELEARRQKSGIKIHEDANGGIYTVGVTTRTVTSAAEMMQCLKLGALSRSTASTQMNVQSSRSHAIFTIHLCQVRVCSPDNHENETDNRLANNSEINEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRGKRSTHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDRDFMETLNTLKYANRARNIKNKVVVNQDRASQQISVLRTEIARLQMELMEY----KAGKRMVGENGVEGINDLVHENSMLQTENNNLRMRVKAMQETIDAQRARLTQLLSDQA--NQALAKAGEG----------SEEIGTMIENY 467          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif21b (kinesin family member 21B [Source:NCBI gene;Acc:101170998])

HSP 1 Score: 531.176 bits (1367), Expect = 2.038e-159
Identity = 274/465 (58.92%), Postives = 344/465 (73.98%), Query Frame = 2
Query:  170 SDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQ---DGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGET---------------ETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLA 1510
            SD  VKVA+RVRPQ A E+++   +C  VTP EPQ+ +GKDKAFTYDFVF++ S+Q  ++ T    LI+GC EGYNAT+ AYGQTGSGKT+TMG+GFD++L   + GIIPR V  LF  I   R   ++  +  P+FK+ AQFLELYNEE++DL D     + +++KS+I+IHE+  GSIY TGV++RLV S E+ L+CLK G L R+TAST MN+ SSRSHAIFT+H+ Q R+    L  N  GET               + +YETL AKFHFVDLAGSERLKRTGATGERA+EGISINCGLLALGNVIS LGD++K+G HVPYR+SKLTRLLQDSLGGNS T+MIAC+SPSD DF+ETLNTL YANRARNIKNK+ +NQDK S+Q++A+R +I  LQ EL+EY    K GK+ A      GYSD+Y EN +LQ +N   RL++KA+ ETI+ L +R   +LA
Sbjct:    5 SDCCVKVALRVRPQMANEKIEGCHVCTLVTPGEPQVLLGKDKAFTYDFVFDLDSEQHLVYQTCVYKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNLGLQEQGIIPRAVHQLFEGIQSRRLRAQQAGVQAPEFKVSAQFLELYNEEILDLFDGTRDPESRNRKSNIRIHEDATGSIYTTGVTSRLVHSEEELLQCLKFGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVC-QQLQMNGGGETGELDGVNGLDSNPIAQPEYETLMAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKKGGHVPYRDSKLTRLLQDSLGGNSHTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEY----KAGKRVACEDGSEGYSDLYQENTMLQRDNDTLRLRVKAMQETIDHLNSRVTHLLA 464          

HSP 2 Score: 304.294 bits (778), Expect = 3.139e-83
Identity = 171/423 (40.43%), Postives = 236/423 (55.79%), Query Frame = 2
Query: 3686 SLARRQLTWKHPGGSMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPT--------------KGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIW 4912
            SL  R  T+        TS I  R S D   +  +   TPP+SP         RS N  NVF RLTS ++  +                +G I  +       T  PLQCVS+A+GH KP+L +D +D +L TGSKDR  K+W+L    EI++L  H N+V  VK   S+ L F+V T YIK+WD+RD  KC++TL SSG    G      T+R      GE  I  I  + +G+ ++ A  N V++WD+ R  A GKL G H   VM L           ++TGSKDHY+KVF+V+ G++G + P+   +PPHYDG+E LA+   +L SGSRD  IKKW+L   +       AH+DW+ AL +   +   LSGCR G+LK+WN +N   IG+V+ H+S I A+ ++S +IF+ASSD  VKIW
Sbjct: 1257 SLPVRGHTFPRQSRGYETSPITRRKSYDRAYRP-TDGYTPPSSP-------PLRSRNDRNVFSRLTSNQAQGSALDKSDDSDSSLSEVLRGVINPIGGVKGGRT-APLQCVSVAEGHSKPVLCVDATDELLFTGSKDRTCKMWNLVTGQEIATLKGHPNNVVSVKYCPSSGLVFSVSTSYIKVWDVRDSAKCVRTLVSSGQVISGDACAGTTTRTINFSQGECQINQIVLNPSGSLLYAAAGNIVRMWDLNRMQATGKLTG-HIGSVMCLTVGQSLLGKDQVITGSKDHYVKVFDVAEGTLGNVGPAHNFEPPHYDGIECLAVQGDVLFSGSRDNGIKKWELEQQELTQQIPNAHKDWVCALAYVPGRPMLLSGCRGGMLKVWNVDNFTPIGEVRGHDSPINAICTNSRQIFTASSDKTVKIW 1669          

HSP 3 Score: 176.407 bits (446), Expect = 9.817e-44
Identity = 92/189 (48.68%), Postives = 138/189 (73.02%), Query Frame = 2
Query: 2054 LATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRR 2620
            LA L+ EI++K++LI EL+  Q++L  ++  YE +L  LQNKI++T+ ERD+VL NL  +E   EE+  K+K EYE++L E+  +L +LQTA++EH  +LKNQ R + EL+ LQ E+NE+K  KV L K+++EE +R R+VE  RN+EI QL+KE+R  + QIR LE +K +++ +L+RK +EV ALRR
Sbjct:  665 LADLTCEIEIKQKLIDELENSQRRLLMLKLQYEEKLILLQNKIRDTQMERDRVLQNLMSMENYTEEKANKIKQEYEKRLKEMNRDLLKLQTAQKEHARLLKNQGRYERELKKLQCEVNEMKKAKVTLMKQMKEEQQRRRMVEAKRNREIAQLKKEQRRQEYQIRALESQKRQQDLVLRRKTQEVTALRR 853          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000060958.1 (SMESG000060958.1)

HSP 1 Score: 2983.74 bits (7734), Expect = 0.000e+0
Identity = 1595/1599 (99.75%), Postives = 1595/1599 (99.75%), Query Frame = 2
Query:  140 MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANXXXXXXXXXXXPIDTDIPGNLSNQXXXXXXXXXXXXXXXXKKTISKRKPATPEELLGVNKNAADRXXXXXXXXXXXXXXXXXXIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWKRNLPDEF 4936
            MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCRSTASTNMNSASSRSHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQ    GKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYTLETEELRARLAEAEAMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVSNAEDSLDDDDESDAENQDAENYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEMKNIKSQIESVQEEISECQSNILEVEESQLEESVSDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANESDDEDDCEESPIDTDIPGNLSNQSRNSSAFNYSFSNSDSKKTISKRKPATPEELLGVNKNAADRSSLSFNFENNNNSSLTSNIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKSSSDRIFSASSDCKVKIWKRNLPDEF
Sbjct:    1 MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCRSTASTNMNSASSRSHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQ----GKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYTLETEELRARLAEAEAMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVSNAEDSLDDDDESDAENQDAENYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEMKNIKSQIESVQEEISECQSNILEVEESQLEESVSDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANESDDEDDCEESPIDTDIPGNLSNQSRNSSAFNYSFSNSDSKKTISKRKPATPEELLGVNKNAADRSSLSFNFENNNNSSLTSNIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKSSSDRIFSASSDCKVKIWKRNLPDEF 1595          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000060958.1 (SMESG000060958.1)

HSP 1 Score: 2905.93 bits (7532), Expect = 0.000e+0
Identity = 1566/1599 (97.94%), Postives = 1566/1599 (97.94%), Query Frame = 2
Query:  140 MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQSSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYXXXXXXXXXXXXXXXXMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLSEWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVXXXXXXXXXXXXXXXXXXXXXXYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEMKNXXXXXXXXXXXXXXXXXNIXXXXXXXXXXXXXDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANXXXXXXXXXXXPIDTDIPGNLSNQXXXXXXXXXXXXXXXXKKTISKRKPATPEELLGVNKNAADRXXXXXXXXXXXXXXXXXXIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKXXXXXXXXXXXDCKVKIWKRNLPDEF 4936
            MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCRSTASTNMNSASSRSHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQ    GKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYTLETEELRARLAEAEAMVHVLQRSNTISSAVEFSKHTHVSMS                             KKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVSNAEDSLDDDDESDAENQDAENYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEMKNIKSQIESVQEEISECQSNILEVEESQLEESVSDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANESDDEDDCEESPIDTDIPGNLSNQSRNSSAFNYSFSNSDSKKTISKRKPATPEELLGVNKNAADRSSLSFNFENNNNSSLTSNIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKSSSDRIFSASSDCKVKIWKRNLPDEF
Sbjct:    1 MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCRSTASTNMNSASSRSHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQ----GKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKARNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYTLETEELRARLAEAEAMVHVLQRSNTISSAVEFSKHTHVSMSA----------------------------KKSEVGDNENGSTFICSISETGDIIQQIASGSSDVDKDSLNGDAEEVSNAEDSLDDDDESDAENQDAENYLHQSLATLSSEIDVKKRLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEVTNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRLLQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQIRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNPPVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSFEQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEMKNIKSQIESVQEEISECQSNILEVEESQLEESVSDIIGNCSLDEAQYLLEQVYQLAVNKGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIFANESDDEDDCEESPIDTDIPGNLSNQSRNSSAFNYSFSNSDSKKTISKRKPATPEELLGVNKNAADRSSLSFNFENNNNSSLTSNIKRTIHTVQTPTETSKGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTTSLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTSTRSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILLTGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIKMWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSNNGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTLVTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGSRDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKLWNTENCAYIGDVQAHESGITALKSSSDRIFSASSDCKVKIWKRNLPDEF 1567          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000024428.1 (SMESG000024428.1)

HSP 1 Score: 324.709 bits (831), Expect = 2.448e-90
Identity = 180/399 (45.11%), Postives = 255/399 (63.91%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI------QDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQ---RMIDSNLDDNLNGETETDYE---TLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGD-KAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAEL 1324
            S++ +V+V  RVRP   +E++   + C  V+P+  Q+ +GKD+ FT+D VFN  S QDEI+ T  K L+    +GYN+TI AYGQTGSGKT+TMG+     L   + GI+PR V+ +F  I + +   K        F + A F+E+Y EE+ DLLD       QDG    + I+I E+  G+  L GV   L  +  D L+CL+ G+  R T +T MN  SSRSH +FT+++ Q+     +D +L    N E++   E    ++ KFHFVDLAGSER  +TG  G+R KE I IN GLLALGNVIS LGD K K+  H+PYR SK+TR+L+DSLGGN++T+MI CISP+  ++ E+LN+L YANRARNI+NK  +N D  ++Q+  M+ +I +L+ +L
Sbjct:    6 STETNVRVVTRVRPLLVKEKLNGEESCIRVSPDLKQVIVGKDRGFTFDAVFNQKSNQDEIYQTCVKDLVKNIFDGYNSTIFAYGQTGSGKTYTMGTFNQEELIHEEKGIVPRAVEEIFTLITEKQNLVK--------FTVTASFIEVYKEEVRDLLDPSGNFSGQDG----TSIQIREDERGNTILCGVYEHLCENQSDLLECLEIGSANRVTEATQMNEHSSRSHCVFTVNVVQEWSTSCVDLDLSYTENSESDKKNEIKNVVSGKFHFVDLAGSERAHKTGNVGDRFKESIHINSGLLALGNVISALGDPKKKKISHIPYRESKITRILKDSLGGNARTLMICCISPTISNYDESLNSLKYANRARNIRNKPIVNHDHTTRQIVQMQSEIIALREQL 392          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000024428.1 (SMESG000024428.1)

HSP 1 Score: 324.709 bits (831), Expect = 2.680e-90
Identity = 180/399 (45.11%), Postives = 255/399 (63.91%), Query Frame = 2
Query:  167 SSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDI------QDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQ---RMIDSNLDDNLNGETETDYE---TLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGD-KAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAEL 1324
            S++ +V+V  RVRP   +E++   + C  V+P+  Q+ +GKD+ FT+D VFN  S QDEI+ T  K L+    +GYN+TI AYGQTGSGKT+TMG+     L   + GI+PR V+ +F  I + +   K        F + A F+E+Y EE+ DLLD       QDG    + I+I E+  G+  L GV   L  +  D L+CL+ G+  R T +T MN  SSRSH +FT+++ Q+     +D +L    N E++   E    ++ KFHFVDLAGSER  +TG  G+R KE I IN GLLALGNVIS LGD K K+  H+PYR SK+TR+L+DSLGGN++T+MI CISP+  ++ E+LN+L YANRARNI+NK  +N D  ++Q+  M+ +I +L+ +L
Sbjct:    6 STETNVRVVTRVRPLLVKEKLNGEESCIRVSPDLKQVIVGKDRGFTFDAVFNQKSNQDEIYQTCVKDLVKNIFDGYNSTIFAYGQTGSGKTYTMGTFNQEELIHEEKGIVPRAVEEIFTLITEKQNLVK--------FTVTASFIEVYKEEVRDLLDPSGNFSGQDG----TSIQIREDERGNTILCGVYEHLCENQSDLLECLEIGSANRVTEATQMNEHSSRSHCVFTVNVVQEWSTSCVDLDLSYTENSESDKKNEIKNVVSGKFHFVDLAGSERAHKTGNVGDRFKESIHINSGLLALGNVISALGDPKKKKISHIPYRESKITRILKDSLGGNARTLMICCISPTISNYDESLNSLKYANRARNIRNKPIVNHDHTTRQIVQMQSEIIALREQL 392          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000063375.1 (SMESG000063375.1)

HSP 1 Score: 283.878 bits (725), Expect = 1.070e-78
Identity = 174/386 (45.08%), Postives = 236/386 (61.14%), Query Frame = 2
Query:  176 ASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGF-DISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCXXXXXXXXXXXXXXXHAIFTLHIKQQRMIDSNLDDNLNGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAK-RGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQ-DKASKQLAAMRMQIESLQAEL 1324
            +S++V VR RP    E     Q C    P    I IG  K FT+D VF+  + Q+EI+    + +I+    GYN T+LAYGQTGSGKT+TMG+ F DI + S + G+IPR +  +++ +D +R              +   F+E+YNE++ DLL       +  HI+  EN    I +  +    V+  ED  KCL  G+  R   ST MN  SSRSHAIFT++I    + D+N          T +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L +K K +  HVPYR SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TLNYA RAR I+NK  IN+ D A  ++  +R Q+ +LQA+L
Sbjct:    5 SSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISS-ESGVIPRAISDIYDYLDPLR--------ETATVCVKVSFIEVYNEDIFDLLS---STKEMRHIR-EENQ--DIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSDAN--------ECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 366          
The following BLAST results are available for this feature:
BLAST of Kinesin protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF21A1.111e-16158.73kinesin family member 21A [Source:HGNC Symbol;Acc:... [more]
KIF21A1.198e-16158.73kinesin family member 21A [Source:HGNC Symbol;Acc:... [more]
KIF21A2.252e-16158.73kinesin family member 21A [Source:HGNC Symbol;Acc:... [more]
KIF21A2.263e-16158.73kinesin family member 21A [Source:HGNC Symbol;Acc:... [more]
KIF21A9.280e-16158.90kinesin family member 21A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-125.388e-12851.75Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-127.520e-12851.75Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-192.479e-7643.15Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
osm-34.870e-7342.71Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
klp-201.403e-6940.52Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klp31E0.000e+040.58gene:FBgn0032243 transcript:FBtr0302039[more]
Klp31E0.000e+040.58gene:FBgn0032243 transcript:FBtr0080018[more]
Klp31E0.000e+040.58gene:FBgn0032243 transcript:FBtr0302038[more]
Klp31E3.083e-14754.66gene:FBgn0032243 transcript:FBtr0331642[more]
Klp3A5.012e-7339.55gene:FBgn0011606 transcript:FBtr0340093[more]
back to top
BLAST of Kinesin protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif21b2.113e-16359.34kinesin family member 21B [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21b1.289e-16259.41kinesin family member 21B [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21a3.118e-16158.84kinesin family member 21A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21a6.349e-15859.16kinesin family member 21A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif42.785e-9545.14kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif21a4.002e-16459.52kinesin family member 21A [Source:NCBI gene;Acc:10... [more]
kif21a1.026e-16359.52kinesin family member 21A [Source:NCBI gene;Acc:10... [more]
kif21a2.589e-16358.73kinesin family member 21A [Source:NCBI gene;Acc:10... [more]
kif21a3.391e-16358.73kinesin family member 21A [Source:NCBI gene;Acc:10... [more]
kif21a1.371e-16258.73kinesin family member 21A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif21a8.244e-16459.13kinesin family member 21A [Source:MGI Symbol;Acc:M... [more]
Kif21a1.008e-16359.13kinesin family member 21A [Source:MGI Symbol;Acc:M... [more]
Kif21a1.453e-16359.13kinesin family member 21A [Source:MGI Symbol;Acc:M... [more]
Kif21a1.574e-16359.13kinesin family member 21A [Source:MGI Symbol;Acc:M... [more]
Kif21a2.081e-16359.13kinesin family member 21A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QXL2|KI21A_MOUSE1.455e-16259.13Kinesin-like protein KIF21A OS=Mus musculus OX=100... [more]
sp|Q7Z4S6|KI21A_HUMAN1.082e-16058.73Kinesin-like protein KIF21A OS=Homo sapiens OX=960... [more]
sp|Q9QXL1|KI21B_MOUSE2.760e-16058.61Kinesin-like protein KIF21B OS=Mus musculus OX=100... [more]
sp|F1M5N7|KI21B_RAT3.763e-16058.87Kinesin-like protein KIF21B OS=Rattus norvegicus O... [more]
sp|O75037|KI21B_HUMAN2.070e-15958.48Kinesin-like protein KIF21B OS=Homo sapiens OX=960... [more]
back to top
BLAST of Kinesin protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PKG50.000e+040.50Uncharacterized protein OS=Pomacea canaliculata OX... [more]
V5HJ080.000e+039.95Putative kinesin-like protein kif21a OS=Ixodes ric... [more]
A0A0L8H2L90.000e+040.16Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A0L8H2I00.000e+039.94Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A1B6CPU20.000e+039.60Uncharacterized protein OS=Clastoptera arizonana O... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif21a3.123e-16157.94kinesin family member 21A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21a5.043e-16156.71kinesin family member 21A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21b1.042e-16058.64kinesin family member 21B [Source:NCBI gene;Acc:10... [more]
kif21b2.468e-16058.64kinesin family member 21B [Source:NCBI gene;Acc:10... [more]
kif21b2.711e-16058.64kinesin family member 21B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF273.051e-9142.18kinesin family member 27 [Source:HGNC Symbol;Acc:H... [more]
kif3a6.846e-7642.61kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3ca8.494e-6537.88kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
kif16bb8.097e-6140.00kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000010617.11.076e-5944.06pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 ge... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP36.644e-5538.81Kinesin-related antiparallel sliding motor protein... [more]
KIP12.622e-5236.46Kinesin-related motor protein; required for mitoti... [more]
KIP21.212e-3929.48Kinesin-related motor protein involved in mitotic ... [more]
KAR35.049e-3937.34Minus-end-directed microtubule motor; functions in... [more]
CIN81.541e-2940.00Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496299.131e-10148.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499904.171e-8146.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375292.185e-7442.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396103.320e-6941.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478181.102e-6540.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif21a2.481e-16861.62kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
kif21a3.047e-16861.62kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
kif21a4.927e-16861.62kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
KIF21A5.337e-16256.11kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
kif21b2.038e-15958.92kinesin family member 21B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060958.10.000e+099.75SMESG000060958.1[more]
SMESG000060958.10.000e+097.94SMESG000060958.1[more]
SMESG000024428.12.448e-9045.11SMESG000024428.1[more]
SMESG000024428.12.680e-9045.11SMESG000024428.1[more]
SMESG000063375.11.070e-7845.08SMESG000063375.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000644 ID=SMED30000644|Name=Kinesin protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5128bp
CAAATAAACTATAAGCCAATGATTATTTTAATTTCTAATTTAATTATGCT
GAAAATGAATAAATGTTAATTAATTTCTTTAAAATTAATAGTTTAGCATT
AATAATTTGGTTTTAAATTGGAAATATAAAATTTCATAAATGACTGTGGC
TAATGAATCTAATGAATCATCCGATGCAAGCGTTAAGGTAGCTGTTAGAG
TTAGACCTCAAAATGCAAGAGAACGAATGCAGATGAATCAAATTTGTGCT
AGCGTTACACCAAATGAACCTCAAATATACATTGGCAAAGATAAAGCATT
TACTTATGATTTTGTATTTAATATACTATCGAAGCAAGATGAAATTTTTA
ACACTTTAGCAAAACCACTTATTGATGGATGCCTGGAAGGTTATAATGCA
ACAATTCTTGCATACGGACAGACTGGATCTGGGAAAACATTTACCATGGG
ATCTGGATTCGATATTTCCCTTGATTCAGTTGACGTAGGAATAATTCCCC
GTGGCGTACAGTACTTATTTAATAGGATTGACAAAATAAGGACGGATTAC
AAAAAGAAAATGTTACCAGTTCCAGATTTTAAAATTGTAGCCCAATTTCT
GGAGTTATACAATGAAGAACTGATTGATCTGCTTGATATCCAAGATGGGA
AAGATAAGAAATCTCACATAAAGATACACGAAAATACGGGAGGAAGTATT
TACCTTACAGGCGTATCAACAAGATTAGTATCTTCTTTAGAAGATACCCT
TAAATGCTTAAAGGATGGAACATTATGCAGAAGTACCGCCAGTACTAATA
TGAATAGTGCATCATCGAGATCGCATGCTATCTTTACGCTGCACATAAAA
CAACAGAGAATGATTGATTCAAATTTGGATGACAATCTTAACGGTGAGAC
CGAAACTGATTATGAAACTTTAACTGCAAAATTTCATTTTGTTGATTTGG
CTGGTAGTGAGAGACTGAAACGTACAGGTGCAACGGGAGAAAGAGCTAAA
GAAGGAATATCCATCAATTGTGGATTGCTTGCTCTTGGAAATGTCATCTC
TACTCTTGGTGATAAAGCTAAACGTGGTTGTCACGTTCCTTATCGAAATT
CAAAATTAACTCGACTGTTGCAAGACTCTCTTGGTGGAAATTCTCAAACA
ATTATGATTGCATGTATTTCACCTTCAGATTGCGATTTTCTAGAGACCCT
AAACACTTTGAATTATGCGAATCGAGCCAGAAATATCAAAAATAAGTTAA
CTATCAATCAAGATAAAGCCAGTAAACAATTGGCAGCGATGAGAATGCAA
ATTGAAAGTCTTCAAGCCGAATTGTTGGAATATCAGCAGAGTTCAAAATT
GGGTAAAAAATCAGCTGACTCCAAAGAAGACGGGGGTTACAGCGACATCT
ACACAGAAAATAATATATTACAGTCTGAAAATCAGGGATTTAGACTCAAA
ATTAAGGCGTTATCGGAGACTATAGAAGCTCTCAAGGCACGCAATGCCCA
AGTACTTGCTGAGAAGGAAGCGTTCAATTGGCAAATGGTAAAGCAAAATA
GTAATTGCACTGGACTCAATATTTTGGATATCGAATCGGATGAAATCATG
AAGGTTATCGAGAAATACACTCTTGAAACTGAAGAATTAAGAGCTAGGTT
GGCAGAAGCTGAAGCAATGGTTCATGTATTGCAAAGGTCAAATACAATAT
CTTCCGCAGTAGAGTTTTCTAAGCATACACATGTTTCAATGTCAGGTGAG
TTTCCCGAAGAGGATGCTTTATTTGACAGCACTTTATCTGAATGGGATTC
ATTTATTGTACATCCGAAACGTCGAAAAACTAAAAAATCCGAAGTTGGGG
ACAACGAAAATGGTTCGACATTTATATGTTCGATAAGTGAAACTGGAGAC
ATAATTCAACAGATTGCATCCGGTTCAAGTGATGTGGATAAGGATAGCTT
AAATGGTGACGCGGAGGAAGTTAGTAATGCAGAAGATAGTTTAGATGATG
ACGATGAAAGTGACGCGGAAAATCAAGATGCTGAAAACTATTTGCATCAG
AGTTTAGCTACTTTATCTTCCGAAATTGACGTAAAGAAAAGGCTTATTAG
TGAGTTGCAAACCAAGCAGAAGCAATTGAAGAAAATCCGACAGCACTATG
AATCCCAGTTAGAGGCTTTGCAAAATAAGATTAAAGAAACCGAGCATGAA
AGAGATCAAGTTCTTGCCAATCTAGGAGAAGTAGAAGTGACAAATGAAGA
GAGAGTTCGAAAAGTTAAAAATGAATACGAAAGAAAATTGTCTGAGTTGA
AGTCGGAGCTCAATCAATTACAAACCGCAAAACGAGAGCATACGATAATG
CTGAAAAATCAGCAACGTAAAGATCACGAATTGCGTTTACTACAAAAAGA
ATTAAATGAGTTAAAAAGTATGAAAGTGCAATTGTCGAAAAAGCTTCGCG
AAGAAGCTAAAAGAACTCGAGTAGTGGAAACAACTCGTAATAAAGAAATT
GTTCAATTGAGAAAAGAAAAACGGCTAGCAGACAATCAAATTCGAAATTT
GGAGCAGGAAAAGATGAGAAAAAACCAAATATTGAAAAGGAAACAAGAAG
AAGTTGAAGCTCTACGGCGTCGCCAACATGTTATTGGAACAAATATTTCA
AAATCTCGACAAGTCGTAGTCTCGGCTCATAGTAATCCTCCAGTCACTGT
AAAATCCCAATCAAAACCAATGCCGAAAAATCATGTCAGGCGCAATTCTT
TACTAGCTAAGTTAACAAGATCTAAATGGAATTCCATTGAGAATGCTCTA
AAGAAAACCATTATCAGACGTCATACTATTAATAGCTTTGAACAGGATAT
GAATACACGTGTTAAAGAAAGAGAGAAATTGGGAATCAAATATCAAAAAC
TTGAAAATCGTCGGTCAGAATATGCAAAGGACGGTAGAACTACTGATGAA
ATTGTTTATGAAATGAAAAATATAAAATCACAAATTGAAAGTGTTCAAGA
AGAAATTAGTGAATGTCAATCCAATATATTGGAAGTTGAAGAATCACAGT
TGGAAGAGTCAGTTTCAGATATAATAGGCAATTGTTCATTGGATGAAGCT
CAATATTTACTAGAACAAGTCTATCAGCTCGCAGTGAACAAAGGAATTTT
GGCCCAAACTCTCGAAATGCAAGAAAATGGTTTGAAGTTTCAGTTGGAAG
CTAAATTCCAAGAAAGAGAACAAGCTCTAGATATGTTGAGGATTGCTTTG
CAGCACTCAACTGTACCTTTTGATATGGACGGAATTTTCGCAAATGAATC
GGACGATGAGGATGATTGTGAAGAAAGCCCGATAGATACCGACATCCCTG
GTAATCTCAGCAATCAATCTCGAAATTCTAGCGCCTTCAATTATTCTTTT
TCCAATTCTGATAGCAAAAAAACTATAAGTAAAAGGAAACCAGCTACTCC
TGAAGAACTGCTTGGTGTAAATAAAAATGCTGCCGATAGATCATCGTTGA
GTTTCAATTTTGAAAATAACAACAATTCCTCATTGACATCCAATATAAAA
AGAACAATTCATACTGTCCAGACTCCAACTGAAACCTCAAAAGGATTGTT
GGTAAACAATTCTGATGCATGGAAAGACATGTCAAATAATAACGATGAAA
ATAAATCAAAAATCAATAGTTGTGTAAATTCTAAGTCTTTGGCCAGGCGA
CAGCTTACGTGGAAACATCCAGGAGGATCTATGACGACCAGCTTAATAGT
TTCCAGAAACAGCACAGATGATGATATTCAACATTTTAGCACCGCTGAAA
CTCCTCCTGCTAGTCCATTGAATTTCCGGCGAGTCGTAAGTCAAAGGTCT
CATAATCAAGAAAATGTTTTTAAAAGATTGACAAGTACTCGTTCATCCCC
TAATCCAACAAAAGGAACTATAACTTCACTTTCCAAAAAAAATCCTTTAT
CAACGCATGTTCCTTTACAATGTGTCTCAATAGCAGATGGACACCAAAAA
CCAATATTAGATTTGGATGTTTCTGATAACATACTGCTTACTGGTAGTAA
AGATCGATGTGCGAAAATTTGGGATTTAAATAAGTTTGTCGAAATCAGTT
CATTGGCTGAACACCAAAATAGTGTAACCAAGGTGAAAATTTCTAGTTCC
ACAAATCTAGCCTTTACTGTTTGCACGTTCTACATCAAAATGTGGGATAT
CAGAGACTGTAAAAAGTGTATTAAAACCTTGTGGTCAAGTGGTTTAAGTC
AAGACGGGCCACCAGAGTTTTCCCAGACTAGTAGACAAACTGTTTGTCCA
CCCGGAGAAAATTACATAATGGATATTGCTTTTAGTAATAACGGAAATAC
AATGTTCCTTGCAACGGCAAACTCAGTTAAATTGTGGGATATGAGACGAT
ATTGTGCAGTCGGAAAACTCCATGGAAATCACCAAGCTCCAGTTATGGTT
TTGGCGGCTTCCGATAGAGACAGATGTTCTTCTACATTGGTTACTGGATC
TAAGGATCATTATATCAAAGTTTTTGAAGTTTCTCCGGGATCTGTTGGTT
TGATAACTCCTTCCATAGAACTACAGCCTCCGCATTATGATGGGGTGGAG
TCTTTAGCTTTAAATGATCAAATATTATTATCTGGTTCACGAGATGCTTG
CATTAAAAAATGGGATTTGGCAACTTCTCAGCCGGTAGCATCTTTCAGCC
AAGCACACAGAGATTGGATTCAAGCATTGTGCTTTACTTCAGATAAAACT
CACTTTCTTAGTGGATGCAGATCAGGTGTTCTGAAATTATGGAACACAGA
AAACTGTGCTTATATTGGAGATGTTCAGGCTCACGAATCCGGTATCACAG
CTTTAAAATCCTCCTCAGATCGTATTTTTTCTGCCTCTAGTGATTGTAAA
GTGAAAATATGGAAAAGAAACCTACCAGATGAATTTTAACTTAATAATAT
ATTGTAAAAATGCAAGAAAATAGAACATCAATTTACTTTCTGGATTATTC
TAGATTTTTAAGTTTTTTGTGGTCAATAGAGAAAACATCAATTTTAAGAT
TAATAAATATTCACGTACTTGTATTGAATAATCATAGATACCTTTCTGTT
GTCACTTATATTTTGTAAACTCATTCAA
back to top

protein sequence of SMED30000644-orf-1

>SMED30000644-orf-1 ID=SMED30000644-orf-1|Name=SMED30000644-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1600bp
MTVANESNESSDASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGK
DKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKT
FTMGSGFDISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIV
AQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSL
EDTLKCLKDGTLCRSTASTNMNSASSRSHAIFTLHIKQQRMIDSNLDDNL
NGETETDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALG
NVISTLGDKAKRGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDF
LETLNTLNYANRARNIKNKLTINQDKASKQLAAMRMQIESLQAELLEYQQ
SSKLGKKSADSKEDGGYSDIYTENNILQSENQGFRLKIKALSETIEALKA
RNAQVLAEKEAFNWQMVKQNSNCTGLNILDIESDEIMKVIEKYTLETEEL
RARLAEAEAMVHVLQRSNTISSAVEFSKHTHVSMSGEFPEEDALFDSTLS
EWDSFIVHPKRRKTKKSEVGDNENGSTFICSISETGDIIQQIASGSSDVD
KDSLNGDAEEVSNAEDSLDDDDESDAENQDAENYLHQSLATLSSEIDVKK
RLISELQTKQKQLKKIRQHYESQLEALQNKIKETEHERDQVLANLGEVEV
TNEERVRKVKNEYERKLSELKSELNQLQTAKREHTIMLKNQQRKDHELRL
LQKELNELKSMKVQLSKKLREEAKRTRVVETTRNKEIVQLRKEKRLADNQ
IRNLEQEKMRKNQILKRKQEEVEALRRRQHVIGTNISKSRQVVVSAHSNP
PVTVKSQSKPMPKNHVRRNSLLAKLTRSKWNSIENALKKTIIRRHTINSF
EQDMNTRVKEREKLGIKYQKLENRRSEYAKDGRTTDEIVYEMKNIKSQIE
SVQEEISECQSNILEVEESQLEESVSDIIGNCSLDEAQYLLEQVYQLAVN
KGILAQTLEMQENGLKFQLEAKFQEREQALDMLRIALQHSTVPFDMDGIF
ANESDDEDDCEESPIDTDIPGNLSNQSRNSSAFNYSFSNSDSKKTISKRK
PATPEELLGVNKNAADRSSLSFNFENNNNSSLTSNIKRTIHTVQTPTETS
KGLLVNNSDAWKDMSNNNDENKSKINSCVNSKSLARRQLTWKHPGGSMTT
SLIVSRNSTDDDIQHFSTAETPPASPLNFRRVVSQRSHNQENVFKRLTST
RSSPNPTKGTITSLSKKNPLSTHVPLQCVSIADGHQKPILDLDVSDNILL
TGSKDRCAKIWDLNKFVEISSLAEHQNSVTKVKISSSTNLAFTVCTFYIK
MWDIRDCKKCIKTLWSSGLSQDGPPEFSQTSRQTVCPPGENYIMDIAFSN
NGNTMFLATANSVKLWDMRRYCAVGKLHGNHQAPVMVLAASDRDRCSSTL
VTGSKDHYIKVFEVSPGSVGLITPSIELQPPHYDGVESLALNDQILLSGS
RDACIKKWDLATSQPVASFSQAHRDWIQALCFTSDKTHFLSGCRSGVLKL
WNTENCAYIGDVQAHESGITALKSSSDRIFSASSDCKVKIWKRNLPDEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR036322WD40_repeat_dom_sf
IPR001752Kinesin_motor_dom
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019821Kinesin_motor_CS
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003774motor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 911..931
NoneNo IPR availableCOILSCoilCoilcoord: 942..969
NoneNo IPR availableCOILSCoilCoilcoord: 703..775
NoneNo IPR availableCOILSCoilCoilcoord: 490..517
NoneNo IPR availableCOILSCoilCoilcoord: 431..458
NoneNo IPR availableCOILSCoilCoilcoord: 787..828
NoneNo IPR availableCOILSCoilCoilcoord: 374..401
NoneNo IPR availableCOILSCoilCoilcoord: 639..694
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1054..1076
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 612..628
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 841..863
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 596..628
NoneNo IPR availablePANTHERPTHR24115:SF398KINESIN-LIKE PROTEIN KIF21Acoord: 13..829
NoneNo IPR availablePANTHERPTHR24115:SF398KINESIN-LIKE PROTEIN KIF21Acoord: 874..1010
NoneNo IPR availableCDDcd00200WD40coord: 1278..1592
e-value: 5.99081E-50
score: 177.142
NoneNo IPR availableCDDcd01372KISc_KIF4coord: 14..367
e-value: 1.25866E-180
score: 541.151
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 219..236
score: 58.38
coord: 84..105
score: 68.56
coord: 264..282
score: 55.92
coord: 316..337
score: 69.28
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 12..374
e-value: 2.1E-154
score: 528.9
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 20..366
e-value: 1.1E-100
score: 336.9
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 14..366
score: 107.153
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 1555..1592
e-value: 0.0017
score: 27.6
coord: 1512..1552
e-value: 5.1E-7
score: 39.3
coord: 1275..1312
e-value: 1.7E-6
score: 37.5
coord: 1420..1463
e-value: 1.0
score: 16.9
coord: 1315..1353
e-value: 0.95
score: 17.2
coord: 1471..1509
e-value: 0.67
score: 18.1
coord: 1379..1417
e-value: 2.7
score: 14.3
IPR001680WD40 repeatPFAMPF00400WD40coord: 1514..1552
e-value: 0.0093
score: 16.8
coord: 1562..1592
e-value: 0.0084
score: 16.9
coord: 1277..1312
e-value: 0.0047
score: 17.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1562..1592
score: 9.539
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1479..1518
score: 10.074
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1282..1321
score: 11.11
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 1520..1555
score: 9.74
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 7..380
e-value: 2.2E-132
score: 442.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1474..1596
e-value: 8.4E-25
score: 89.1
coord: 1255..1473
e-value: 2.8E-26
score: 93.9
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 13..829
coord: 874..1010
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 263..274
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 1299..1313
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1282..1599
score: 30.769
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 1291..1594
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 14..401