Microtubule-actin cross-linking factor 1-like isoform X28

Overview
NameMicrotubule-actin cross-linking factor 1-like isoform X28
Smed IDSMED30000639
Length (bp)6631
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microtubule-actin cross-linking factor 1-like isoform X28 (SMED30000639) t-SNE clustered cells

Violin plots show distribution of expression levels for Microtubule-actin cross-linking factor 1-like isoform X28 (SMED30000639) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microtubule-actin cross-linking factor 1-like isoform X28 (SMED30000639) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microtubule-actin cross-linking factor 1-like isoform X28 (SMED30000639) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000639

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30000639SMESG000017517.1 PL08009A2C06ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000639SMESG000017517.1 PL08009A2C06ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 dd_Smed_v4_6577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000639SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000639SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000639SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000639SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30000639SMESG000017517.1 SMESG000017520.1 SMESG000017519.1 SMED30000639smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000639SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30000639SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30000639SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 262.692 bits (670), Expect = 4.411e-70
Identity = 190/681 (27.90%), Postives = 342/681 (50.22%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK--LQNPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +RL ER R  + A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L +ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID     + E+       + LK   R L E    + S ++  ++E+  ++         +   L+ +L+ A+EF+S ++ L  WL +AE+ L+    LP   +E  L  LI++H+  +K+++E +  +     +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      + ++ +  IP +++ V  +I +H  F+ E++     +  + K +K    +PSS           +A  KR+      Y +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYRFG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct:  470 KVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLP--DDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRF-PASSLYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 1129          

HSP 2 Score: 63.5438 bits (153), Expect = 5.694e-9
Identity = 56/262 (21.37%), Postives = 112/262 (42.75%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++      E S+++N +E +  ++   +   +QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +    +  + T  +    G+ +L  C   A   +++ I     +W  + ++  +R  KL E+L
Sbjct:  126 DKHTVQDP--------LMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEAL 377          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 257.684 bits (657), Expect = 9.167e-68
Identity = 199/753 (26.43%), Postives = 360/753 (47.81%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ--------KSKSMKMSFSXXXXXXXXXXXXDEKPTVKKSIQYQKASSLSSRIPTGLSKK 6284
            K+ +RL ER R  + A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L +ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID     + E+       + LK   R L E    + S ++  ++E+  ++         +   L+ +L+ A+EF+S ++ L  WL +AE+ L+    LP   +E  L  LI++H+  +K+++E +  +     +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      + ++ +  IP +++ V  +I +H  F+ E++     +  + K +K +  +PSS           +A  KR+      Y +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +++           S  M+                 P    S+  Q A + S ++P   + K
Sbjct: 4601 KVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLP--DDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRF-PASSLYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPK 5332          

HSP 2 Score: 63.1586 bits (152), Expect = 7.501e-9
Identity = 56/262 (21.37%), Postives = 112/262 (42.75%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++      E S+++N +E +  ++   +   +QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +    +  + T  +    G+ +L  C   A   +++ I     +W  + ++  +R  KL E+L
Sbjct: 4257 DKHTVQDP--------LMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEAL 4508          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 257.299 bits (656), Expect = 1.240e-67
Identity = 199/753 (26.43%), Postives = 360/753 (47.81%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ--------KSKSMKMSFSXXXXXXXXXXXXDEKPTVKKSIQYQKASSLSSRIPTGLSKK 6284
            K+ +RL ER R  + A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L +ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID     + E+       + LK   R L E    + S ++  ++E+  ++         +   L+ +L+ A+EF+S ++ L  WL +AE+ L+    LP   +E  L  LI++H+  +K+++E +  +     +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      + ++ +  IP +++ V  +I +H  F+ E++     +  + K +K +  +PSS           +A  KR+      Y +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +++           S  M+                 P    S+  Q A + S ++P   + K
Sbjct: 4275 KVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLP--DDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRF-PASSLYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPK 5006          

HSP 2 Score: 63.1586 bits (152), Expect = 9.378e-9
Identity = 56/262 (21.37%), Postives = 112/262 (42.75%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++      E S+++N +E +  ++   +   +QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +    +  + T  +    G+ +L  C   A   +++ I     +W  + ++  +R  KL E+L
Sbjct: 3931 DKHTVQDP--------LMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEAL 4182          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 256.529 bits (654), Expect = 1.375e-67
Identity = 190/687 (27.66%), Postives = 343/687 (49.93%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +RL ER R  + A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L +ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID     + E+       + LK   R L E    + S ++  ++E+  ++         +   L+ +L+ A+EF+S ++ L  WL +AE+ L+    LP   +E  L  LI++H+  +K+++E +  +     +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      + ++ +  IP +++ V  +I +H  F+ E++     +  + K +K +  +PSS           +A  KR+      Y +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 1793 KVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLP--DDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRF-PASSLYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 2458          

HSP 2 Score: 63.5438 bits (153), Expect = 5.666e-9
Identity = 56/262 (21.37%), Postives = 112/262 (42.75%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++      E S+++N +E +  ++   +   +QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +    +  + T  +    G+ +L  C   A   +++ I     +W  + ++  +R  KL E+L
Sbjct: 1449 DKHTVQDP--------LMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEAL 1700          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 257.299 bits (656), Expect = 1.435e-67
Identity = 199/753 (26.43%), Postives = 360/753 (47.81%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ--------KSKSMKMSFSXXXXXXXXXXXXDEKPTVKKSIQYQKASSLSSRIPTGLSKK 6284
            K+ +RL ER R  + A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L +ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID     + E+       + LK   R L E    + S ++  ++E+  ++         +   L+ +L+ A+EF+S ++ L  WL +AE+ L+    LP   +E  L  LI++H+  +K+++E +  +     +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      + ++ +  IP +++ V  +I +H  F+ E++     +  + K +K +  +PSS           +A  KR+      Y +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +++           S  M+                 P    S+  Q A + S ++P   + K
Sbjct: 4641 KVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLP--DDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRF-PASSLYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPK 5372          

HSP 2 Score: 63.1586 bits (152), Expect = 8.874e-9
Identity = 56/262 (21.37%), Postives = 112/262 (42.75%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++      E S+++N +E +  ++   +   +QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +    +  + T  +    G+ +L  C   A   +++ I     +W  + ++  +R  KL E+L
Sbjct: 4297 DKHTVQDP--------LMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEAL 4548          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 162.54 bits (410), Expect = 2.823e-39
Identity = 277/1400 (19.79%), Postives = 548/1400 (39.14%), Query Frame = 3
Query: 2013 VQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFDGVGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIAHSDSISTLTDADNKSTTSSVGFELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVTQFVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLL--ELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKL--------KEMKILTEQIRVLIPEKYVMIQEILKNEKL-LSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELE-----NLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIE---NFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEML-KTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKF--VPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL--KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDM----QNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDL 6128
            + + P     +  E   + + ++ K+ A+  LKQ  ++LL     S  + D                   A D+++ L  +E L + +  +  +R  +L ++ D    +WSE+     ++  ++              ++ +++EP   H + +     AD +   + V  E++                             + +  +L   GK +  +V   E  ++   NQ+  + G F  +    F E   + I   E+A+               F  D ++++ +W ++ E +L+    +   + + EI  L  EL +   E+  +    +++ +   ++ +        T+ +   ++  ++S L   + E+ + L+     +G+L  ++      + +    +K++ P              KN   L D     Q     L   I AH D  +  N   +  +   G L        K M +  E I+ ++ E      E+ K E   +  E+     +LE+  + L      G   E+ E     F     D+    + +E  L     H++    D  T+LS     +  K+ + + L   R++KL +  +  +  ++    ++  I+  E       SI R+ P  I    AE    ++   + A +   + +H       ++ +  + D   +   L     ++ KI  R  ER +       E   + D   +L  ++ +  V I    N      K+   L+++K   + ++ +   F  T + G  L ++ T  +   Y  + M  + +  KW ++   +        + +++ G   ++M  +  W++D + ++       +  D+D V  L+DE      E    +   K +  K   L      E+  I    E +  +++      + R  S++E+ Q A+EF++K + L  WL   E+ LK   L       D VE +++      ++ E K         G+ IL+ C P A   +   +    +RW +++ + ++R   L E     +     IE+L     +   ++   I      D+    QN+ D  N           +DS+++        Q P                          D+  KS    + N     L+T++ KLW  ++  + +L N    L E ++L  + +  WK+ ++ +      R+ DLFRR      G    + F + II S FPT++  + +V + F+K +   I  ++FI++LR +       N N   +     I H+I E +   C+C   Y +++  +N YRFG      MVR L STVMVR+GGGW+++ EFL K+DPCR    L++
Sbjct: 3556 ISADPSVLESRLAENRSIVESLRDKQNAYDALKQTASELL----ASAPEGDAA-----------------AGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLR--------------NRLELVEPATGHPEQL-----ADQQEIMAQVASEMER---------------------------ARPRIEALSIAGKQLADYVPDDEKAVIE--NQVANVRGGFSTI-TGLFAEKKRDLIAAMEEAM--------------TFHGD-LQELLKWLDMAEQKLLKMSPVEHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPP-------------KNAVNLRD-IEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTSGALDAETSDSLKSMNLKWEDIQKVL-ESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKTHGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRL-PDVIEKQLAEHESWME---EVAGRKMAMTKH-QASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSE---YKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL-------DEVEGVKQ------EMDEAKGRYQECLKKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQNEQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFAN-----------LDSELRE-------QQPEV------------------------DAACKSAKKGARNPAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSKFPTSRLEMAKVADRFDKGDGM-INAKEFINALRFDA-----SNRNAKPQTDTEKITHEI-ELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNI 4785          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 162.155 bits (409), Expect = 3.341e-39
Identity = 276/1400 (19.71%), Postives = 547/1400 (39.07%), Query Frame = 3
Query: 2013 VQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFDGVGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIAHSDSISTLTDADNKSTTSSVGFELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVTQFVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLL--ELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKL--------KEMKILTEQIRVLIPEKYVMIQEILKNEKL-LSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELE-----NLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIE---NFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEML-KTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKF--VPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL--KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDM----QNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDL 6128
            + + P     +  E   + + ++ K+ A+  LKQ  ++LL     S  + D                   A D+++ L  +E L + +  +  +R  +L ++ D    +WSE+     ++  ++              ++ +++EP   H + +     AD +   + V  E++                             + +  +L   GK +  +V   E  ++   NQ+  + G F  +    F E   + I   E+A+               F  D ++++ +W ++ E +L+    +   + + EI  L  EL +   E+  +    +++ +   ++ +        T+ +   ++  ++S L   + E+ + L+     +G+L  ++      + +    +K++ P              KN   L D     Q     L   I AH D  +  N   +  +   G L        K M +  E I+ ++ E      E+ K E   +  E+     +LE+  + L      G   E+ E     F     D+    + +E  L     H++    D  T+LS     +  K+ + + L   R++KL +  +  +  ++    ++  I+  E       SI R+ P  I    AE    ++   + A +   + +H       ++ +  + D   +   L     ++ KI  R  ER +       E   + D   +L  ++ +  V I    N      K+   L+++K   + ++ +   F  T + G  L ++ T  +   Y  + M  + +  KW ++   +        + +++ G   ++M  +  W++D + ++       +  D+D V  L+DE      E    +   K +  K   L      E+  I    E +  +++      + R  S++E+ Q A+EF++K + L  WL   E+ LK   L       D VE +++      ++ E K         G+ IL+ C P A   +   +    +RW +++ + ++R   L E     +     IE+L     +   ++   I      D+    QN+ D  N       +  E+D+  KS  K  +  NP++                                          L+T++ KLW  ++  + +L N    L E ++L  + +  WK+ ++ +      R+ DLFRR      G    + F + II S FPT++  + +V + F+K +   I  ++FI++LR +       N N   +     I H+I E +   C+C   Y +++  +N YRFG      MVR L STVMVR+GGGW+++ EFL K+DPCR    L++
Sbjct: 3568 ISADPSVLESRLAENRSIVESLRDKQNAYDALKQTASELL----ASAPEGDAA-----------------AGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLR--------------NRLELVEPATGHPEQL-----ADQQEIMAQVASEMER---------------------------ARPRIEALSIAGKQLADYVPDDEKAVIE--NQVANVRGGFSTI-TGLFAEKKRDLIAAMEEAM--------------TFHGD-LQELLKWLDMAEQKLLKMSPVEHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPP-------------KNAVNLRD-IEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTSGALDAETSDSLKSMNLKWEDIQKVL-ESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKTHGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRL-PDVIEKQLAEHESWME---EVAGRKMAMTKH-QASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSE---YKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL-------DEVEGVKQ------EMDEAKGRYQECLKKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQNEQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFANLDSELREQQPEVDAACKSAKKGAR--NPAA----------------------------------------EMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSKFPTSRLEMAKVADRFDKGDGM-INAKEFINALRFDA-----SNRNAKPQTDTEKITHEI-ELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNI 4797          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 162.155 bits (409), Expect = 3.440e-39
Identity = 276/1400 (19.71%), Postives = 547/1400 (39.07%), Query Frame = 3
Query: 2013 VQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFDGVGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIAHSDSISTLTDADNKSTTSSVGFELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVTQFVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLL--ELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKL--------KEMKILTEQIRVLIPEKYVMIQEILKNEKL-LSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELE-----NLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIE---NFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEML-KTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKF--VPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL--KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDM----QNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDL 6128
            + + P     +  E   + + ++ K+ A+  LKQ  ++LL     S  + D                   A D+++ L  +E L + +  +  +R  +L ++ D    +WSE+     ++  ++              ++ +++EP   H + +     AD +   + V  E++                             + +  +L   GK +  +V   E  ++   NQ+  + G F  +    F E   + I   E+A+               F  D ++++ +W ++ E +L+    +   + + EI  L  EL +   E+  +    +++ +   ++ +        T+ +   ++  ++S L   + E+ + L+     +G+L  ++      + +    +K++ P              KN   L D     Q     L   I AH D  +  N   +  +   G L        K M +  E I+ ++ E      E+ K E   +  E+     +LE+  + L      G   E+ E     F     D+    + +E  L     H++    D  T+LS     +  K+ + + L   R++KL +  +  +  ++    ++  I+  E       SI R+ P  I    AE    ++   + A +   + +H       ++ +  + D   +   L     ++ KI  R  ER +       E   + D   +L  ++ +  V I    N      K+   L+++K   + ++ +   F  T + G  L ++ T  +   Y  + M  + +  KW ++   +        + +++ G   ++M  +  W++D + ++       +  D+D V  L+DE      E    +   K +  K   L      E+  I    E +  +++      + R  S++E+ Q A+EF++K + L  WL   E+ LK   L       D VE +++      ++ E K         G+ IL+ C P A   +   +    +RW +++ + ++R   L E     +     IE+L     +   ++   I      D+    QN+ D  N       +  E+D+  KS  K  +  NP++                                          L+T++ KLW  ++  + +L N    L E ++L  + +  WK+ ++ +      R+ DLFRR      G    + F + II S FPT++  + +V + F+K +   I  ++FI++LR +       N N   +     I H+I E +   C+C   Y +++  +N YRFG      MVR L STVMVR+GGGW+++ EFL K+DPCR    L++
Sbjct: 3683 ISADPSVLESRLAENRSIVESLRDKQNAYDALKQTASELL----ASAPEGDAA-----------------AGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLR--------------NRLELVEPATGHPEQL-----ADQQEIMAQVASEMER---------------------------ARPRIEALSIAGKQLADYVPDDEKAVIE--NQVANVRGGFSTI-TGLFAEKKRDLIAAMEEAM--------------TFHGD-LQELLKWLDMAEQKLLKMSPVEHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPP-------------KNAVNLRD-IEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTSGALDAETSDSLKSMNLKWEDIQKVL-ESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKTHGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRL-PDVIEKQLAEHESWME---EVAGRKMAMTKH-QASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSE---YKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL-------DEVEGVKQ------EMDEAKGRYQECLKKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQNEQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFANLDSELREQQPEVDAACKSAKKGAR--NPAA----------------------------------------EMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSKFPTSRLEMAKVADRFDKGDGM-INAKEFINALRFDA-----SNRNAKPQTDTEKITHEI-ELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNI 4912          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 162.155 bits (409), Expect = 3.557e-39
Identity = 276/1400 (19.71%), Postives = 547/1400 (39.07%), Query Frame = 3
Query: 2013 VQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFDGVGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIAHSDSISTLTDADNKSTTSSVGFELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVTQFVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLL--ELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKL--------KEMKILTEQIRVLIPEKYVMIQEILKNEKL-LSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELE-----NLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIE---NFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEML-KTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKF--VPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL--KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDM----QNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDL 6128
            + + P     +  E   + + ++ K+ A+  LKQ  ++LL     S  + D                   A D+++ L  +E L + +  +  +R  +L ++ D    +WSE+     ++  ++              ++ +++EP   H + +     AD +   + V  E++                             + +  +L   GK +  +V   E  ++   NQ+  + G F  +    F E   + I   E+A+               F  D ++++ +W ++ E +L+    +   + + EI  L  EL +   E+  +    +++ +   ++ +        T+ +   ++  ++S L   + E+ + L+     +G+L  ++      + +    +K++ P              KN   L D     Q     L   I AH D  +  N   +  +   G L        K M +  E I+ ++ E      E+ K E   +  E+     +LE+  + L      G   E+ E     F     D+    + +E  L     H++    D  T+LS     +  K+ + + L   R++KL +  +  +  ++    ++  I+  E       SI R+ P  I    AE    ++   + A +   + +H       ++ +  + D   +   L     ++ KI  R  ER +       E   + D   +L  ++ +  V I    N      K+   L+++K   + ++ +   F  T + G  L ++ T  +   Y  + M  + +  KW ++   +        + +++ G   ++M  +  W++D + ++       +  D+D V  L+DE      E    +   K +  K   L      E+  I    E +  +++      + R  S++E+ Q A+EF++K + L  WL   E+ LK   L       D VE +++      ++ E K         G+ IL+ C P A   +   +    +RW +++ + ++R   L E     +     IE+L     +   ++   I      D+    QN+ D  N       +  E+D+  KS  K  +  NP++                                          L+T++ KLW  ++  + +L N    L E ++L  + +  WK+ ++ +      R+ DLFRR      G    + F + II S FPT++  + +V + F+K +   I  ++FI++LR +       N N   +     I H+I E +   C+C   Y +++  +N YRFG      MVR L STVMVR+GGGW+++ EFL K+DPCR    L++
Sbjct: 3443 ISADPSVLESRLAENRSIVESLRDKQNAYDALKQTASELL----ASAPEGDAA-----------------AGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLR--------------NRLELVEPATGHPEQL-----ADQQEIMAQVASEMER---------------------------ARPRIEALSIAGKQLADYVPDDEKAVIE--NQVANVRGGFSTI-TGLFAEKKRDLIAAMEEAM--------------TFHGD-LQELLKWLDMAEQKLLKMSPVEHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPP-------------KNAVNLRD-IEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTSGALDAETSDSLKSMNLKWEDIQKVL-ESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKTHGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRL-PDVIEKQLAEHESWME---EVAGRKMAMTKH-QASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSE---YKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL-------DEVEGVKQ------EMDEAKGRYQECLKKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQNEQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFANLDSELREQQPEVDAACKSAKKGAR--NPAA----------------------------------------EMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSKFPTSRLEMAKVADRFDKGDGM-INAKEFINALRFDA-----SNRNAKPQTDTEKITHEI-ELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNI 4672          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 161.77 bits (408), Expect = 3.952e-39
Identity = 276/1400 (19.71%), Postives = 547/1400 (39.07%), Query Frame = 3
Query: 2013 VQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFDGVGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIAHSDSISTLTDADNKSTTSSVGFELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVTQFVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLL--ELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKL--------KEMKILTEQIRVLIPEKYVMIQEILKNEKL-LSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELE-----NLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIE---NFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEML-KTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKF--VPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL--KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDM----QNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDL 6128
            + + P     +  E   + + ++ K+ A+  LKQ  ++LL     S  + D                   A D+++ L  +E L + +  +  +R  +L ++ D    +WSE+     ++  ++              ++ +++EP   H + +     AD +   + V  E++                             + +  +L   GK +  +V   E  ++   NQ+  + G F  +    F E   + I   E+A+               F  D ++++ +W ++ E +L+    +   + + EI  L  EL +   E+  +    +++ +   ++ +        T+ +   ++  ++S L   + E+ + L+     +G+L  ++      + +    +K++ P              KN   L D     Q     L   I AH D  +  N   +  +   G L        K M +  E I+ ++ E      E+ K E   +  E+     +LE+  + L      G   E+ E     F     D+    + +E  L     H++    D  T+LS     +  K+ + + L   R++KL +  +  +  ++    ++  I+  E       SI R+ P  I    AE    ++   + A +   + +H       ++ +  + D   +   L     ++ KI  R  ER +       E   + D   +L  ++ +  V I    N      K+   L+++K   + ++ +   F  T + G  L ++ T  +   Y  + M  + +  KW ++   +        + +++ G   ++M  +  W++D + ++       +  D+D V  L+DE      E    +   K +  K   L      E+  I    E +  +++      + R  S++E+ Q A+EF++K + L  WL   E+ LK   L       D VE +++      ++ E K         G+ IL+ C P A   +   +    +RW +++ + ++R   L E     +     IE+L     +   ++   I      D+    QN+ D  N       +  E+D+  KS  K  +  NP++                                          L+T++ KLW  ++  + +L N    L E ++L  + +  WK+ ++ +      R+ DLFRR      G    + F + II S FPT++  + +V + F+K +   I  ++FI++LR +       N N   +     I H+I E +   C+C   Y +++  +N YRFG      MVR L STVMVR+GGGW+++ EFL K+DPCR    L++
Sbjct: 3570 ISADPSVLESRLAENRSIVESLRDKQNAYDALKQTASELL----ASAPEGDAA-----------------AGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLR--------------NRLELVEPATGHPEQL-----ADQQEIMAQVASEMER---------------------------ARPRIEALSIAGKQLADYVPDDEKAVIE--NQVANVRGGFSTI-TGLFAEKKRDLIAAMEEAM--------------TFHGD-LQELLKWLDMAEQKLLKMSPVEHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPP-------------KNAVNLRD-IEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTSGALDAETSDSLKSMNLKWEDIQKVL-ESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKTHGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRL-PDVIEKQLAEHESWME---EVAGRKMAMTKH-QASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSE---YKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL-------DEVEGVKQ------EMDEAKGRYQECLKKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQNEQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFANLDSELREQQPEVDAACKSAKKGAR--NPAA----------------------------------------EMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSKFPTSRLEMAKVADRFDKGDGM-INAKEFINALRFDA-----SNRNAKPQTDTEKITHEI-ELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGRLNI 4799          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273222)

HSP 1 Score: 251.136 bits (640), Expect = 4.862e-66
Identity = 258/1130 (22.83%), Postives = 500/1130 (44.25%), Query Frame = 3
Query: 2856 LSDEIKKVFEWFEVMEN----------RLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLS---KEIHLHIDXXX--------XXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTF--LSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENF------KDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEES----DIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAE-KLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKL----QNPSSFHKAPTK-------RYHDRVEFYKNIWRNSKDSLNKSTDDLS-TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            L D ++K  E+ E ++N          +  + G +  D   ++  + +LKS   E+     +++ +     E+          ++ E    +  ++  L++G++E+   L+     +G+   +L++ +  + + ++ +  L P    GDP+        LK L ++              I AH +  D  N   R  +       E     E++R L  E   ++Q+    +  L    +E H +I  ++                 P  G  + + EQ       Y  +L++ R  +E        +I+     K +   L   ++TL  ++      A+ +K KL I  K   E+    Q   + + + E L       S++  T   Q++  K+  +    + +    L  +   +K F  + D   +   L     +  ++  +  ER R  +  Y+E + F+D+++ +  +L E+  +++          +P K+  ++ KLK   +QL  + + +  T+R G  L ++    D  + +L +ML  L+ +W ++    +  +  L   L+ +G   DA+  +  W+  + ++   +  + GDL+TV+ L +     E ++       + +    L   ++ E S    ++   ++E+++ +    + V +R + LQ +L  A++ N+++  L  WL  AE KL   K+ P   +E    E+++ H   +K ++  +   T      + I+   +P A   +   +     RW ++   + +R  KL + L SL+     IEEL+  +      + N    ++P ++  V  +I  H  F+   +   +++    K  +L    + PS   K P +          DR+  Y       + S + S  +L   + R   L T++  +W LS E +  L +HL+ L + E+ R F ++ W+K FL Y+  K  RLTDLFR+      G    + F + I+ + F T+   ++ V ++F++N    I +Q+FI +LRP+   Q  K  N +DK      IHD +++ V +CTC  ++ V + G+ KYRFG + KL +VR L STVMVR+GGGW  + EFL+KNDPCR
Sbjct: 3998 LIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKP--IPGDPQLLEVELAKLKVLAND--------------IQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVY-NELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGD--RPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGV----LKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAP--DDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRITPTRDTPDRDRLPHY-----GPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPD--WQERKPANDSDK------IHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR 5089          

HSP 2 Score: 51.9878 bits (123), Expect = 8.969e-6
Identity = 40/201 (19.90%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 4416 LKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEI---NNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSL-PKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNI 5006
            L+ L  +WN ++  +      L+  L+++G   +A+  ++ W++D+            D   V+  + E    +  +    N      NL   + N  +  E + I   + ++  +F    +  +QR   L+E++++AK F+ K++ L++WL   E+ +K   L P   +E  + + I +H+ L  ++   K   ++  ++
Sbjct: 3111 LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT--DEEKIQQRIREHDRLHDEILGKKPDFSDLADV 3309          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304853)

HSP 1 Score: 251.136 bits (640), Expect = 4.918e-66
Identity = 260/1136 (22.89%), Postives = 502/1136 (44.19%), Query Frame = 3
Query: 2856 LSDEIKKVFEWFEVMEN----------RLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLS---KEIHLHIDXXX--------XXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTF--LSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENF------KDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEES----DIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAE-KLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKL----QNPSSFHKAPTK-RYHDRVE------FYKNIWRNSKD-SLNKSTDDLST------NTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            L D ++K  E+ E ++N          +  + G +  D   ++  + +LKS   E+     +++ +     E+          ++ E    +  ++  L++G++E+   L+     +G+   +L++ +  + + ++ +  L P    GDP+        LK L ++              I AH +  D  N   R  +       E     E++R L  E   ++Q+    +  L    +E H +I  ++                 P  G  + + EQ       Y  +L++ R  +E        +I+     K +   L   ++TL  ++      A+ +K KL I  K   E+    Q   + + + E L       S++  T   Q++  K+  +    + +    L  +   +K F  + D   +   L     +  ++  +  ER R  +  Y+E + F+D+++ +  +L E+  +++          +P K+  ++ KLK   +QL  + + +  T+R G  L ++    D  + +L +ML  L+ +W ++    +  +  L   L+ +G   DA+  +  W+  + ++   +  + GDL+TV+ L +     E ++       + +    L   ++ E S    ++   ++E+++ +    + V +R + LQ +L  A++ N+++  L  WL  AE KL   K+ P   +E    E+++ H   +K ++  +   T      + I+   +P A   +   +     RW ++   + +R  KL + L SL+     IEEL+  +      + N    ++P ++  V  +I  H  F+   +   +++    K  +L    + PS   K P +   HD  E        +  ++ S+D  LN      S       + R   L T++  +W LS E +  L +HL+ L + E+ R F ++ W+K FL Y+  K  RLTDLFR+      G    + F + I+ + F T+   ++ V ++F++N    I +Q+FI +LRP+   Q  K  N +DK      IHD +++ V +CTC  ++ V + G+ KYRFG + KL +VR L STVMVR+GGGW  + EFL+KNDPCR
Sbjct: 4068 LIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKP--IPGDPQLLEVELAKLKVLAND--------------IQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVY-NELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGD--RPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGV----LKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAP--DDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRGSSHDLREQSPDGTLRRQSFKGSRDQGLNARKGSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPD--WQERKPANDSDK------IHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR 5170          

HSP 2 Score: 52.373 bits (124), Expect = 8.320e-6
Identity = 40/201 (19.90%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 4416 LKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEI---NNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSL-PKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNI 5006
            L+ L  +WN ++  +      L+  L+++G   +A+  ++ W++D+            D   V+  + E    +  +    N      NL   + N  +  E + I   + ++  +F    +  +QR   L+E++++AK F+ K++ L++WL   E+ +K   L P   +E  + + I +H+ L  ++   K   ++  ++
Sbjct: 3181 LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT--DEEKIQQRIREHDRLHDEILGKKPDFSDLADV 3379          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304847)

HSP 1 Score: 251.136 bits (640), Expect = 4.918e-66
Identity = 260/1136 (22.89%), Postives = 502/1136 (44.19%), Query Frame = 3
Query: 2856 LSDEIKKVFEWFEVMEN----------RLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLS---KEIHLHIDXXX--------XXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTF--LSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENF------KDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEES----DIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAE-KLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKL----QNPSSFHKAPTK-RYHDRVE------FYKNIWRNSKD-SLNKSTDDLST------NTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            L D ++K  E+ E ++N          +  + G +  D   ++  + +LKS   E+     +++ +     E+          ++ E    +  ++  L++G++E+   L+     +G+   +L++ +  + + ++ +  L P    GDP+        LK L ++              I AH +  D  N   R  +       E     E++R L  E   ++Q+    +  L    +E H +I  ++                 P  G  + + EQ       Y  +L++ R  +E        +I+     K +   L   ++TL  ++      A+ +K KL I  K   E+    Q   + + + E L       S++  T   Q++  K+  +    + +    L  +   +K F  + D   +   L     +  ++  +  ER R  +  Y+E + F+D+++ +  +L E+  +++          +P K+  ++ KLK   +QL  + + +  T+R G  L ++    D  + +L +ML  L+ +W ++    +  +  L   L+ +G   DA+  +  W+  + ++   +  + GDL+TV+ L +     E ++       + +    L   ++ E S    ++   ++E+++ +    + V +R + LQ +L  A++ N+++  L  WL  AE KL   K+ P   +E    E+++ H   +K ++  +   T      + I+   +P A   +   +     RW ++   + +R  KL + L SL+     IEEL+  +      + N    ++P ++  V  +I  H  F+   +   +++    K  +L    + PS   K P +   HD  E        +  ++ S+D  LN      S       + R   L T++  +W LS E +  L +HL+ L + E+ R F ++ W+K FL Y+  K  RLTDLFR+      G    + F + I+ + F T+   ++ V ++F++N    I +Q+FI +LRP+   Q  K  N +DK      IHD +++ V +CTC  ++ V + G+ KYRFG + KL +VR L STVMVR+GGGW  + EFL+KNDPCR
Sbjct: 4068 LIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKP--IPGDPQLLEVELAKLKVLAND--------------IQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVY-NELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGD--RPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGV----LKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAP--DDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRGSSHDLREQSPDGTLRRQSFKGSRDQGLNARKGSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPD--WQERKPANDSDK------IHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR 5170          

HSP 2 Score: 52.373 bits (124), Expect = 8.320e-6
Identity = 40/201 (19.90%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 4416 LKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEI---NNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSL-PKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNI 5006
            L+ L  +WN ++  +      L+  L+++G   +A+  ++ W++D+            D   V+  + E    +  +    N      NL   + N  +  E + I   + ++  +F    +  +QR   L+E++++AK F+ K++ L++WL   E+ +K   L P   +E  + + I +H+ L  ++   K   ++  ++
Sbjct: 3181 LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT--DEEKIQQRIREHDRLHDEILGKKPDFSDLADV 3379          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273224)

HSP 1 Score: 250.751 bits (639), Expect = 5.468e-66
Identity = 258/1130 (22.83%), Postives = 500/1130 (44.25%), Query Frame = 3
Query: 2856 LSDEIKKVFEWFEVMEN----------RLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLS---KEIHLHIDXXX--------XXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTF--LSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENF------KDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEES----DIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAE-KLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKL----QNPSSFHKAPTK-------RYHDRVEFYKNIWRNSKDSLNKSTDDLS-TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            L D ++K  E+ E ++N          +  + G +  D   ++  + +LKS   E+     +++ +     E+          ++ E    +  ++  L++G++E+   L+     +G+   +L++ +  + + ++ +  L P    GDP+        LK L ++              I AH +  D  N   R  +       E     E++R L  E   ++Q+    +  L    +E H +I  ++                 P  G  + + EQ       Y  +L++ R  +E        +I+     K +   L   ++TL  ++      A+ +K KL I  K   E+    Q   + + + E L       S++  T   Q++  K+  +    + +    L  +   +K F  + D   +   L     +  ++  +  ER R  +  Y+E + F+D+++ +  +L E+  +++          +P K+  ++ KLK   +QL  + + +  T+R G  L ++    D  + +L +ML  L+ +W ++    +  +  L   L+ +G   DA+  +  W+  + ++   +  + GDL+TV+ L +     E ++       + +    L   ++ E S    ++   ++E+++ +    + V +R + LQ +L  A++ N+++  L  WL  AE KL   K+ P   +E    E+++ H   +K ++  +   T      + I+   +P A   +   +     RW ++   + +R  KL + L SL+     IEEL+  +      + N    ++P ++  V  +I  H  F+   +   +++    K  +L    + PS   K P +          DR+  Y       + S + S  +L   + R   L T++  +W LS E +  L +HL+ L + E+ R F ++ W+K FL Y+  K  RLTDLFR+      G    + F + I+ + F T+   ++ V ++F++N    I +Q+FI +LRP+   Q  K  N +DK      IHD +++ V +CTC  ++ V + G+ KYRFG + KL +VR L STVMVR+GGGW  + EFL+KNDPCR
Sbjct: 3998 LIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKP--IPGDPQLLEVELAKLKVLAND--------------IQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVY-NELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGD--RPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGV----LKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAP--DDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRITPTRDTPDRDRLPHY-----GPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPD--WQERKPANDSDK------IHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR 5089          

HSP 2 Score: 51.9878 bits (123), Expect = 8.673e-6
Identity = 40/201 (19.90%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 4416 LKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEI---NNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSL-PKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNI 5006
            L+ L  +WN ++  +      L+  L+++G   +A+  ++ W++D+            D   V+  + E    +  +    N      NL   + N  +  E + I   + ++  +F    +  +QR   L+E++++AK F+ K++ L++WL   E+ +K   L P   +E  + + I +H+ L  ++   K   ++  ++
Sbjct: 3111 LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT--DEEKIQQRIREHDRLHDEILGKKPDFSDLADV 3309          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273225)

HSP 1 Score: 249.98 bits (637), Expect = 1.144e-65
Identity = 258/1130 (22.83%), Postives = 500/1130 (44.25%), Query Frame = 3
Query: 2856 LSDEIKKVFEWFEVMEN----------RLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLS---KEIHLHIDXXX--------XXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTF--LSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENF------KDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEES----DIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAE-KLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKL----QNPSSFHKAPTK-------RYHDRVEFYKNIWRNSKDSLNKSTDDLS-TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            L D ++K  E+ E ++N          +  + G +  D   ++  + +LKS   E+     +++ +     E+          ++ E    +  ++  L++G++E+   L+     +G+   +L++ +  + + ++ +  L P    GDP+        LK L ++              I AH +  D  N   R  +       E     E++R L  E   ++Q+    +  L    +E H +I  ++                 P  G  + + EQ       Y  +L++ R  +E        +I+     K +   L   ++TL  ++      A+ +K KL I  K   E+    Q   + + + E L       S++  T   Q++  K+  +    + +    L  +   +K F  + D   +   L     +  ++  +  ER R  +  Y+E + F+D+++ +  +L E+  +++          +P K+  ++ KLK   +QL  + + +  T+R G  L ++    D  + +L +ML  L+ +W ++    +  +  L   L+ +G   DA+  +  W+  + ++   +  + GDL+TV+ L +     E ++       + +    L   ++ E S    ++   ++E+++ +    + V +R + LQ +L  A++ N+++  L  WL  AE KL   K+ P   +E    E+++ H   +K ++  +   T      + I+   +P A   +   +     RW ++   + +R  KL + L SL+     IEEL+  +      + N    ++P ++  V  +I  H  F+   +   +++    K  +L    + PS   K P +          DR+  Y       + S + S  +L   + R   L T++  +W LS E +  L +HL+ L + E+ R F ++ W+K FL Y+  K  RLTDLFR+      G    + F + I+ + F T+   ++ V ++F++N    I +Q+FI +LRP+   Q  K  N +DK      IHD +++ V +CTC  ++ V + G+ KYRFG + KL +VR L STVMVR+GGGW  + EFL+KNDPCR
Sbjct: 4109 LIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKP--IPGDPQLLEVELAKLKVLAND--------------IQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVY-NELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGD--RPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGV----LKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAP--DDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRITPTRDTPDRDRLPHY-----GPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPD--WQERKPANDSDK------IHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR 5200          

HSP 2 Score: 51.9878 bits (123), Expect = 9.051e-6
Identity = 40/201 (19.90%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 4416 LKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEI---NNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSL-PKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNI 5006
            L+ L  +WN ++  +      L+  L+++G   +A+  ++ W++D+            D   V+  + E    +  +    N      NL   + N  +  E + I   + ++  +F    +  +QR   L+E++++AK F+ K++ L++WL   E+ +K   L P   +E  + + I +H+ L  ++   K   ++  ++
Sbjct: 3222 LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT--DEEKIQQRIREHDRLHDEILGKKPDFSDLADV 3420          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Zebrafish
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 247.669 bits (631), Expect = 6.725e-65
Identity = 186/727 (25.58%), Postives = 350/727 (48.14%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELS----EIDSQIKSLIKDFKLQNPSSFH-------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLST-NTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR---------------------------------------------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +R  ER R+ + A +  K F +S++ L  WL+ES   ++      + P K+   L + K   K L  +++ +  T R G  LKDK +++D +   L  ML  LR KW+ +    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E  + + S ++  ++E+  ++    +    +   L+++L  A+EF+S ++ L  WL +AE+ L+   +LP   +E  L  LIE+H+  +K+++E +  ++   ++G+ IL+ CHP +   +        +R+ ++ + +    ++L+ +L  L+ +  L+E+L+  +      +  + +  +P +++ V  +I +H  F+ E++    ++D   K+  +      P   H       + P KR   +  +          +   S   + T N R+N L +++ ++W L+++ +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K +   DK      I D + ++VA C C  R+ V++ G NKYR                                             FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 2896 KVVQRSVERGRLLDDARKRAKQFHESWSKLMEWLEESERALDTELEIANDPDKIKTQLTQHKEFQKALGSKHSVYDTTSRTGRALKDKTSLQD-DNQKLDHMLSELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAEDQPVHGDIDLVLNLIDSHKVFQKELGKRTGSVQALKRSARDLIESSHDDSSWVKVQMQELSTRWETVCSLSVSKQTRLEQALSQAEEFHSTVHILLEWLAEAEQSLRFHGALPD--DEEALRALIEQHKEFMKRLEEKRLALSKATSMGEAILSICHPDSITTIKHWNTIIKARFEEVTAWARQHQQRLSSALDELQATQELLEKLLNWLQWAETTLGEKDKDPMPQELEEVKALIAEHQTFLEEMTRKQPDVDKVTKTHKRKATADPPVQSHIPVLDKGRTPRKRSPTQTMY----------TAAASQAQIETKNPRVNLLVSKWQQVWLLALDRRRKLNDALDRLEELKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQDGKVTRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPLTDADK------IEDEVTRQVAKCKCPKRFQVEQIGANKYRFYLGNQFGLVHCLHDPLIADETITNRDNQNLTPHLHVAVLESCILFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 3601          

HSP 2 Score: 53.5286 bits (127), Expect = 4.177e-6
Identity = 79/418 (18.90%), Postives = 175/418 (41.87%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVLDHLDKLKNLCKQL------SCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKT-GSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + K  +ER+ I  +A +    F DS  N+   +D    ++E   D  + V   L+ +K   ++L      + Q       L + + L  K  +++ ++  + E +  L+  W  +   I+  +  L   L+  G    A+  +  W+  +        K  GD   +E+ + + H+ +N++  HK   E        ++      E   ++N +E +  ++   +   +QR + L  +L  A+ F+ ++ ++  WL+ +E+ LL  K++    + A   E +  H  L   ++  +    +    G+ IL    P   +    L  +    +W  + ++ ++R  KL E+L         +++ I      L + +  + +  P    ++ +   I++H +F+ E++    QI  L K
Sbjct: 2460 LNKTWKERVEILEEAMQAAVQFQDSLQNMFDSVD----IMEGKLDSMSPVGTDLETVKQQIEELKEFKGDAYQLQIEMERLNHQAGLLLKKVMDEDDRTSISEPMNELKMLWENLDKKIINRQHKLEGALLALGQFQHALDELLTWLTHTEELLGEQRKACGDPKAIEIELAKHHVLQNDVLAHKSTVEAVNRAGCDLMESSAGEEARGLQNKLENLNQRWKNILEKTEQRRQLLDSALLQAQGFHGEIEDMQRWLKDSERQLLASKAVGGLPDTAR--EQLNTHLELCSTLEVKEEIYKHLLERGQQILAMT-PEGQDSTTELDLRNLQDKWESVQAKVKERKVKLEEALAMATDFHNSLQDFI----NWLTQAEQTLTMVSPASLILETIMFQIDEHKVFVTEVNSHRDQIMELDK 2866          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Zebrafish
Match: macf1a (microtubule actin crosslinking factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3606])

HSP 1 Score: 234.187 bits (596), Expect = 9.166e-61
Identity = 177/679 (26.07%), Postives = 331/679 (48.75%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTV-EDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK---LQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +R  +R R  ++A +  K F +++  L  WL+E+   +++     ++P K+   L K K   K L  +   +  T+R G  ++DK T+  D +K  L  +L  +R KW+ +    V  +  L   L+ +G   +A++ +  W+     +   D  + GDLD V  L+D   + + E+       + LK   R L E    + + ++  ++E+ N++         +   LQ++L+ A+EF + +  L  WL +AE+ L+ + +   + E  L  L+  H   ++ V+E +  +     +G+ IL  CHP     +   I    +R+ ++ + ++   ++L  +L  L  + AL+EEL+  +      +       +  D+  +  +I +H +F+ E++     +  + K +K    ++PSS       R               +   + S      N RL  L +++ ++W L+++ +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT+K  +  V +IF+++ +  I Y +F+ +L P + +   +     DK      I D + ++VA C C  R+ V++ G+NKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 4508 KLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKIQLAKHKEFQKSLGSKQPVYDTTVRSGKAMRDKATLPADTQK--LDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQPVHGDLDLVSNLMDCHKVFQKELGKRTSSVQALKRSARELMETGRDDTAWVKVQLQELSNRWDTVCALSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEEAET-LQALLHTHRDFMQTVEEKRVDVNKAAGMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLTQDILQLKTLITEHQVFMEEMTRKQPDVDKVTKTYKRKPAEHPSSLSDRKGARK-----------HQQQQQQHHSVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTSKLEMTAVADIFDRDCDGYIDYYEFVAALHPNKDAY--RPTTDADK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 5164          

HSP 2 Score: 71.633 bits (174), Expect = 1.673e-11
Identity = 83/418 (19.86%), Postives = 177/418 (42.34%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPT---KVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVIL-----TNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + +  RER+   ++A      + D+   +  +LD + + + +     T    V   +++LK    ++  Q  +       G  L  K + +  ++ ++ E L  LR  W+ +   I   +  L   L+  G    A+  +  W++ + A       +  D   +E+ + + H+  N++ +H+   E   +    +L      E + +R+ ++E+   +   +    +R K L+ +LQ A+ F+ +L E   WLR+ E  L   + P         E +++H  L  Q+ +         + G+ IL      +  P  T     L     ++W  +N++ EDR  KL E++    G  + +++ I      L + +  + +  P    +  V   I++H +F+NE++    Q+ +L K
Sbjct: 4068 LNRTWRERMERLDEAMTASVQYQDALQGMFDYLDNAVIKLCDMPAVGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLSHQGELLLRKVS-DQTDRDMIQEPLTELRHLWDNLVDKITVRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPISSDPKAIEIELAKHHVLRNDVLSHRSTVETVNSAGSELLESSPGDEINHLRDQLDELNRSWKNLLLKTDERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLS-AAKPTGGLPETAREQLQQHMELQAQLAQRGEHYHRLLDHGESILLARGGEDAGPGTTQTQQNLAM-LQNKWASLNTKMEDRRGKLEEAVSLATGFQSSLQDTI----NWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEK 4478          

HSP 3 Score: 62.7734 bits (151), Expect = 6.895e-9
Identity = 85/412 (20.63%), Postives = 170/412 (41.26%), Query Frame = 3
Query: 4140 ERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQ---PTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVED--PEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL-----KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVEL-IEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCH-PMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL---GSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSL 5330
            ER ++   A ++ + F         WL  +   +   K     P    + L +   L  QL+ +  ++H  L +G  +      ED  P      + L  L+ KW  +   +   +  L   +        +++    W+  +             LDTV   IDE  +  NE+N H+E    L     +LR  +  ++     I+N +  ++ ++   V     R + L E+ + AK+F+    +L  WL +AE   ++ S  +  NE D +++ + KH+   K +   +         GK +      P  T  ++ L+ +   +W+ +  +S +R  KL E+L   G    +   + + +Y+V   L + Q      +  D+  V+++++ H +F  EL +  S +++L
Sbjct: 4293 ERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQAQLAQRGEHYHRLLDHGESILLARGGEDAGPGTTQTQQNLAMLQNKWASLNTKMEDRRGKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDV--VLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAES--RLDSELEISNEPDKIKIQLAKHKEFQKSLGSKQPVYDTTVRSGKAMRDKATLPADTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQ-----PVHGDLDLVSNLMDCHKVFQKELGKRTSSVQAL 4695          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Zebrafish
Match: macf1a (microtubule actin crosslinking factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3606])

HSP 1 Score: 233.032 bits (593), Expect = 1.794e-60
Identity = 178/686 (25.95%), Postives = 333/686 (48.54%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTV-EDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK---LQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            K+ +R  +R R  ++A +  K F +++  L  WL+E+   +++     ++P K+   L K K   K L  +   +  T+R G  ++DK T+  D +K  L  +L  +R KW+ +    V  +  L   L+ +G   +A++ +  W+     +   D  + GDLD V  L+D   + + E+       + LK   R L E    + + ++  ++E+ N++         +   LQ++L+ A+EF + +  L  WL +AE+ L+ + +   + E  L  L+  H   ++ V+E +  +     +G+ IL  CHP     +   I    +R+ ++ + ++   ++L  +L  L  + AL+EEL+  +      +       +  D+  +  +I +H +F+ E++     +  + K +K    ++PSS       R               +   + S      N RL  L +++ ++W L+++ +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT+K  +  V +IF+++ +  I Y +F+ +L P + +   +     DK      I D + ++VA C C  R+ V++ G+NKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +L+
Sbjct: 4876 KLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKIQLAKHKEFQKSLGSKQPVYDTTVRSGKAMRDKATLPADTQK--LDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQPVHGDLDLVSNLMDCHKVFQKELGKRTSSVQALKRSARELMETGRDDTAWVKVQLQELSNRWDTVCALSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEEAET-LQALLHTHRDFMQTVEEKRVDVNKAAGMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLTQDILQLKTLITEHQVFMEEMTRKQPDVDKVTKTYKRKPAEHPSSLSDRKGARK-----------HQQQQQQHHSVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTSKLEMTAVADIFDRDCDGYIDYYEFVAALHPNKDAY--RPTTDADK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNLE 5539          

HSP 2 Score: 71.2478 bits (173), Expect = 2.106e-11
Identity = 83/418 (19.86%), Postives = 177/418 (42.34%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPT---KVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVIL-----TNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + +  RER+   ++A      + D+   +  +LD + + + +     T    V   +++LK    ++  Q  +       G  L  K + +  ++ ++ E L  LR  W+ +   I   +  L   L+  G    A+  +  W++ + A       +  D   +E+ + + H+  N++ +H+   E   +    +L      E + +R+ ++E+   +   +    +R K L+ +LQ A+ F+ +L E   WLR+ E  L   + P         E +++H  L  Q+ +         + G+ IL      +  P  T     L     ++W  +N++ EDR  KL E++    G  + +++ I      L + +  + +  P    +  V   I++H +F+NE++    Q+ +L K
Sbjct: 4436 LNRTWRERMERLDEAMTASVQYQDALQGMFDYLDNAVIKLCDMPAVGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLSHQGELLLRKVS-DQTDRDMIQEPLTELRHLWDNLVDKITVRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPISSDPKAIEIELAKHHVLRNDVLSHRSTVETVNSAGSELLESSPGDEINHLRDQLDELNRSWKNLLLKTDERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLS-AAKPTGGLPETAREQLQQHMELQAQLAQRGEHYHRLLDHGESILLARGGEDAGPGTTQTQQNLAM-LQNKWASLNTKMEDRRGKLEEAVSLATGFQSSLQDTI----NWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEK 4846          

HSP 3 Score: 62.3882 bits (150), Expect = 8.895e-9
Identity = 85/412 (20.63%), Postives = 170/412 (41.26%), Query Frame = 3
Query: 4140 ERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQ---PTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVED--PEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL-----KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVEL-IEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCH-PMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL---GSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSL 5330
            ER ++   A ++ + F         WL  +   +   K     P    + L +   L  QL+ +  ++H  L +G  +      ED  P      + L  L+ KW  +   +   +  L   +        +++    W+  +             LDTV   IDE  +  NE+N H+E    L     +LR  +  ++     I+N +  ++ ++   V     R + L E+ + AK+F+    +L  WL +AE   ++ S  +  NE D +++ + KH+   K +   +         GK +      P  T  ++ L+ +   +W+ +  +S +R  KL E+L   G    +   + + +Y+V   L + Q      +  D+  V+++++ H +F  EL +  S +++L
Sbjct: 4661 ERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQAQLAQRGEHYHRLLDHGESILLARGGEDAGPGTTQTQQNLAMLQNKWASLNTKMEDRRGKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDV--VLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAES--RLDSELEISNEPDKIKIQLAKHKEFQKSLGSKQPVYDTTVRSGKAMRDKATLPADTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQ-----PVHGDLDLVSNLMDCHKVFQKELGKRTSSVQAL 5063          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Zebrafish
Match: macf1b (microtubule actin crosslinking factor 1b [Source:ZFIN;Acc:ZDB-GENE-100922-36])

HSP 1 Score: 120.553 bits (301), Expect = 1.120e-29
Identity = 66/185 (35.68%), Postives = 107/185 (57.84%), Query Frame = 3
Query: 5577 EQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            E+   FDFN W+K ++ +I     R+ D+FR     + G    +EF + ++ S FPTN   +  V NIF+ N +  I Y +F+ +L P R     + ++++        I++ + ++V+ C C  R+ V++   N+YRFG + +L MVR L ST+MVR+GGGW  + EFL KNDPCR+    +L+
Sbjct:    3 EEFANFDFNIWRKRYMQWISHLKSRILDVFRSIDRDQDGRITHKEFIDSVLASKFPTNVLEMTAVANIFDVNGDGFIDYYEFVSALHPSR-DPYRRTVDIDQ-------INEEVSRQVSQCNCPKRFQVEQISANRYRFGDSQQLRMVRILRSTLMVRVGGGWTALDEFLVKNDPCRVKGRTNLK 179          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Zebrafish
Match: gas2l1 (growth arrest-specific 2 like 1 [Source:ZFIN;Acc:ZDB-GENE-070705-38])

HSP 1 Score: 67.3958 bits (163), Expect = 4.297e-11
Identity = 25/70 (35.71%), Postives = 45/70 (64.29%), Query Frame = 3
Query: 5904 IHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIA 6113
            + +++ + +  C+C  ++ + +  + KY+ G +S L  +R L + VMVR+GGGW T+  +L K+DPCR A
Sbjct:  229 LDELVREILGQCSCPSQFPMTKVSEGKYKVGDSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCRCA 298          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 265.774 bits (678), Expect = 3.100e-70
Identity = 189/682 (27.71%), Postives = 345/682 (50.59%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK--LQNPSSFHKAPTKRYHDRVEFYKNIW-RNSKDSLNKSTDDLS---TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR-------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            + +R  ER R+ + A +  K F +++  L  WL+ES   +++     + P K+   L K K   K L  ++  +  T R G  LK+K T+ D +   L +ML  +R KW+ +    +  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S ++  ++E+  ++    N    +   L+E+L  A+ F++ ++ L  WL  AE+ L+    LP   +E  L  LIE+H+  +++V+E ++ +    ++G+ IL  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + + +IP D+  V  +I +H IF+ E+++    +  + K +K  +++ +   + P       ++  +  W R+   SL  S    S    N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF   I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ G+NKYR       FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 5285 VVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTD-DIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAEDQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILP--DDEDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPV------LDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 5949          

HSP 2 Score: 66.6254 bits (161), Expect = 7.796e-10
Identity = 83/429 (19.35%), Postives = 177/429 (41.26%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVL---DHLDKLKNL-----CKQLSCQYANFH--CTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLL----KIKSLPKFQNEA-----DLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + K  +ER+   ++A +    + D    L  W+D + + +E+     T ++     + +LK        +Q+  +  N      L+  +   DK  VEDP        L  L+  WN +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  HK   + +K     ++      E S + + +E +  ++ + ++  ++R K L  +L  A+ F+S++ ++  WL   E+ L     +  LP+   E      +L  L E  E + K++ +    M          +  C       +++ +     +W  ++++  +R  KL E+L    G    +++ I      L + +  + I  P    +  V   I++H +F+ E++    QI  L K
Sbjct: 4848 LNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDP--------LSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIESSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQM----------MERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFI----NWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDK 5254          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 265.388 bits (677), Expect = 4.799e-70
Identity = 189/682 (27.71%), Postives = 345/682 (50.59%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK--LQNPSSFHKAPTKRYHDRVEFYKNIW-RNSKDSLNKSTDDLS---TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR-------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            + +R  ER R+ + A +  K F +++  L  WL+ES   +++     + P K+   L K K   K L  ++  +  T R G  LK+K T+ D +   L +ML  +R KW+ +    +  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S ++  ++E+  ++    N    +   L+E+L  A+ F++ ++ L  WL  AE+ L+    LP   +E  L  LIE+H+  +++V+E ++ +    ++G+ IL  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + + +IP D+  V  +I +H IF+ E+++    +  + K +K  +++ +   + P       ++  +  W R+   SL  S    S    N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF   I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ G+NKYR       FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 5486 VVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTD-DIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAEDQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILP--DDEDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPV------LDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 6150          

HSP 2 Score: 66.2402 bits (160), Expect = 8.633e-10
Identity = 83/429 (19.35%), Postives = 177/429 (41.26%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVL---DHLDKLKNL-----CKQLSCQYANFH--CTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLL----KIKSLPKFQNEA-----DLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + K  +ER+   ++A +    + D    L  W+D + + +E+     T ++     + +LK        +Q+  +  N      L+  +   DK  VEDP        L  L+  WN +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  HK   + +K     ++      E S + + +E +  ++ + ++  ++R K L  +L  A+ F+S++ ++  WL   E+ L     +  LP+   E      +L  L E  E + K++ +    M          +  C       +++ +     +W  ++++  +R  KL E+L    G    +++ I      L + +  + I  P    +  V   I++H +F+ E++    QI  L K
Sbjct: 5049 LNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDP--------LSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIESSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQM----------MERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFI----NWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDK 5455          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 265.003 bits (676), Expect = 6.063e-70
Identity = 189/682 (27.71%), Postives = 345/682 (50.59%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK--LQNPSSFHKAPTKRYHDRVEFYKNIW-RNSKDSLNKSTDDLS---TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR-------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            + +R  ER R+ + A +  K F +++  L  WL+ES   +++     + P K+   L K K   K L  ++  +  T R G  LK+K T+ D +   L +ML  +R KW+ +    +  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S ++  ++E+  ++    N    +   L+E+L  A+ F++ ++ L  WL  AE+ L+    LP   +E  L  LIE+H+  +++V+E ++ +    ++G+ IL  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + + +IP D+  V  +I +H IF+ E+++    +  + K +K  +++ +   + P       ++  +  W R+   SL  S    S    N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF   I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ G+NKYR       FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 5438 VVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTD-DIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAEDQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILP--DDEDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPV------LDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 6102          

HSP 2 Score: 66.2402 bits (160), Expect = 9.787e-10
Identity = 83/429 (19.35%), Postives = 177/429 (41.26%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVL---DHLDKLKNL-----CKQLSCQYANFH--CTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLL----KIKSLPKFQNEA-----DLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + K  +ER+   ++A +    + D    L  W+D + + +E+     T ++     + +LK        +Q+  +  N      L+  +   DK  VEDP        L  L+  WN +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  HK   + +K     ++      E S + + +E +  ++ + ++  ++R K L  +L  A+ F+S++ ++  WL   E+ L     +  LP+   E      +L  L E  E + K++ +    M          +  C       +++ +     +W  ++++  +R  KL E+L    G    +++ I      L + +  + I  P    +  V   I++H +F+ E++    QI  L K
Sbjct: 5001 LNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDP--------LSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIESSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQM----------MERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFI----NWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDK 5407          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 264.233 bits (674), Expect = 9.579e-70
Identity = 189/682 (27.71%), Postives = 345/682 (50.59%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK--LQNPSSFHKAPTKRYHDRVEFYKNIW-RNSKDSLNKSTDDLS---TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR-------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            + +R  ER R+ + A +  K F +++  L  WL+ES   +++     + P K+   L K K   K L  ++  +  T R G  LK+K T+ D +   L +ML  +R KW+ +    +  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S ++  ++E+  ++    N    +   L+E+L  A+ F++ ++ L  WL  AE+ L+    LP   +E  L  LIE+H+  +++V+E ++ +    ++G+ IL  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + + +IP D+  V  +I +H IF+ E+++    +  + K +K  +++ +   + P       ++  +  W R+   SL  S    S    N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF   I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ G+NKYR       FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 6056 VVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTD-DIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAEDQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILP--DDEDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPV------LDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 6720          

HSP 2 Score: 65.855 bits (159), Expect = 1.253e-9
Identity = 83/429 (19.35%), Postives = 177/429 (41.26%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVL---DHLDKLKNL-----CKQLSCQYANFH--CTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLL----KIKSLPKFQNEA-----DLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + K  +ER+   ++A +    + D    L  W+D + + +E+     T ++     + +LK        +Q+  +  N      L+  +   DK  VEDP        L  L+  WN +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  HK   + +K     ++      E S + + +E +  ++ + ++  ++R K L  +L  A+ F+S++ ++  WL   E+ L     +  LP+   E      +L  L E  E + K++ +    M          +  C       +++ +     +W  ++++  +R  KL E+L    G    +++ I      L + +  + I  P    +  V   I++H +F+ E++    QI  L K
Sbjct: 5619 LNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDP--------LSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIESSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQM----------MERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFI----NWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDK 6025          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 262.692 bits (670), Expect = 3.035e-69
Identity = 189/681 (27.75%), Postives = 344/681 (50.51%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK--LQNPSSFHKAPTKRYHDRVEFYKNIW-RNSKDSLNKSTDDLS---TNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR-------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            + +R  ER R+ + A +  K F +++  L  WL+ES   +++     + P K+   L K K   K L  ++  +  T R G  LK+K T+ D +   L +ML  +R KW+ +    +  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S ++  ++E+  ++    N    +   L+E+L  A+ F++ ++ L  WL  AE+ L+    LP   +E  L  LIE+H+  +++V+E ++ +    ++G+ IL  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + + +IP D+  V  +I +H IF+ E+++    +  + K +K  +++ +   + P       ++  +  W R+   SL  S    S    N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF   I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ G+NKYR       FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR
Sbjct: 6052 VVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTD-DIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAEDQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILPD--DEDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPV------LDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR 6715          

HSP 2 Score: 65.855 bits (159), Expect = 1.329e-9
Identity = 83/430 (19.30%), Postives = 174/430 (40.47%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLK-----------DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLL----KIKSLPKFQNEA-----DLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + K  +ER+   ++A +    + D    L  W+D + + +E+     T ++    ++  L KQ           L   ++ K           DK  VEDP        L  L+  WN +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  HK   + +K     ++      E S + + +E +  ++ + ++  ++R K L  +L  A+ F+S++ ++  WL   E+ L     +  LP+   E      +L  L E  E + K++ +    M          +  C       +++ +     +W  ++++  +R  KL E+L    G    +++ I      L + +  + I  P    +  V   I++H +F+ E++    QI  L K
Sbjct: 5615 LNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVEL-KQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDP--------LSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIESSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQM----------MERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFI----NWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDK 6021          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 268.085 bits (684), Expect = 1.273e-71
Identity = 193/694 (27.81%), Postives = 347/694 (50.00%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            K+ +RL ER R  ++A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L  ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S +R  ++E+  ++         +   L+ +LQ A+EF+S ++ L  WL +AE+ L+   +LP   +E  L  LIE+H+  +K+++E +  ++    +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + +  IP +++ V  +I +H  F+ E++     +  + K +K +  +P S           +A  KR+     FY +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +++
Sbjct:  741 KVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALP--DDEDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGRAGRKRF-PASGFYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNME 1413          

HSP 2 Score: 56.6102 bits (135), Expect = 4.502e-7
Identity = 54/262 (20.61%), Postives = 111/262 (42.37%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   IV+ +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   + +      ++   +  E S+++  +  +  ++   +    QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +       + T  +    G+ +L  C   A   +++ I     +W  + S+  ++  KL E+L
Sbjct:  397 DKHTVQDP--------LMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEAL 648          

HSP 3 Score: 53.9138 bits (128), Expect = 3.393e-6
Identity = 104/564 (18.44%), Postives = 243/564 (43.09%), Query Frame = 3
Query: 3663 DLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKS-IKISIQTADKNFDIYEHLTIRSFDI--KCFGNRIDN-SQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVLD----HLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLE-MLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEV-LIDECHMTENEINNHK-EDFKNLKLRMLNEIKNYEESDIR--NTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLV-ELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIE--IPCDMQNVNDIINKHLIFINELSE 5306
            D+   ++++E   K  +  IES + ++ + L   ++ L  +++       +RK++L    +    +  + + LQ+ + + E   +       +  T  EQ+ + +++    A K  + Y+ L +R   +  +C  +   N  Q I  LKE   K   ++ +L E+     +A      F +S  +   WL ++   + N   +P+ +LD     +D+ K    +++          + G++LK     +D    +L++ +L +++++W K+   +V    +L+    +    ++A   +  W+ +S      +L++  D D ++  L+      ++    H   D  N   R L E  +  + +++  N + E+ +++        +R   L+E+L  + +F   L  L  WL + E  L  +  P    + DLV  LI+ H+   K++ +  +++       + ++       +++V   + +  +RW  + + S  +  +L  +L       +++  L+    E L + +  +R    +P D   +  +I +H  F+  L E
Sbjct:  480 DVLAHQSTVEAVNKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNAHMEVCTAFAIKE-ETYKSLMLRGQQMLARCPRSAETNIDQDITNLKE---KWESVKSKLNEKKTKLEEALHLAMNFHNSLQDFINWLTQAEQTL-NVASRPSLILDTILFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQD---VVLIKNLLISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLADDNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQL-AEDQP-VHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRD-DSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLL----EWLAEAEQTLRFHGALPDDEDALRTLIEQHKEFMKRLEE 1028          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 268.47 bits (685), Expect = 3.953e-71
Identity = 193/687 (28.09%), Postives = 345/687 (50.22%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +RL ER R  ++A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L  ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S +R  ++E+  ++         +   L+ +LQ A+EF+S ++ L  WL +AE+ L+   +LP   +E  L  LIE+H+  +K+++E +  ++    +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + +  IP +++ V  +I +H  F+ E++     +  + K +K +  +P S           +A  KR+     FY +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 4495 KVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPD--DEDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGRAGRKRF-PASGFYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 5160          

HSP 2 Score: 56.225 bits (134), Expect = 7.681e-7
Identity = 54/262 (20.61%), Postives = 111/262 (42.37%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   IV+ +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   + +      ++   +  E S+++  +  +  ++   +    QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +       + T  +    G+ +L  C   A   +++ I     +W  + S+  ++  KL E+L
Sbjct: 4151 DKHTVQDP--------LMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEAL 4402          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 267.7 bits (683), Expect = 5.790e-71
Identity = 193/687 (28.09%), Postives = 345/687 (50.22%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +RL ER R  ++A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L  ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S +R  ++E+  ++         +   L+ +LQ A+EF+S ++ L  WL +AE+ L+   +LP   +E  L  LIE+H+  +K+++E +  ++    +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + +  IP +++ V  +I +H  F+ E++     +  + K +K +  +P S           +A  KR+     FY +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 6509 KVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPD--DEDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGRAGRKRF-PASGFYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 7174          

HSP 2 Score: 56.6102 bits (135), Expect = 5.605e-7
Identity = 55/262 (20.99%), Postives = 110/262 (41.98%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   IV+ +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++   +  E S+++  +  +  ++   +    QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +       + T  +    G+ +L  C   A   +++ I     +W  + S+  ++  KL E+L
Sbjct: 6165 DKHTVQDP--------LMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEAL 6416          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 267.314 bits (682), Expect = 9.757e-71
Identity = 193/687 (28.09%), Postives = 345/687 (50.22%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +RL ER R  ++A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L  ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S +R  ++E+  ++         +   L+ +LQ A+EF+S ++ L  WL +AE+ L+   +LP   +E  L  LIE+H+  +K+++E +  ++    +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + +  IP +++ V  +I +H  F+ E++     +  + K +K +  +P S           +A  KR+     FY +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 6796 KVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPD--DEDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGRAGRKRF-PASGFYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 7461          

HSP 2 Score: 56.225 bits (134), Expect = 7.340e-7
Identity = 55/262 (20.99%), Postives = 110/262 (41.98%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   IV+ +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++   +  E S+++  +  +  ++   +    QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +       + T  +    G+ +L  C   A   +++ I     +W  + S+  ++  KL E+L
Sbjct: 6452 DKHTVQDP--------LMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEAL 6703          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 266.929 bits (681), Expect = 9.864e-71
Identity = 193/694 (27.81%), Postives = 347/694 (50.00%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIK-SLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            K+ +RL ER R  ++A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L  ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S +R  ++E+  ++         +   L+ +LQ A+EF+S ++ L  WL +AE+ L+   +LP   +E  L  LIE+H+  +K+++E +  ++    +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + +  IP +++ V  +I +H  F+ E++     +  + K +K +  +P S           +A  KR+     FY +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +++
Sbjct: 4278 KVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPD--DEDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGRAGRKRF-PASGFYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNME 4950          

HSP 2 Score: 55.4546 bits (132), Expect = 1.206e-6
Identity = 54/262 (20.61%), Postives = 111/262 (42.37%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLR---MLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   IV+ +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   + +      ++   +  E S+++  +  +  ++   +    QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +       + T  +    G+ +L  C   A   +++ I     +W  + S+  ++  KL E+L
Sbjct: 3934 DKHTVQDP--------LMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEAL 4185          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. UniProt/SwissProt
Match: sp|Q91ZU6|DYST_MOUSE (Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2)

HSP 1 Score: 267.7 bits (683), Expect = 4.050e-70
Identity = 193/687 (28.09%), Postives = 345/687 (50.22%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +RL ER R  ++A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L  ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E    + S +R  ++E+  ++         +   L+ +LQ A+EF+S ++ L  WL +AE+ L+   +LP   +E  L  LIE+H+  +K+++E +  ++    +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      +  + +  IP +++ V  +I +H  F+ E++     +  + K +K +  +P S           +A  KR+     FY +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 6509 KVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPD--DEDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGRAGRKRF-PASGFYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 7174          

HSP 2 Score: 56.6102 bits (135), Expect = 3.921e-6
Identity = 55/262 (20.99%), Postives = 110/262 (41.98%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   IV+ +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++   +  E S+++  +  +  ++   +    QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +       + T  +    G+ +L  C   A   +++ I     +W  + S+  ++  KL E+L
Sbjct: 6165 DKHTVQDP--------LMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEAL 6416          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. UniProt/SwissProt
Match: sp|D3ZHV2|MACF1_RAT (Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.241e-67
Identity = 188/679 (27.69%), Postives = 334/679 (49.19%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKL--RMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDL--------STNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPER---RSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            K+ +R  ER R  + A +  K F +++  L  WL+++   +++     + P K+   L K K   K L  +   +  T+R G  LK+K  + D +   L  +L  +R KW+ +    V  +  L   L+ +G   DA++ +  W+     +   D  + GDLD V  L+D   + + E+       + LK   R L E    + + ++  ++E+  ++         +   L+++L+ A+EF   ++ L  WL +AE+ L+ +       EA L  LI+ H+  +K+V+E +  +     +G+VIL  CHP     +   I    +R+ ++ + ++   ++L  +L  L  +  L+EEL+  +      +    +  IP ++  V  +I +H  F+ E++     +  + K +K +N    H AP         F +     S+ SLN+ T           + N R+N L+ ++ ++W L++E +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT K  +  V +IF+++ +  I Y +F+ +L P +   R   D      DK      I D + ++VA C C  R+ V++ G+NKYRFG + +L +VR L STVMVR+GGGW  + EFL KNDPCR
Sbjct: 4576 KVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLAD-DAQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIESSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEA-LQSLIDTHKEFMKKVEEKRVDVNAAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALITEHQSFMEEMTRKQPDVDRVTKTYKRKNIEPTH-AP---------FIEKSRSGSRKSLNQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDA-----DK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR 5231          

HSP 2 Score: 60.8474 bits (146), Expect = 2.221e-7
Identity = 81/407 (19.90%), Postives = 169/407 (41.52%), Query Frame = 3
Query: 4137 RERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPT---KVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGK-VILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKI---QNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQI 5321
            +ER+     A +    + D+   +  WLD + + +       T    V D L+++K    ++  Q          G  +  K T ++ ++ I+ E L  L+  W  +   I   +  L   L+  G    A++ +  W+  +         + GD   +EV + + H+ +N++  H+   E        +L      + S +R+ +E +   +   +   ++R + LQ +LQ A+ F+S++ E  + L + E  L   S P         E ++ H  L  Q++  +       + G+ ++L+     + +   + +     +W+ ++S+ E+R  KL E+L       +L  E    + E +N +   +  + I  P    +  V   I +H +F NE++    QI
Sbjct: 4144 KERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIRLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKAT-DETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMGWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEEFLLELNRMESQLSA-SKPTGGLPETAREQLDAHMELHSQLRAKEEIYNQLLDKGRLMLLSRGDSGSGSKTEQSVALLEQKWHVVSSKVEERKSKLEEAL-------SLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQI 4541          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. UniProt/SwissProt
Match: sp|Q03001|DYST_HUMAN (Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4)

HSP 1 Score: 256.144 bits (653), Expect = 1.426e-66
Identity = 190/687 (27.66%), Postives = 343/687 (49.93%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKS-LPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQ--NPSSFH---------KAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +RL ER R  + A +  K F ++++ L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LK+K ++ D +   L +ML  LR KW+ I    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID     + E+       + LK   R L E    + S ++  ++E+  ++         +   L+ +L+ A+EF+S ++ L  WL +AE+ L+    LP   +E  L  LI++H+  +K+++E +  +     +G  +L  CHP +   +   I    +R+ ++ + ++   ++L  +L  L     L+E L+  +      + ++ +  IP +++ V  +I +H  F+ E++     +  + K +K +  +PSS           +A  KR+      Y +            T   + N R+N L +++ ++W L++E +  L + L  L E  +   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K I   DK      I D + ++VA C C  R+ V++ GDNKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 6687 KVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLAD-DNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLP--DDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRF-PASSLYPS---------GSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADK------IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 7352          

HSP 2 Score: 63.929 bits (154), Expect = 2.611e-8
Identity = 56/262 (21.37%), Postives = 112/262 (42.75%), Query Frame = 3
Query: 4368 DKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEK-LLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL 5141
            DK TV+DP        L  L+  W+ +   I+  +  L   L+  G    A+  +  W+  +         + GD   +E+ + + H+ +N++  H+   E        ++      E S+++N +E +  ++   +   +QR + L  +L+ AK F+ ++ +L  WL   E+ LL  K L      A   E +  H  +    +  + T  +    G+ +L  C   A   +++ I     +W  + ++  +R  KL E+L
Sbjct: 6343 DKHTVQDP--------LMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAK--EQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEAL 6594          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. UniProt/SwissProt
Match: sp|Q9UPN3|MACF1_HUMAN (Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4)

HSP 1 Score: 253.062 bits (645), Expect = 1.153e-65
Identity = 182/672 (27.08%), Postives = 333/672 (49.55%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTV-EDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESD--IRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPER---RSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            K+ +R  ER R  + A +  K F +++  L  WL+++   +++     + P K+   L K K   K L  +   +  T+R G  LK+K  + ED +K  L   L  +R KW+ +    V  +  L   L+ +G   DA++ +  W+     +   D  + GDLD V  L+D   + + E+       + LK      I+N  +    ++  ++E+  ++         +   L+++L+ A+ F   ++ L  WL +AE+ L+ +       EA L  LI+ H+  +K+V+E +  + +   +G+VIL  CHP     +   I    +R+ ++ + ++   ++L  +L  L  +  L+EEL+  +      +    +  IP ++  V  +I +H  F+ E++     +  + K +K +N    H    ++   R    K++ + +   +   +   + N R+N L+ ++ ++W L++E +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT K  +  V +IF+++ +  I Y +F+ +L P +   R   D      DK      I D + ++VA C C  R+ V++ G+NKYRFG + +L +VR L STVMVR+GGGW  + EFL KNDPCR
Sbjct: 6534 KVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDSQK--LDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPDDTEA-LQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEK--SRSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDA-----DK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR 7189          

HSP 2 Score: 62.3882 bits (150), Expect = 6.505e-8
Identity = 82/409 (20.05%), Postives = 168/409 (41.08%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPT---KVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNY-VNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQI 5321
            + K  +ER+     A +    + D+   +  WLD + + +       T    V D L+++K    ++  Q          G  +  K T ++ ++ I+ E L  L+  W  +   I   +  L   L+  G    A++ +  W+  +         + GD   +EV + + H+ +N++  H+   E        +L      + S +R+ +E +   +   +   ++R + LQ +LQ A+ F+S++ +  + L + E  L   S P         E ++ H  L  Q+K  + T     + G+++L +     +     + +     +W+ ++S+ E+R  KL E+L         ++E I      L   +  + I  P    +  V   I +H +F NE++    QI
Sbjct: 6097 LNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKAT-DETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSA-SKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFI----NWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQI 6499          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. UniProt/SwissProt
Match: sp|Q9QXZ0|MACF1_MOUSE (Microtubule-actin cross-linking factor 1 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2)

HSP 1 Score: 243.432 bits (620), Expect = 9.466e-63
Identity = 187/690 (27.10%), Postives = 334/690 (48.41%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVE-DPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKL--RMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDL--------STNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEK----EQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPER---RSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRF------GQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            K+ +R  ER R  + A +  K F +++  L  WL+++   +++     + P K+   L K K   K L  +   +  T+R G  LK+K  +  D +K  L  +L  +R KW+ +    V  +  L   L+ +G   DA++ +  W+     +   D  + GDLD V  L+D   + + E+       + LK   R L E    + + ++  ++E+  ++         +   L+++L+ A+EF   ++ L  WL +AE+ L+ +       EA L  LI+ H+  +K+V+E +  +     +G+ IL  CHP     +   I    +R+ ++ + ++   ++L  +L  L  +  L+EEL+  +      +    +  IP ++  V  +I +H  F+ E++     +  + K +K ++    H AP         F +     S+ SLN+ T           + N R+N L+ ++ ++W L++E +  L + L  L E     ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT K  +  V +IF+++ +  I Y +F+ +L P +   R   D      DK      I D + ++VA C C  R+ V++ G+NKYRF      G + +L +VR L STVMVR+GGGW  + EFL KNDPCR
Sbjct: 6490 KVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLAGDTQK--LDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIEGSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEA-LQSLIDTHKEFMKKVEEKRVDVNTAVAMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALITEHQSFMEEMTRKQPDVDRVTKTYKRKSVEPTH-AP---------FMEKSRSGSRKSLNQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELCPELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDA-----DK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR 7155          

HSP 2 Score: 60.4622 bits (145), Expect = 2.550e-7
Identity = 80/412 (19.42%), Postives = 172/412 (41.75%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPT---KVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL---KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGK-VILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKI---QNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQI 5321
            + K  +ER+     A +    + D+   +  WLD + + +       T    V D L+++K    ++  Q          G  +  K T ++ ++ I+ E L  L+  W  +   I   +  L   L+  G    A++ +  W+  +         + GD   +EV + + H+ +N++  H+     +      +L      + S +R+ +E +   +   +   ++R + LQ +LQ A+ F+S++ +  + L + E  L   S P         E ++ H  L  Q++  +       + G+ ++L+     + +   + +     +W+ ++S+ E+R  KL E+L       +L  E    + E +N +   +  + I  P    +  V   I +H +F NE+++   QI
Sbjct: 6053 LNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKAT-DETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVATVNKAGSELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELNRMENQLSA-SKPTGGLPETAREQLDTHMELHSQLRAKEEIYNQLLDKGRLMLLSRGDSGSGSKTEQSVALLEQKWHAVSSKVEERKSKLEEAL-------SLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNDHRDQI 6455          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. TrEMBL
Match: A0A2C9KRX1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106066346 PE=4 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 1.486e-103
Identity = 320/1207 (26.51%), Postives = 597/1207 (49.46%), Query Frame = 3
Query: 2601 IISQDLVKQQYSSLKKMGKDVTQFVEKLE--TDLVPKANQI----VKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQ-YDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMN-PSKITVTCAEQIK---SIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKL--AKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFK---DQPTKVLDHLDKLK------NLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQKSKSMKMS 6155
            + +Q+L      ++K+   ++  F ++LE   +LV +  QI      + GQ   +EI +  E L        D I ++      A    D     +  +  W    E++L    + +PD   ++  + ELK   ++I      + ++    + +     + ++  ++ +K+ + EK+SEL++G+ ++ N L      +GE++ +++D I  L E ++Q+  +  +  +GD +Y  +  + L+ ++ +          L + +    D+   +++    +  +  K  EMK         + +K   +QE ++  K    EI   +  + +  + LK     G   +S E+    F      L++Q   IE  L      I+ C+       ++  +K L  ++   +  A KRKEK+  +  L + +  D   +  D L    +S++    PSK+      QI    + K  +    +N ++ +        +K FG + D   + ++  + G++L   K+ +R  ER R+  QAY+EDK F DS+  L  WLD+S   +  F    +QP      +D+LK         +QL+ ++  F  T R G  LKD+C   DPE+ IL +ML+ L+ KWN +R  +   ++ L+  L+ +G + DA++ +  W+  + A    ++ +LGDLDTV +LI++    + E+   +     L +R    +   + S++    + + +   +       R   L+E+L+LA+EF   +  +  +L +AE  LK ++LP  ++E  + +LIEKHE   + ++  + ++     + + IL++CHP A  +V   +  T +RW+Q+  R+  R ++L E+L +++G+ AL+EEL+  + +    +  + R  IP D++ V  ++ +HL F  E++  ++  + L    KL    S   A +K Y   ++       N  D  N          R+  L  ++  +W +S++ K  LQ+    L E E  + FDF+ W++ +L +I+ K  R+TD FRRQ     G+   EEF + ++KS FPTN+  L  VF+IF+K +N  I Y++F+D+L+ +R++++ KN N + K  V L IH+ IEKE++ C C   +  +   + KYRFG+  K  +VR+LN TVMVR+GGGW T+ EFL++NDPCR     +    +++ +S
Sbjct:   16 MYNQELPGLDPEAIKEQQAELAGFKKELEKARELVGECRQIGHDLSNVCGQSGAIEIQKQMEDLSHMTDEVNDKIRDRGDELRGAFQHADHFKKLVDSINSWLPQAEHQLALMKQPSPDPNTLQRQIEELKVFKSDIHPHIVDMQQLVQEAASLKDISPLASEALMKPVKV-LNEKWSELIRGLTDRENQLTDMQLKVGEVNQAMEDIIVSLDEAQSQMDAM--EEVQGDTKYLETRIRKLELMEADIKNKDKVVHKLNKAVD---DMLQQSDVNVTES-PLHKKRIEMKEKLRNTSATLRQKENRLQESIRKIKRFLGEIDDQLAQVNEFRSELKTNEPFGALPDSAEKQYAEFVIKCQHLDEQERDIEQLLNTGQDLIDHCKSAHDVQDITDHVKRLKERWTDTKDRARKRKEKMEGHL-LNVSHFHDTLKVFTDWLNNAEISMRGCKYPSKLVKIVTNQIAEHNTFKADLLAQTENMNMLDQSGTY---LKFFGKKQDT--VYVKNMQVGIRLRWKKLLRRSDERTRLLEQAYKEDKRFDDSWHELCDWLDQSMQSMSKFALSANQPAGTKQDIDELKKHEMIVRFNQQLTLKHPTFFSTTRLGRNLKDRCVKSDPEREILNQMLEDLKNKWNSVRSVVSRSQNKLDEALLNSGRVSDALQSLLEWLQKAEAALDEEMPILGDLDTVHMLIEQHRNIQQELTAREATV--LTMRAPGNLPAQQASELAQLWDRVNHLCDI-------RESKLKEALKLAEEFQDVVTLMREFLPQAEAQLKFRALP--EDEMVIFQLIEKHEKFQEDLRNHQESVEKIKGLAEDILSSCHPNAVRFVKYYLTITQTRWDQLLHRATTRGQRLQEALRNIQGNAALLEELLAWLTDAQALLATKERDPIPDDLKVVETLLKEHLEFHEEVTSKNNDAERL---SKLVTSESKMAAQSKGYGSNMKL------NEFDGYN---------PRVIALQNKWRTVWHMSMDRKKRLQDAHDTLLELESFKNFDFDLWRQRYLNWIQAKKFRITDFFRRQDKDSDGFLDREEFISGMLKSKFPTNRTELSAVFDIFDKASNGFIEYKNFVDALKADRKNRI-KNNNRSAKSDVEL-IHEEIEKELSNCQCRQSFKAEWLEEGKYRFGEKQKTCLVRFLNHTVMVRVGGGWVTLEEFLEQNDPCRAKGRTNFDLRETLALS 1178          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. TrEMBL
Match: A0A210QRC3 (Dystonin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24659 PE=4 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 1.656e-101
Identity = 252/811 (31.07%), Postives = 424/811 (52.28%), Query Frame = 3
Query: 3723 ESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMN---PSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENF-----KDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIK--DFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLD 6125
            E C  D  T +   ++ L  ++   +  A KRKEKLS + + + E+     TL+     L N  I   N   PSK+      Q++         D++ +  + L      +K F  + D   +   L    L+  K+ +R  ER R+   A+REDK F D++  L  WLDES   +  F     K   TK  +++D LK    +L+ ++  F+   R G  LKD+CT  DPE+ +L +ML  L+ KWN +R  I   ++ L+  L+ +G + DA+  +  W+  + A    D  +LGDLDT+ +LI++    + E+   ++    +K        N   S     +EE+E  +         R   L++SLQLA+EF   +  +  +L +AE  LK ++LP   +E  +++LIEKHE   + ++  +  +     + + IL NCHP A  +V   +  T +RW+Q+  R+++R ++L E+L S++G+ AL+E+L+  + +    +  + R  IP D++ V D+   H+ F +E++  ++ ++ L K  + + ++P   H +             N+  N  D  N          R+  L  ++  +W++S++ K  LQ+ L  L E E  + FDF  WK  +L +IK K +R+TD FRRQ  R  G  + ++F N ++ + FPTN+  L  VF+IF+++  + I Y+DFI++L+P R  +   N + N +     +IHD +EKE++ C C   +  +R  + KYRFG+   + +VR+LNSTVMVR+GGGW T+ EFL+ NDPCR  +S D
Sbjct: 2512 EKCDPDDVTQICDRLRKLKDRWNDTKDRAQKRKEKLSEHLENVDEFHG---TLKTFTDWLNNAEIAMRNFKYPSKLVDRVTVQLEEHNKMKMELDQHSERMQTLDRTGSYLKHFCRKQDTIYIKNLLVGIRLRWKKLLRRTDERGRLLTHAHREDKRFYDAWKGLCDWLDESSKTVARFMSPVAKGSATK--ENIDDLKRFQHELAGKHTTFYSATRLGRNLKDRCTKSDPEREVLQQMLDDLKDKWNSVRSVISRSQNKLDEALLTSGRVTDALTSLLEWLGKAEATLAEDQPVLGDLDTIHMLIEQHKGMQQELGAREQTVAAMKA-----AGNVSAS----HLEELETTWDRVNRLSDHRENKLRDSLQLAEEFQDVVQVMREFLPQAEAELKYRALP--DDEVAIIQLIEKHEKFQEDLRNHQDCVDKIKLLAEEILQNCHPNAIRFVKYYLTITQTRWDQLLQRAKNRGQRLQEALRSIQGNAALVEDLLAWLTDAQVLLSTKERDPIPDDLKVVEDLYKDHVEFHDEITSKNNDVERLTKIINSEPKSPGRIHGS-------------NMKLNENDIFN---------PRVITLQNKWRIVWRMSVDRKKNLQDALDTLLELESFKTFDFGVWKAKYLNWIKAKKMRVTDFFRRQDKRGDGLLLRDDFVNGMLITRFPTNRTELHAVFDIFDRDGRDVIEYKDFIEALKPTRHQKTRLNSS-NRQMTDAELIHDNVEKEISGCQCRNSFRAERLSEGKYRFGEKQNIRLVRFLNSTVMVRVGGGWVTLDEFLETNDPCRAGSSGD 3283          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. TrEMBL
Match: A0A0L8H184 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024678mg PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 7.988e-93
Identity = 293/1095 (26.76%), Postives = 540/1095 (49.32%), Query Frame = 3
Query: 2865 EIKKVFEWFEVMENRLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNG---LQSDFQNLCER-ISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKD---------QPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVV-TLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            E+  +  W  V   +L      + D+  +   + ELK    +       +D +   ++ +     V  +  ++ +  +I E++++L+KGI ++ ++L +    +GE+D ++++ +G L   +  I +L      GD +   +  K L+ + D+        S  +N  +  IS  GD +       R T  +   L+E++I T+       ++   +QE L+  K  S ++   + ++  L   LK  P  G   E+       F     +L+ + + +++        ++ CQ +    LS  +K L  ++   ++   +R++K+  + + + E+    +     +   E L      PSKI     EQIK      +      +  + L      +K FG + D   +   L    L+  K+ +R  ER R+  Q+Y ED+ F +S+ +L  WLD S  M+ +F           Q  K+ + +D+LK    QL+ +++ ++ T R G  LKD+CT  D ++ IL  ML  L+ KWN +R  +   ++ L+  L+ +G + DA+  +  W++ + A    D  +LGD DTV +LI++    + E+   ++  + LK        +  E  I + +  +  + +L     + R   L+E+L LA EF   +  +  +L   E  LK + LP   +E  ++ LIE+HE   ++++  + T+     + + IL +CHP A  +V   +  T +RW+Q+  RS  R+++L ++L S++G+ AL+EEL+  + +C   +  + +  IP D++ V  ++ +H     E++  ++    L K       +S  K    R+      Y + WR     LN+       N R+  L  ++  +W++S++ K  LQ+ L  L E E  + FDF+ W++ +L +I+ K LR+TD FRRQ     G    +EF   +I++ FPTNK  L  VF+IF+ N+  +I Y++FI +L+P+R  Q    +    ++   + +IHD +E++++ C C  ++  +R  D +YRFG+N KL +VR+LNS VMVR+GGGW T+ EFL+ NDPCR
Sbjct:  848 ELLAIRSWLPVSRQKLSVMKVPSTDKAALRHQIEELKLFKMQTHPHVADVDTLNQHMTALNDLSPVAAEYLMKPVS-DINEQWNDLIKGIADRESNLNETQVKVGEIDNAIENVLGSLTGIKTDIDSL--DEVIGDSKCIETQLKKLQLIQDDVKNQSLTTSKLKNAVDNLISRSGDADSPLQ---RKTNEVSKLLREVEIKTK-------DQENKLQETLRYVKKFSGDVDDMLHWITDLRMELKSQPPFGALPETARGQLDNFIKRCEELDIKEDCVKSLQINGQDMMDRCQPENIFQLSEKLKKLRERWHETKNRTLRRRDKMKEHLQHVEEFHTTLKKFSDWLNSAETLMRGFKFPSKIVEKVCEQIKEHADFKKDVQSYTEWMQKLDRTGTYLKYFGRKQDTIYIKNLLVGIRLRWKKLLRRTDERERLLQQSYHEDRRFEESWKDLCDWLDSSEDMLTSFLTPQVQASPLTQVNKMKEEMDELKLFQHQLAAKHSLYYSTTRLGRNLKDRCTKSDQDRDILQAMLDQLKNKWNLVRSVVSKSQNKLDEALLTSGRVSDALNSLQEWLSKAEAMLSKDECILGDYDTVNLLIEQHKSVQQELEAREQTLEALK-----SAGSIPEQHIEDLVF-LWKRINLLS---ESREARLKEALTLADEFQEVVQVMREFLPTVESELKFRPLP--DDELSIIHLIERHEKFQERLRNHQDTVDKIKVLAERILKHCHPNAVRFVKYYLTITQTRWDQLIQRSHSRAQRLQDALKSIQGNAALLEELLAWLTDCQVLLATKEKDPIPEDIRVVETLLKEHQDLHEEITSKNADADRLTKIV-----TSESKLSQGRH------YGSNWR-----LNEID---GHNPRVIALQNKWRTVWRMSVDRKKKLQDALETLMELESFKNFDFDLWRQRYLGWIQEKKLRITDFFRRQDKDCDGALTRKEFVEGMIQTKFPTNKTELNAVFDIFDPNHTGKIVYRNFIAALKPDRHKQA--RLKTGKRQATDSEMIHDEVERQISQCQCRHQFKAERIQDGQYRFGENLKLKLVRFLNSCVMVRVGGGWVTLDEFLETNDPCR 1897          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. TrEMBL
Match: A0A0L8H273 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024678mg PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 2.461e-91
Identity = 294/1098 (26.78%), Postives = 540/1098 (49.18%), Query Frame = 3
Query: 2865 EIKKVFEWFEVMENRLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGII---EKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNG---LQSDFQNLCER-ISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKD---------QPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVV-TLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            E+  +  W  V   +L      + D+  +   + ELK    +       +D +   ++ +     V  +  ++ +  +I E++++L+KGI    E+ ++L +    +GE+D ++++ +G L   +  I +L      GD +   +  K L+ + D+        S  +N  +  IS  GD +       R T  +   L+E++I T+       ++   +QE L+  K  S ++   + ++  L   LK  P  G   E+       F     +L+ + + +++        ++ CQ +    LS  +K L  ++   ++   +R++K+  + + + E+    +     +   E L      PSKI     EQIK      +      +  + L      +K FG + D   +   L    L+  K+ +R  ER R+  Q+Y ED+ F +S+ +L  WLD S  M+ +F           Q  K+ + +D+LK    QL+ +++ ++ T R G  LKD+CT  D ++ IL  ML  L+ KWN +R  +   ++ L+  L+ +G + DA+  +  W++ + A    D  +LGD DTV +LI++    + E+   ++  + LK        +  E  I + +  +  + +L     + R   L+E+L LA EF   +  +  +L   E  LK + LP   +E  ++ LIE+HE   ++++  + T+     + + IL +CHP A  +V   +  T +RW+Q+  RS  R+++L ++L S++G+ AL+EEL+  + +C   +  + +  IP D++ V  ++ +H     E++  ++    L K       +S  K    R+      Y + WR     LN+       N R+  L  ++  +W++S++ K  LQ+ L  L E E  + FDF+ W++ +L +I+ K LR+TD FRRQ     G    +EF   +I++ FPTNK  L  VF+IF+ N+  +I Y++FI +L+P+R  Q    +    ++   + +IHD +E++++ C C  ++  +R  D +YRFG+N KL +VR+LNS VMVR+GGGW T+ EFL+ NDPCR
Sbjct:  848 ELLAIRSWLPVSRQKLSVMKVPSTDKAALRHQIEELKLFKMQTHPHVADVDTLNQHMTALNDLSPVAAEYLMKPVS-DINEQWNDLIKGIADREEEQSNLNETQVKVGEIDNAIENVLGSLTGIKTDIDSL--DEVIGDSKCIETQLKKLQLIQDDVKNQSLTTSKLKNAVDNLISRSGDADSPLQ---RKTNEVSKLLREVEIKTK-------DQENKLQETLRYVKKFSGDVDDMLHWITDLRMELKSQPPFGALPETARGQLDNFIKRCEELDIKEDCVKSLQINGQDMMDRCQPENIFQLSEKLKKLRERWHETKNRTLRRRDKMKEHLQHVEEFHTTLKKFSDWLNSAETLMRGFKFPSKIVEKVCEQIKEHADFKKDVQSYTEWMQKLDRTGTYLKYFGRKQDTIYIKNLLVGIRLRWKKLLRRTDERERLLQQSYHEDRRFEESWKDLCDWLDSSEDMLTSFLTPQVQASPLTQVNKMKEEMDELKLFQHQLAAKHSLYYSTTRLGRNLKDRCTKSDQDRDILQAMLDQLKNKWNLVRSVVSKSQNKLDEALLTSGRVSDALNSLQEWLSKAEAMLSKDECILGDYDTVNLLIEQHKSVQQELEAREQTLEALK-----SAGSIPEQHIEDLVF-LWKRINLLS---ESREARLKEALTLADEFQEVVQVMREFLPTVESELKFRPLP--DDELSIIHLIERHEKFQERLRNHQDTVDKIKVLAERILKHCHPNAVRFVKYYLTITQTRWDQLIQRSHSRAQRLQDALKSIQGNAALLEELLAWLTDCQVLLATKEKDPIPEDIRVVETLLKEHQDLHEEITSKNADADRLTKIV-----TSESKLSQGRH------YGSNWR-----LNEID---GHNPRVIALQNKWRTVWRMSVDRKKKLQDALETLMELESFKNFDFDLWRQRYLGWIQEKKLRITDFFRRQDKDCDGALTRKEFVEGMIQTKFPTNKTELNAVFDIFDPNHTGKIVYRNFIAALKPDRHKQA--RLKTGKRQATDSEMIHDEVERQISQCQCRHQFKAERIQDGQYRFGENLKLKLVRFLNSCVMVRVGGGWVTLDEFLETNDPCR 1900          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. TrEMBL
Match: A0A0L8H0R3 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024678mg PE=4 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 9.646e-90
Identity = 293/1112 (26.35%), Postives = 540/1112 (48.56%), Query Frame = 3
Query: 2865 EIKKVFEWFEVMENRLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNG---LQSDFQNLCER-ISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKD---------QPTKVLDHLDKLKN-----------------LCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVV-TLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            E+  +  W  V   +L      + D+  +   + ELK    +       +D +   ++ +     V  +  ++ +  +I E++++L+KGI ++ ++L +    +GE+D ++++ +G L   +  I +L      GD +   +  K L+ + D+        S  +N  +  IS  GD +       R T  +   L+E++I T+       ++   +QE L+  K  S ++   + ++  L   LK  P  G   E+       F     +L+ + + +++        ++ CQ +    LS  +K L  ++   ++   +R++K+  + + + E+    +     +   E L      PSKI     EQIK      +      +  + L      +K FG + D   +   L    L+  K+ +R  ER R+  Q+Y ED+ F +S+ +L  WLD S  M+ +F           Q  K+ + +D+LK                     QL+ +++ ++ T R G  LKD+CT  D ++ IL  ML  L+ KWN +R  +   ++ L+  L+ +G + DA+  +  W++ + A    D  +LGD DTV +LI++    + E+   ++  + LK        +  E  I + +  +  + +L     + R   L+E+L LA EF   +  +  +L   E  LK + LP   +E  ++ LIE+HE   ++++  + T+     + + IL +CHP A  +V   +  T +RW+Q+  RS  R+++L ++L S++G+ AL+EEL+  + +C   +  + +  IP D++ V  ++ +H     E++  ++    L K       +S  K    R+      Y + WR     LN+       N R+  L  ++  +W++S++ K  LQ+ L  L E E  + FDF+ W++ +L +I+ K LR+TD FRRQ     G    +EF   +I++ FPTNK  L  VF+IF+ N+  +I Y++FI +L+P+R  Q    +    ++   + +IHD +E++++ C C  ++  +R  D +YRFG+N KL +VR+LNS VMVR+GGGW T+ EFL+ NDPCR
Sbjct:  848 ELLAIRSWLPVSRQKLSVMKVPSTDKAALRHQIEELKLFKMQTHPHVADVDTLNQHMTALNDLSPVAAEYLMKPVS-DINEQWNDLIKGIADRESNLNETQVKVGEIDNAIENVLGSLTGIKTDIDSL--DEVIGDSKCIETQLKKLQLIQDDVKNQSLTTSKLKNAVDNLISRSGDADSPLQ---RKTNEVSKLLREVEIKTK-------DQENKLQETLRYVKKFSGDVDDMLHWITDLRMELKSQPPFGALPETARGQLDNFIKRCEELDIKEDCVKSLQINGQDMMDRCQPENIFQLSEKLKKLRERWHETKNRTLRRRDKMKEHLQHVEEFHTTLKKFSDWLNSAETLMRGFKFPSKIVEKVCEQIKEHADFKKDVQSYTEWMQKLDRTGTYLKYFGRKQDTIYIKNLLVGIRLRWKKLLRRTDERERLLQQSYHEDRRFEESWKDLCDWLDSSEDMLTSFLTPQVQASPLTQVNKMKEEMDELKPKPVDMETRISQLLHVKLFQHQLAAKHSLYYSTTRLGRNLKDRCTKSDQDRDILQAMLDQLKNKWNLVRSVVSKSQNKLDEALLTSGRVSDALNSLQEWLSKAEAMLSKDECILGDYDTVNLLIEQHKSVQQELEAREQTLEALK-----SAGSIPEQHIEDLVF-LWKRINLLS---ESREARLKEALTLADEFQEVVQVMREFLPTVESELKFRPLP--DDELSIIHLIERHEKFQERLRNHQDTVDKIKVLAERILKHCHPNAVRFVKYYLTITQTRWDQLIQRSHSRAQRLQDALKSIQGNAALLEELLAWLTDCQVLLATKEKDPIPEDIRVVETLLKEHQDLHEEITSKNADADRLTKIV-----TSESKLSQGRH------YGSNWR-----LNEID---GHNPRVIALQNKWRTVWRMSVDRKKKLQDALETLMELESFKNFDFDLWRQRYLGWIQEKKLRITDFFRRQDKDCDGALTRKEFVEGMIQTKFPTNKTELNAVFDIFDPNHTGKIVYRNFIAALKPDRHKQA--RLKTGKRQATDSEMIHDEVERQISQCQCRHQFKAERIQDGQYRFGENLKLKLVRFLNSCVMVRVGGGWVTLDEFLETNDPCR 1914          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Cavefish
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 238.81 bits (608), Expect = 1.506e-62
Identity = 184/681 (27.02%), Postives = 342/681 (50.22%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFK---LQNPSSFHKAPT---KRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            K+ +R  ER R+ + A +  K F +S+  L  WL+ES   +++     + P K+   L + K   K L  +++ +  T R G  LKDK +++D +   L +ML  LR KW+ +    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E  + + S ++  ++E+  ++         +   L+++L  A+EF+S ++ L  WL +AE+ L+   SLP   +E  L  LIE+H+  +K+++E +  +    ++G+ IL  CHP +   V        +R+ ++ + +    ++L+ +   L  +  L+E L+  +      +  + +  +P +++ V  +I++H  F+ E++     +  + K  K      P    + P     R   +    +N++  +     +     + N R+N L +++ ++W L+++ +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF   I+ S FPT++  +  V +IF+++ +  I Y +F+ +L P + +   K +   DK      I D + ++VA C C  R+ V++ G NKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR
Sbjct:  920 KVVQRSVERGRLLDDARKRAKQFHESWTKLMEWLEESERALDSELEIANDPDKIKLQLAQHKEFQKALGGKHSVYDTTGRTGRALKDKTSLKD-DNQKLDDMLCELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAEDQPVHGDIDLVLNLIDSHKVFQKELGKRTGSVQALKRSARDLVENTHDDSSWVKVQMQELSTRWETVCALSVSKQTRLEQALCQAEEFHSTVHILLEWLAEAEQSLRFHGSLP--DDEEALRSLIEQHKEFMKKLEEKRVALGKAISMGEAILAICHPDSITTVKHWNTIIKARFEEVTAWARQHDQRLSTAFTELLATQELLESLLSWLQWAETTLTEKDKEPLPQEIEEVKALISEHQTFMEEMTRKQPDVDKVTKTHKRKATAEPLVQSQIPVLEKGRTCRKRSPTQNMYPATAQPQIE-----TKNPRVNLLVSKWQQVWLLALDRRRKLNDALDRLEELKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQDGKVTRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPLTDADK------IEDEVTRQVAKCKCPKRFQVEQIGANKYRFYLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR 1584          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Cavefish
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 239.195 bits (609), Expect = 1.998e-62
Identity = 180/680 (26.47%), Postives = 337/680 (49.56%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTV-EDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESD---IRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPER---RSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            K+ +R  +R R  ++A +  K F +++  L  WL+E+   +++     ++P K+   L K K   K L  +   +  T+R G  ++DK T+  D EK  L  +L  +R KW+ +    V  +  L   L+ +G   +A++ +  W+     +   D  + GDLD V  L+D     + E+       + LK R   E+ +    D   ++  ++E+ N++         +   LQ++L+ A+EF + +  L  WL +AE+ L+ + +   ++E  L EL+  H   ++ V+E +  +     +G+ IL  CHP     +   I    +R+ ++ + ++   ++L  +L  L  + AL+EEL+  +      +       +P D+  +  ++++H +F+ E++     +  + K +K + P+    +  +R   R +      + S+     +      N RL  L +++ ++W L+++ +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT+K  +  V +IF+++ +  I Y +F+ +L P +   R   D      DK      I D + ++VA C C  R+ V++ G+NKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR+
Sbjct: 4476 KLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKVQLTKHKEFQKALGSKQPVYDTTVRSGRAMRDKATLPADTEK--LDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQPVHGDLDLVSNLMDSHKAFQKELGKRTSSVQALK-RSARELMDTGRDDTAWVKVQLQELSNRWDTVCTLSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEESET-LQELLHTHRDFMQTVEEKRVDVNKAAGMGEGILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLPQDIPQLKTLMSEHQMFMEEMTRKQPDVDKVTKTYK-RKPAEPPSSLAERRGTRKQ------QQSQQQQQHAVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLHDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTSKLEMMAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDA-----DK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRV 5133          

HSP 2 Score: 75.8702 bits (185), Expect = 5.954e-13
Identity = 82/418 (19.62%), Postives = 177/418 (42.34%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMI---ENFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVIL-----TNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + +  RER+    +A      + D+   +  +LD + + +   +      + V   +++LK    ++  Q  +       G  L  K T +  ++ ++ E L  LR  W+ +   I   +  L   L+  G    A+  +  W++ + A       +  D   +E+ + + H+  N++ +H+   E   +    +L+     E S +R+ ++E+   +   +   ++R K L+ +LQ A+ F+ +L E   WLR+ E  L   + P         E +++H  L  Q+ +         + G+ +L         P  T     L     ++W  +N++ +DR  KL E++    G  + +++ I      L + +  + +  P    +  V   I++H +F+NE++    Q+ +L K
Sbjct: 4036 LNRTWRERMEKLEEAMTASVQYQDALQGMFDYLDNAVIKLCEMQTIGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLCHQGELLLKKVT-DQTDRDMIQEPLTELRHLWDNLGEKITLRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPVSSDPKAIEIELAKHHVLRNDVLSHRATVETVNSAGSELLDSSPGDEASHLRDQLDELNRSWDSLLLKTKERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLS-AAKPTGGLPETAREQLQQHMELQSQLSQRGEQYHRLLDQGESMLLARGGEEAGPGTTQTQQNLAL-LQNKWASLNTKMDDRRAKLEEAVSLATGFQSSLQDTI----NWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEK 4446          

HSP 3 Score: 61.6178 bits (148), Expect = 1.318e-8
Identity = 108/522 (20.69%), Postives = 211/522 (40.42%), Query Frame = 3
Query: 4074 SQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQ---PTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVED--PEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL-----KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVEL-IEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCH-PMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL---GSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRF 5594
            S L  +L E       +  + +ER ++   A ++ + F         WL  +   +   K     P    + L +   L  QLS +   +H  L  G  +      E+  P      + L  L+ KW  +   +   ++ L   +        +++    W+  +             LDTV   IDE  +  NE+N H+E    L     +LR  +  ++     I+N +  ++ ++   V     R + L E+ + AK+F+    +L  WL +AE   ++ S  +  NE D +++ + KH+   K +   +         G+ +      P  T  ++ L+ +   +W+ +  +S +R  KL E+L   G    +   + + +Y+V   L + Q      +  D+  V+++++ H  F  EL +  S +++L +  +    +   +  T     +++   N W    D++   T  +S  TRL        +  K + E + A+Q  L  L+E EQ  RF
Sbjct: 4239 SHLRDQLDELNRSWDSLLLKTKERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQSQLSQRGEQYHRLLDQGESMLLARGGEEAGPGTTQTQQNLALLQNKWASLNTKMDDRRAKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDV--VLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAES--RLDSELEISNEPDKIKVQLTKHKEFQKALGSKQPVYDTTVRSGRAMRDKATLPADTEKLDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQ-----PVHGDLDLVSNLMDSHKAFQKELGKRTSSVQALKRSARELMDTG--RDDTAWVKVQLQELSNRW----DTV--CTLSVSKQTRL-------QQALKQAEEFRTAVQMLLEWLSEAEQTLRF 4736          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Cavefish
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 238.424 bits (607), Expect = 3.780e-62
Identity = 179/684 (26.17%), Postives = 339/684 (49.56%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTV-EDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESD---IRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            K+ +R  +R R  ++A +  K F +++  L  WL+E+   +++     ++P K+   L K K   K L  +   +  T+R G  ++DK T+  D EK  L  +L  +R KW+ +    V  +  L   L+ +G   +A++ +  W+     +   D  + GDLD V  L+D     + E+       + LK R   E+ +    D   ++  ++E+ N++         +   LQ++L+ A+EF + +  L  WL +AE+ L+ + +   ++E  L EL+  H   ++ V+E +  +     +G+ IL  CHP     +   I    +R+ ++ + ++   ++L  +L  L  + AL+EEL+  +      +       +P D+  +  ++++H +F+ E++     +  + K +K + P+    +  +R   R +      + S+     +      N RL  L +++ ++W L+++ +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPT+K  +  V +IF+++ +  I Y +F+ +L P + +   +     DK      I D + ++VA C C  R+ V++ G+NKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +L+
Sbjct: 4824 KLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKVQLTKHKEFQKALGSKQPVYDTTVRSGRAMRDKATLPADTEK--LDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQPVHGDLDLVSNLMDSHKAFQKELGKRTSSVQALK-RSARELMDTGRDDTAWVKVQLQELSNRWDTVCTLSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEESET-LQELLHTHRDFMQTVEEKRVDVNKAAGMGEGILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLPQDIPQLKTLMSEHQMFMEEMTRKQPDVDKVTKTYK-RKPAEPPSSLAERRGTRKQ------QQSQQQQQHAVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLHDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTSKLEMMAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNLE 5488          

HSP 2 Score: 75.8702 bits (185), Expect = 7.370e-13
Identity = 82/418 (19.62%), Postives = 177/418 (42.34%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMI---ENFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHK---EDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVIL-----TNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD--MQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            + +  RER+    +A      + D+   +  +LD + + +   +      + V   +++LK    ++  Q  +       G  L  K T +  ++ ++ E L  LR  W+ +   I   +  L   L+  G    A+  +  W++ + A       +  D   +E+ + + H+  N++ +H+   E   +    +L+     E S +R+ ++E+   +   +   ++R K L+ +LQ A+ F+ +L E   WLR+ E  L   + P         E +++H  L  Q+ +         + G+ +L         P  T     L     ++W  +N++ +DR  KL E++    G  + +++ I      L + +  + +  P    +  V   I++H +F+NE++    Q+ +L K
Sbjct: 4384 LNRTWRERMEKLEEAMTASVQYQDALQGMFDYLDNAVIKLCEMQTIGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLCHQGELLLKKVT-DQTDRDMIQEPLTELRHLWDNLGEKITLRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPVSSDPKAIEIELAKHHVLRNDVLSHRATVETVNSAGSELLDSSPGDEASHLRDQLDELNRSWDSLLLKTKERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLS-AAKPTGGLPETAREQLQQHMELQSQLSQRGEQYHRLLDQGESMLLARGGEEAGPGTTQTQQNLAL-LQNKWASLNTKMDDRRAKLEEAVSLATGFQSSLQDTI----NWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEK 4794          

HSP 3 Score: 61.2326 bits (147), Expect = 1.657e-8
Identity = 108/522 (20.69%), Postives = 211/522 (40.42%), Query Frame = 3
Query: 4074 SQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQ---PTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVED--PEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL-----KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVEL-IEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCH-PMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL---GSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRF 5594
            S L  +L E       +  + +ER ++   A ++ + F         WL  +   +   K     P    + L +   L  QLS +   +H  L  G  +      E+  P      + L  L+ KW  +   +   ++ L   +        +++    W+  +             LDTV   IDE  +  NE+N H+E    L     +LR  +  ++     I+N +  ++ ++   V     R + L E+ + AK+F+    +L  WL +AE   ++ S  +  NE D +++ + KH+   K +   +         G+ +      P  T  ++ L+ +   +W+ +  +S +R  KL E+L   G    +   + + +Y+V   L + Q      +  D+  V+++++ H  F  EL +  S +++L +  +    +   +  T     +++   N W    D++   T  +S  TRL        +  K + E + A+Q  L  L+E EQ  RF
Sbjct: 4587 SHLRDQLDELNRSWDSLLLKTKERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQSQLSQRGEQYHRLLDQGESMLLARGGEEAGPGTTQTQQNLALLQNKWASLNTKMDDRRAKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDV--VLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAES--RLDSELEISNEPDKIKVQLTKHKEFQKALGSKQPVYDTTVRSGRAMRDKATLPADTEKLDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAEDQ-----PVHGDLDLVSNLMDSHKAFQKELGKRTSSVQALKRSARELMDTG--RDDTAWVKVQLQELSNRW----DTV--CTLSVSKQTRL-------QQALKQAEEFRTAVQMLLEWLSEAEQTLRF 5084          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Cavefish
Match: macf1b (microtubule actin crosslinking factor 1b [Source:ZFIN;Acc:ZDB-GENE-100922-36])

HSP 1 Score: 115.931 bits (289), Expect = 3.231e-28
Identity = 67/180 (37.22%), Postives = 102/180 (56.67%), Query Frame = 3
Query: 5577 EQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPER---RSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            E+   FDFN W+K ++ +I     R+ D+FR       G    +EF + ++ S FPTN   +  V NIF+ N++  I Y +F+ +L P R   R  +D +            I++ + ++V+ C C  R+ V++   N+YRFG + +L MVR L ST+MVR+GGGW  + EFL KNDPCR
Sbjct:    4 EEFANFDFNLWRKRYMQWISHLKSRILDVFRAIDRDHDGRITQKEFVDSVLAS-FPTNSLEMTAVANIFDVNSDGYIDYYEFVSALHPSRDPYRRTIDADQ-----------INEEVSRQVSQCNCPKRFQVEQISANRYRFGDSQQLRMVRILRSTLMVRVGGGWTALDEFLVKNDPCR 171          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Cavefish
Match: ENSAMXT00000038065.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:11675492:11682368:1 gene:ENSAMXG00000041735.1 transcript:ENSAMXT00000038065.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 2.147e-11
Identity = 30/80 (37.50%), Postives = 50/80 (62.50%), Query Frame = 3
Query: 5880 DKKVVTLIIHDI-IEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIAN 6116
            +K+ V L +  + ++  ++ CTC  ++ + +  + KYR G +S L  VR L + VMVR+GGGW T+  +L K+DPCR  +
Sbjct:    5 NKRCVCLYLSCVQVQHLISRCTCPTQFPMVKISEGKYRVGDSSTLIFVRILRNHVMVRVGGGWDTLEHYLDKHDPCRCTS 84          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Sea Lamprey
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 236.498 bits (602), Expect = 2.540e-62
Identity = 202/807 (25.03%), Postives = 388/807 (48.08%), Query Frame = 3
Query: 3753 LSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITV-TCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKD---QPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESD---IRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            L   I+ L HK+K   +   +R+ KL    K  +E+    Q     + ++EN ++  ++P+ + + +   QI   K+     + + +    L      +K F  + D + +   L     +   I +   ER R  + A +  K F +S+  L  WL+ +   +++  D    P ++   L + K++ K L  +   +  T R G  LK++ T+ D ++  L  ML  LR KW+ I    V  +  L   L+ +G   +A++ +  W+         D  + GD+  V  LID   + + E+         LK R   ++ +  +SD   +R  + E+  ++         +   L  +L+ A+ F + +  +   L +AEK L+   +LP   +E  L  LI +H+  +++++  ++ +    ++G+ IL  CHP + + + + I    +R+ ++ + +     +L  +L  L  ++ L+EE++  + +    +    +  +P  +++++ +I++H  F+ E+     +++ + K +K + PS  H    +    R    K     S    + S    + N R+  L  ++ ++W +++E +  LQ+ L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF + I+ S FPTN+  +  V +IF+++ +  I Y +FI +L P + +   + I   DK      I D + ++VA C CT R+ V++ G+NKYR      FG + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +L+
Sbjct: 2431 LKYGIQDLEHKWKIVGNKLNERRAKLETALKTAIEFHNSLQDFIGWLTQMEN-NLNTLSPASLILDSVLFQIDEHKMLANEVNTHREQIIELDKTGTHLKYFSQKQDVALIKNLLLSVQTRWEHIMQSTLERGRSLDDARKRAKQFHESWTKLMDWLEGAEKGLDHELDCGNDPERIKLMLGRHKDIQKSLGAKQPIYDSTTRTGRTLKERATLVDDDQR-LDNMLSELRDKWDTICGKSVERQHKLEEALLFSGQFAEALQVLIDWLYKVEPHLSEDQPVHGDVALVMTLIDAHKVFQRELGKRASSVNALK-RSARDLLDSSKSDASWVRAQMAELSARWDTVCKLSLSKQARLDNALKQAEVFRTLVQSIMDVLAEAEKTLRFHGTLPD--DEDSLRLLIAQHKEFMERLEAQRSEVIRAVSMGEAILAVCHPDSASAIKQWINIIRTRFEEVMTWARQHQTRLEAALSELVSNSQLLEEMLAWLQKAQEMLAQRDQETLPEQIESLHYLISEHQGFMEEMMSKQPEMEQMTKSYK-RKPSESHALFDR---TRGSTRKRGGPQSTAPASPSQPLETKNPRITLLFNRWRQVWLVALERQRKLQDALERLQELKEFENFDFDVWRKRYMQWMNHKKSRVMDFFRRMDKDQDGKITRQEFIDGILSSRFPTNRLEMTAVADIFDRDGDGYIDYYEFIAALHPNKDAY--RPITDADK------IEDEVTRQVAACKCTRRFQVEQIGENKYRFYLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNLE 3220          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006484.1 (pep scaffold:Pmarinus_7.0:GL476558:220668:227717:-1 gene:ENSPMAG00000005854.1 transcript:ENSPMAT00000006484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 1.792e-24
Identity = 66/213 (30.99%), Postives = 106/213 (49.77%), Query Frame = 3
Query: 5502 FNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR----------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            ++++W  ++E +  L++ L       +  +F F  W+K F    K++  RL D+FRR    + G    +EF   I   G  + ++ L  V   F       + Y  F+  L P   S+    +   DK      I D + ++V+ C C  R+ V++  +NKYR          FG + +L +VR L STVMVR+GGGW ++ +FL+KNDPCR 
Sbjct:   28 WHQVWLAALERQGRLRDALQQSQTVSEQEKFSFAQWRKLFSQQTKLRKSRLMDIFRRLDGDQDGRITRDEFVREISLLGLGSEEWELDAVVGRFGVQEGTLVDYYQFVSELCP---SKAGGTMTDADK------IDDEVIRKVSACKCPQRFQVEQVEENKYRVSFTCGCRSQFGDSQQLRLVRILRSTVMVRVGGGWLSLGDFLQKNDPCRA 231          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006481.1 (pep scaffold:Pmarinus_7.0:GL476558:220668:230205:-1 gene:ENSPMAG00000005854.1 transcript:ENSPMAT00000006481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 2.104e-22
Identity = 93/367 (25.34%), Postives = 160/367 (43.60%), Query Frame = 3
Query: 5091 QINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIK--DFKLQNPSSFHKAPTKRYHDRVEFYK--NIWRNSKDSLNKSTDDLST--NTRLNFLNTQFNKLWKLSIEHKVALQNHL-----------MDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR----------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRI 6110
            Q++ R+      L+ SL  L     L EE+   + E  + +  +    +P D +++  +I++H   +  +     ++  L +    KL + S     P   + D+    K      +S  S   S   LS   +  +  L   ++++W  ++E +  L++ L                   + +F F  W+K F    K++  RL D+FRR    + G    +EF   I   G  + ++ L  V   F       + Y  F+  L P   S+    +   DK      I D + ++V+ C C  R+ V++  +NKYR          FG + +L +VR L STVMVR+GGGW ++ +FL+KNDPCR 
Sbjct:    3 QVSGRAWRLQAWLDTSLRELEEQAHLAEEMFLWLQEAQDSLAEKETELLPQDEESIQGLIDEHQSLMERMMLKQPEMDRLGRYNRRKLSSESQL-SGPLSPFLDKTRTRKLSGSQPDSPVSSPLSPGPLSEPRDPHVTALVACWHQVWLAALERQGRLRDALQQSQTVSEQVTASCKSTSGVEKFSFAQWRKLFSQQTKLRKSRLMDIFRRLDGDQDGRITRDEFVREISLLGLGSEEWELDAVVGRFGVQEGTLVDYYQFVSELCP---SKAGGTMTDADK------IDDEVIRKVSACKCPQRFQVEQVEENKYRVSFTCGCRSQFGDSQQLRLVRILRSTVMVRVGGGWLSLGDFLQKNDPCRA 359          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Sea Lamprey
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 65.855 bits (159), Expect = 1.087e-10
Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 5937 CTCTLRYYVKREGDNKYRFGQNSKLYMVR-YLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQKSKSMKMS 6155
            CTC +++ + R  + KYR G +S L  VR  L   VMVR+GGGW T+  +L K+DPCR      L  S+S+ ++
Sbjct:  198 CTCPVQFPMVRVSEGKYRVGDSSSLIYVRQILRKHVMVRVGGGWDTLEHYLDKHDPCRC-----LAPSESLPLT 266          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Sea Lamprey
Match: GAS2L1 (growth arrest specific 2 like 1 [Source:HGNC Symbol;Acc:HGNC:16955])

HSP 1 Score: 65.4698 bits (158), Expect = 1.112e-10
Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 5937 CTCTLRYYVKREGDNKYRFGQNSKLYMVR-YLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQKSKSMKMS 6155
            CTC +++ + R  + KYR G +S L  VR  L   VMVR+GGGW T+  +L K+DPCR      L  S+S+ ++
Sbjct:  196 CTCPVQFPMVRVSEGKYRVGDSSSLIYVRQILRKHVMVRVGGGWDTLEHYLDKHDPCRC-----LAPSESLPLT 264          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Nematostella
Match: EDO37706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF35])

HSP 1 Score: 213.001 bits (541), Expect = 3.529e-55
Identity = 190/748 (25.40%), Postives = 340/748 (45.45%), Query Frame = 3
Query: 4143 RIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKD---QPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEM-LKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNL---KLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKL-NELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD-MQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRY--HDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLR----PERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYR---------FGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIAN--SLDLQK--------SKSMKMSFSXXXXXXXXXXXXDEKPTVKKSIQYQKASSLSSRIPTGLSKK 6284
            R R  ++ YR    F     +L   LD +   ++N +     P  +   L K K     L    A    T++ G  L D+   ED    I +E  +  L+A+W+ +    V  +  L   L+ TG   DA++ +  W+         +  ++GD +TV++LID     + E+   + +++++      M+NE K  E + +   + ++  ++         +   L+ +L LAKEF+S +  EL +  +  E L ++   P  ++  ++ E +EKH     ++K+ +  + +    G+VIL  CHP A   + + + +   RW+++   S  R  +L E L  L     L+ EL+  +      +  + +  IP D  + V+ ++ +H +F  E+++       L K  K +   S  + P  +     R      I R+S    +      + N  ++ L+ ++  LW LS+E    LQ  L  +  K    +F+F  WK  F  ++     R+ D+FRR    R G    E+F   ++ + FPT ++ ++ V + F +N    I Y++F+++L+    PE+             K     IH+ I+++V  C C  ++   + G+NKYR         FG + KL ++R L STVMVR+GGGW+T+ EFL+KNDPCR     +LDL+         ++SM    S    + +       KPT + S      +SL  + P+G   K
Sbjct:  708 RKRSLDENYRMSSKFFGGVEDLMKMLDAAEEALKNEEPIGVDPAHLRTQLKKHKEFQTMLGANQAGLDATVKMGKQLMDRSLDED---AITIEGKIADLKARWDAVCGLSVERQQKLEEALLFTGMFQDALQSLLDWLFAVEPSLSTETAVMGDPETVQILIDNHKTFQRELGRREANYQSVMKAGRAMINENKVEEPAALEEKLADLRMRWDAVYAMSNTKQDRLENALVLAKEFDSSVKTELHILKQFEENLRELG--PIAEDLEEIKEQMEKHRVFHDELKQEEVNVQSAVKKGQVILRFCHPSAIQIIQQWLARLKKRWDEVWKWSSQRLMRLEEELRKLAEEDELMGELLRWIQTKEEALAEKEKEPIPDDDYEEVHRLLEEHKVFQEEMAKKQPSYDRLTKSAKRRTNGSTTRTPEVKATPSRRGGAVSRIPRSSPAGRS------AHNPAVSHLSKRWQHLWLLSMERLRRLQEKLERIAIKRASAKFNFPEWKSRFNKWLHDSKSRVQDIFRRMDHDRDGKLTREQFITGVLNTSFPTERWEMEIVASKFERNGL--IDYKEFMNALKDKPSPEK------------PKTDAQKIHNEIDRQVEHCCCAKQFSYFKVGENKYRVSHAKKERYFGDSQKLRLLRILRSTVMVRVGGGWETLQEFLEKNDPCRAEGRTNLDLRAQLVGDAGFAESMATFKSKRPSLSREGSDIGGKPTRESS-----GTSLRGKPPSGARPK 1425          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Nematostella
Match: EDO27804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T889])

HSP 1 Score: 68.9366 bits (167), Expect = 2.605e-14
Identity = 28/57 (49.12%), Postives = 36/57 (63.16%), Query Frame = 3
Query: 5937 CTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            CTC  RY V+R  D KY+ G +  L  VR +   VMVR+GGGW T+  +  K+DPCR
Sbjct:    1 CTCPTRYPVQRIADGKYKMGDSKNLIFVRVMRKHVMVRVGGGWDTLDRYFDKHDPCR 57          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Nematostella
Match: EDO33092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST60])

HSP 1 Score: 70.4774 bits (171), Expect = 6.803e-13
Identity = 28/57 (49.12%), Postives = 36/57 (63.16%), Query Frame = 3
Query: 5937 CTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCR 6107
            CTC  RY V+R  D KY+ G +  L  VR +   VMVR+GGGW T+  +  K+DPCR
Sbjct:  196 CTCPTRYPVQRIADGKYKMGDSKNLIFVRVMRKHVMVRVGGGWDTLDRYFDKHDPCR 252          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Nematostella
Match: EDO29908 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2A8])

HSP 1 Score: 53.1434 bits (126), Expect = 1.556e-6
Identity = 75/390 (19.23%), Postives = 164/390 (42.05%), Query Frame = 3
Query: 4215 WLDESYVMIENFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTL-----------RYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDL--KLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESD---IRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIK 5336
            WLDE  + +       T+       L  + +QL    A FH  L           + GS + ++C  ED E  ++   L+ +  +W+++       +  L   L++ G    A + +  W+  + +     L  K+ GD+  +E+ + +  + +N+I +H+    +L  R  + +    E+D   +   ++E++  +   +    QR   L+++L+ +  F S++ EL  WL +A + LK +     + E +  + + KH+ L + +   +        +   I   C      Y+  ++     RW ++ + S  R + L+E+          +E+L+  +      ++NE  I +  D  ++   + KH  F   L    + + + +K
Sbjct: 1030 WLDELELKLSEVPPVGTE-------LATVQEQLKLHKA-FHAELTPHQSEITQINQLGSTVGERCRHEDSE--LVHAQLEEVNHRWDELCNHSTGRQQKLEEALLQLGQFQLAFQELLVWLRQTDSTLDEQLAKKVQGDVKYIEIELAKHKILQNDILSHEPSVDSLS-RAASALLESGETDSTALEGKVQELKTTWDAVLAKSAQRQAELEKALKDSHSFMSQIKELRGWLNEASEFLKSRRAIGGRPE-NATKQLNKHKELKEDIDAHRDPYKGMRLLAHKISDVCIKEDGVYIEGIMSGLEERWKELLTTSSARKRSLDENYRMSSKFFGGVEDLMKMLDAAEEALKNEEPIGV--DPAHLRTQLKKHKEFQTMLGANQAGLDATVK 1405          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Medaka
Match: ENSORLT00000046669.1 (pep primary_assembly:ASM223467v1:15:24337939:24343724:-1 gene:ENSORLG00000026707.1 transcript:ENSORLT00000046669.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 9.658e-45
Identity = 139/568 (24.47%), Postives = 274/568 (48.24%), Query Frame = 3
Query: 4122 IQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIEN---FKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLK--LRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKI-KSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSS---------FHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDL---STNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQV 5771
            +QK + ER R+ + A +  K F +++  L  WLDES   +++     + P K+   L + K   K L  +++ +  T R G  LKDK ++ D  +  L +ML  LR KW+ +    V  ++ L   L+ +G   DA++ +  W+     +   D  + GD+D V  LID   + + E+       + LK   R L E  + + S ++  ++E+  ++    N    +   L+++L  A+EF+S ++ L  WL +AE+ L+   SLP    E  L+  IE+H+  +K+++E + ++    ++G+ I++ CHP +   +        +R+ ++ + +    ++LN +L  L  +  L+E L+  +      I N+    +P +++ +  +I +H +F+ E++     +  + K  K +  +           +K  T R            R+   ++  ST      + N R+N L +++  +W L+++ +  L + L  L E ++   FDF+ W+K ++ ++  K  R+ D FRR    + G    +EF   I+ S FPT++  +  V
Sbjct:   50 VQKSV-ERGRLLDDARKRTKQFHETFNKLMEWLDESERTLDSEVEIANDPDKIKTQLAQHKEFQKALGSKHSVYDTTARTGRALKDKTSLRDDHQK-LDDMLCELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAEDQPVHGDIDLVLHLIDNHKVFQKELGKRTVGVQALKRSARELIENTHDDSSWVKVQMQELSTRWETVCNLSVSKQGRLEQALCQAEEFHSTVHILLEWLAEAEQSLRFHGSLP--DEEETLLGQIEQHKEFMKKLEEKRVSVNKATSMGEAIISICHPDSITTIKHWNTIIKARFEEVQAWARQHQQRLNLALKELLATQELLETLLNWLQWAEANISNKDMEILPQEIEEIKTLIAEHQVFMEEMTRKQPDVDKITKTHKRKAAAEPPIQSQIPVLNKGRTGRK-----------RSPTQAMYASTTQTPIETKNPRVNLLVSKWQHVWLLALDRRRKLNDALDRLEELKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQDGKVTRQEFIEGILSSKFPTSRLEMSAV 602          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Medaka
Match: macf1b (microtubule actin crosslinking factor 1b [Source:ZFIN;Acc:ZDB-GENE-100922-36])

HSP 1 Score: 116.316 bits (290), Expect = 1.690e-28
Identity = 67/187 (35.83%), Postives = 108/187 (57.75%), Query Frame = 3
Query: 5571 EKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            + E+   FDFN W+K ++ +I     R+ D+FR     + G    +EF + ++ S FPTN   +  V NIF+ N +  I Y +F+ +L P R     K ++ +        I++ + ++V+ C+C  R+ V++   N+YRFG + +L MVR L ST+MVR+GGGW  + EFL KNDPCR+    +L+
Sbjct:    2 QMEEFANFDFNIWRKRYIQWISHMKSRILDVFRCIDRDQDGRISHKEFVDYVLAS-FPTNSLEMNAVANIFDTNADGFIDYYEFVSALHPSR-DPYRKTLDADQ-------INEEVSRQVSQCSCPKRFQVEQISANRYRFGDSQQLRMVRILRSTLMVRVGGGWTALDEFLVKNDPCRVKGRTNLK 179          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Medaka
Match: ENSORLT00000034832.1 (pep primary_assembly:ASM223467v1:11:16837571:16849096:-1 gene:ENSORLG00000026542.1 transcript:ENSORLT00000034832.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 4.086e-23
Identity = 63/167 (37.72%), Postives = 94/167 (56.29%), Query Frame = 3
Query: 5649 RLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRF------GQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIANSLDLQ 6131
            R+ D FRR    + G    +EF + I+ S FPT+K  +  V +IF+++ +  I Y +F+ +L P +     +     DK      I D + ++VA C C  R+ V++ G+NKYRF      G + +L +VR L STVMVR+GGGW  + EFL KNDPCR     +L+
Sbjct:   10 RVMDFFRRIDKDQDGKITRQEFIDGILASKFPTSKLEMTAVADIFDRDGDGYIDYYEFVAALHPNK--DAYRPTTDADK------IEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNLE 168          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Medaka
Match: gas2l1 (growth arrest specific 2 like 1 [Source:NCBI gene;Acc:101154873])

HSP 1 Score: 68.5514 bits (166), Expect = 8.683e-11
Identity = 29/80 (36.25%), Postives = 49/80 (61.25%), Query Frame = 3
Query: 5874 LNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIA 6113
            L D + +  ++ +I+ K    C+C  ++ + +  + KY+ G +S L  +R L + VMVR+GGGW T+  +L K+DPCR A
Sbjct:  225 LCDMRNLDELVREILGK----CSCPAQFPMIKVSEGKYKVGDSSALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCRCA 300          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Medaka
Match: gas2b (growth arrest-specific protein 2-like [Source:NCBI gene;Acc:101166700])

HSP 1 Score: 64.6994 bits (156), Expect = 2.290e-10
Identity = 30/70 (42.86%), Postives = 43/70 (61.43%), Query Frame = 3
Query: 5901 IIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNST-VMVRIGGGWQTITEFLKKNDPCR 6107
            I+  IIE     C+C  R+ V+++    YR G   K+  +R LN   VMVR+GGGW+T   +L+K+DPCR
Sbjct:  189 IVRGIIENPP--CSCPTRFSVEKQPKGSYRVGD--KVLYIRMLNERHVMVRVGGGWETFMGYLQKHDPCR 254          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Planmine SMEST
Match: SMESG000017519.1 (SMESG000017519.1)

HSP 1 Score: 2978.35 bits (7720), Expect = 0.000e+0
Identity = 1520/1536 (98.96%), Postives = 1529/1536 (99.54%), Query Frame = 3
Query: 1257 MDLPKNWDTNVSDIKNRIDEIKIYLDNLHIMEKDLQGIDKALSEDLSDQLEINFELLEKAITNIQYCEKERLLTYTDLDKIYNIILNNYLPTIITYENNKQLAESIITETNISLEEFIKDFXXXXXXXXXXXXPFVIDAIKYRKSNLQKLENILYEIEPLVEAVESYGFDLIEQLIELTSDYGSDCSFLQSIKDDLQEIRNKFRTLKNQIADLDSKIIELLSPNSKSHILEKLTSEYEIWHSLNDVLIKLDPVQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFDGVGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIAHSDSISTLTDADNKSTTSSVGFELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVTQFVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLSKEIHLHIDXXXXXXXXXXXXXXXGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDK 5864
            MDLPKNWDTNVSDIKNRIDEIKIYLDNL IMEKDLQGIDKALSEDLSDQLEINFELLEKAITNIQYCEKERLLTYTDLDKIYNIILNNYLPTIITYENNKQLAESIITETNISLEEFIKDFNNYTTYTNDNETPFVIDAIK RKSNLQKLENILYEIEPLVEAVESYGFDLIEQLIELTSDYGSDCSFLQSIKDD+QEIRNKFRTLKNQIADLDSKIIELLSPNSKSHILEKLTSEYEIWHSLNDVLIKLDPVQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFD +GIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQI HSDSISTLT+ADNKSTTSSV FELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVT+FVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYT+SCFKNLKFLD+EFNGLQSDFQNLCE+ISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLSKEIHLHIDYLEKLNNYLKLPPKLGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNS+LNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHE LVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCD+QNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKS DDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVFNIFNKNNNNEIPYQDFIDSLRPERRSQVDK
Sbjct:    1 MDLPKNWDTNVSDIKNRIDEIKIYLDNLQIMEKDLQGIDKALSEDLSDQLEINFELLEKAITNIQYCEKERLLTYTDLDKIYNIILNNYLPTIITYENNKQLAESIITETNISLEEFIKDFNNYTTYTNDNETPFVIDAIKDRKSNLQKLENILYEIEPLVEAVESYGFDLIEQLIELTSDYGSDCSFLQSIKDDIQEIRNKFRTLKNQIADLDSKIIELLSPNSKSHILEKLTSEYEIWHSLNDVLIKLDPVQSFPEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKEQFDDIGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKDLVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIVHSDSISTLTEADNKSTTSSVDFELDEKFDEDSKLELPNLTESKFPEEIISQDLVKQQYSSLKKMGKDVTEFVEKLETDLVPKANQIVKIGGQFCELEISEFTESLLEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFGEITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKNTLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQEFENQIKNLTPQSCKGDPEYTYSCFKNLKFLDEEFNGLQSDFQNLCEKISAHGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNEKLLSKEIHLHIDYLEKLNNYLKLPPKLGFSQESVEQSNLIFSNYIGDLNKQRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKEKLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSIKISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDIRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSRLNELDVWLRKAEKLLKIKSLPKFQNEADLVELIEKHEVLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDVQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSMDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVFNIFNKNNNNEIPYQDFIDSLRPERRSQVDK 1536          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Planmine SMEST
Match: SMESG000017520.1 (SMESG000017520.1)

HSP 1 Score: 535.798 bits (1379), Expect = 2.009e-154
Identity = 291/301 (96.68%), Postives = 295/301 (98.01%), Query Frame = 3
Query:   39 KALLFNNFHELFNESFPSSAKALTADIENLSSQKEDIDSLFLDVQEFILNYKVILSENQNSSMANSLQDSINKLKLKLNTMFRQIKKYLPFKKLEEVKGLSQKDMLETIDTLKSYQPDLSFAFESINKFEISLANVQAIPKSSIKALSIEEDLFSLKELFTNIFTEVELILNWLENLLSEFSARESDIQDIKFNLNXXXXXXXXXXXXXXXSDENLCRFSKKLSVLEKDLLEIEQSFKNFDKDFPLDFKEIKLFESLNLDCFDLAQKIFDLKTGFDVKLNLLSQTKTRLAEFFQISNKFNE 941
            K LLFNNFHELFN SFPSSAKALTAD+ENLSSQKEDIDSLF DVQEFILNYKVILSENQNSSMANSLQDSINKLKLKLNTMFRQIKKYLPFKKLEEVKGLSQKDMLETIDTLKS+QPDLSFAFESINKFEISLANVQAIPKSSIKALSIEEDLFSLKELFTNIFTEVELILNWLENLLSEFSARE+DIQDIKFNLNEFEIKFIEE KFI ISDENLCRFSKKLSVLEKDLLEIEQSFKNFDKDFPL+FKEIKLFESLNLDC DLAQKIFDLKTGFDVKLNLLSQTKTRLAEFFQISNKFNE
Sbjct: 2926 KHLLFNNFHELFNVSFPSSAKALTADMENLSSQKEDIDSLFHDVQEFILNYKVILSENQNSSMANSLQDSINKLKLKLNTMFRQIKKYLPFKKLEEVKGLSQKDMLETIDTLKSHQPDLSFAFESINKFEISLANVQAIPKSSIKALSIEEDLFSLKELFTNIFTEVELILNWLENLLSEFSARENDIQDIKFNLNEFEIKFIEETKFICISDENLCRFSKKLSVLEKDLLEIEQSFKNFDKDFPLNFKEIKLFESLNLDCIDLAQKIFDLKTGFDVKLNLLSQTKTRLAEFFQISNKFNE 3226          

HSP 2 Score: 32.7278 bits (73), Expect = 2.009e-154
Identity = 16/21 (76.19%), Postives = 16/21 (76.19%), Query Frame = 1
Query:    1 DEISSEFKILSQEKHYYLTTF 63
            DEISSEFKILSQEKH     F
Sbjct: 2913 DEISSEFKILSQEKHLLFNNF 2933          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Planmine SMEST
Match: SMESG000017520.1 (SMESG000017520.1)

HSP 1 Score: 535.798 bits (1379), Expect = 2.025e-154
Identity = 291/301 (96.68%), Postives = 295/301 (98.01%), Query Frame = 3
Query:   39 KALLFNNFHELFNESFPSSAKALTADIENLSSQKEDIDSLFLDVQEFILNYKVILSENQNSSMANSLQDSINKLKLKLNTMFRQIKKYLPFKKLEEVKGLSQKDMLETIDTLKSYQPDLSFAFESINKFEISLANVQAIPKSSIKALSIEEDLFSLKELFTNIFTEVELILNWLENLLSEFSARESDIQDIKFNLNXXXXXXXXXXXXXXXSDENLCRFSKKLSVLEKDLLEIEQSFKNFDKDFPLDFKEIKLFESLNLDCFDLAQKIFDLKTGFDVKLNLLSQTKTRLAEFFQISNKFNE 941
            K LLFNNFHELFN SFPSSAKALTAD+ENLSSQKEDIDSLF DVQEFILNYKVILSENQNSSMANSLQDSINKLKLKLNTMFRQIKKYLPFKKLEEVKGLSQKDMLETIDTLKS+QPDLSFAFESINKFEISLANVQAIPKSSIKALSIEEDLFSLKELFTNIFTEVELILNWLENLLSEFSARE+DIQDIKFNLNEFEIKFIEE KFI ISDENLCRFSKKLSVLEKDLLEIEQSFKNFDKDFPL+FKEIKLFESLNLDC DLAQKIFDLKTGFDVKLNLLSQTKTRLAEFFQISNKFNE
Sbjct: 2925 KHLLFNNFHELFNVSFPSSAKALTADMENLSSQKEDIDSLFHDVQEFILNYKVILSENQNSSMANSLQDSINKLKLKLNTMFRQIKKYLPFKKLEEVKGLSQKDMLETIDTLKSHQPDLSFAFESINKFEISLANVQAIPKSSIKALSIEEDLFSLKELFTNIFTEVELILNWLENLLSEFSARENDIQDIKFNLNEFEIKFIEETKFICISDENLCRFSKKLSVLEKDLLEIEQSFKNFDKDFPLNFKEIKLFESLNLDCIDLAQKIFDLKTGFDVKLNLLSQTKTRLAEFFQISNKFNE 3225          

HSP 2 Score: 32.7278 bits (73), Expect = 2.025e-154
Identity = 16/21 (76.19%), Postives = 16/21 (76.19%), Query Frame = 1
Query:    1 DEISSEFKILSQEKHYYLTTF 63
            DEISSEFKILSQEKH     F
Sbjct: 2912 DEISSEFKILSQEKHLLFNNF 2932          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 211.846 bits (538), Expect = 3.008e-54
Identity = 184/693 (26.55%), Postives = 323/693 (46.61%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIE---NFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLG-DLDTVEVLIDECHMTENEINNHKEDFKNLKL-RMLNEIKNYEESD-IRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSL-PKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL---------------------GSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIA 6113
            K+  R  ER R  +  Y+E K F D    L   +  +  ++E   +    P+K+ + + K K     L      +  T R G  L+DK  ++D +K  + E++  L+ KW  +    +  +  LN  L+ +GN  DAM  +  W+     K     K  G D++TV+ L++E  + E ++ +     + +    M   I++ E+S  I + + E+++ ++       ++ + L+E+   A EF    N L  +  K+E  L+  ++ P+ + E  +  +I  H    K +   +  + +F   G  IL + +P A   +   I    S+W+ + S SE R   L + L                     G+L  S +   EL Y + E   K Q                  N+H  FI +++        +I + K + P      P      R+E  + I        +K  + L  N ++N L++++ ++W + +  +  L +H+  L E E ++ F+F  W++ +++++     R+ D FRRQ +   G    +EF + II S F T +  ++ V +IF+K  +  I Y+ F+ +LRP+R +   K  N N+      IIHD ++K+++ CTC+  Y + + GD KY+FG   KL +VR L S VMVRIGGGW  + EFL K+DPCR A
Sbjct: 7491 KVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKK--IDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASES--RELSYALAEA--KFQ-----------------YNEHERFITDMTLKQKDHDEIITNSKKKTPPLI---PIFDRSKRMETNQGI--------SKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENE------IIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCREA 8143          
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 211.846 bits (538), Expect = 3.163e-54
Identity = 184/693 (26.55%), Postives = 323/693 (46.61%), Query Frame = 3
Query: 4119 KIQKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIE---NFKDQPTKVLDHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKTLRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPDLKLLG-DLDTVEVLIDECHMTENEINNHKEDFKNLKL-RMLNEIKNYEESD-IRNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAEKLLKIKSL-PKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILTNCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESL---------------------GSLRGSTALIEELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIKSLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTNTRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFLTYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVXXXXXXXXXXEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEKEVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTITEFLKKNDPCRIA 6113
            K+  R  ER R  +  Y+E K F D    L   +  +  ++E   +    P+K+ + + K K     L      +  T R G  L+DK  ++D +K  + E++  L+ KW  +    +  +  LN  L+ +GN  DAM  +  W+     K     K  G D++TV+ L++E  + E ++ +     + +    M   I++ E+S  I + + E+++ ++       ++ + L+E+   A EF    N L  +  K+E  L+  ++ P+ + E  +  +I  H    K +   +  + +F   G  IL + +P A   +   I    S+W+ + S SE R   L + L                     G+L  S +   EL Y + E   K Q                  N+H  FI +++        +I + K + P      P      R+E  + I        +K  + L  N ++N L++++ ++W + +  +  L +H+  L E E ++ F+F  W++ +++++     R+ D FRRQ +   G    +EF + II S F T +  ++ V +IF+K  +  I Y+ F+ +LRP+R +   K  N N+      IIHD ++K+++ CTC+  Y + + GD KY+FG   KL +VR L S VMVRIGGGW  + EFL K+DPCR A
Sbjct: 7479 KVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKK--IDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASES--RELSYALAEA--KFQ-----------------YNEHERFITDMTLKQKDHDEIITNSKKKTPPLI---PIFDRSKRMETNQGI--------SKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENE------IIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCREA 8131          
The following BLAST results are available for this feature:
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DST4.411e-7027.90dystonin [Source:HGNC Symbol;Acc:HGNC:1090][more]
DST9.167e-6826.43dystonin [Source:HGNC Symbol;Acc:HGNC:1090][more]
DST1.240e-6726.43dystonin [Source:HGNC Symbol;Acc:HGNC:1090][more]
DST1.375e-6727.66dystonin [Source:HGNC Symbol;Acc:HGNC:1090][more]
DST1.435e-6726.43dystonin [Source:HGNC Symbol;Acc:HGNC:1090][more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-102.823e-3919.79VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-103.341e-3919.71VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-103.440e-3919.71VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-103.557e-3919.71VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
vab-103.952e-3919.71VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shot4.862e-6622.83gene:FBgn0013733 transcript:FBtr0273222[more]
shot4.918e-6622.89gene:FBgn0013733 transcript:FBtr0304853[more]
shot4.918e-6622.89gene:FBgn0013733 transcript:FBtr0304847[more]
shot5.468e-6622.83gene:FBgn0013733 transcript:FBtr0273224[more]
shot1.144e-6522.83gene:FBgn0013733 transcript:FBtr0273225[more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DST6.725e-6525.58dystonin [Source:HGNC Symbol;Acc:HGNC:1090][more]
macf1a9.166e-6126.07microtubule actin crosslinking factor 1a [Source:Z... [more]
macf1a1.794e-6025.95microtubule actin crosslinking factor 1a [Source:Z... [more]
macf1b1.120e-2935.68microtubule actin crosslinking factor 1b [Source:Z... [more]
gas2l14.297e-1135.71growth arrest-specific 2 like 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11fip23.100e-7027.71RAB11 family interacting protein 2 (class I) [Sour... [more]
rab11fip24.799e-7027.71RAB11 family interacting protein 2 (class I) [Sour... [more]
rab11fip26.063e-7027.71RAB11 family interacting protein 2 (class I) [Sour... [more]
rab11fip29.579e-7027.71RAB11 family interacting protein 2 (class I) [Sour... [more]
rab11fip23.035e-6927.75RAB11 family interacting protein 2 (class I) [Sour... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dst1.273e-7127.81dystonin [Source:MGI Symbol;Acc:MGI:104627][more]
Dst3.953e-7128.09dystonin [Source:MGI Symbol;Acc:MGI:104627][more]
Dst5.790e-7128.09dystonin [Source:MGI Symbol;Acc:MGI:104627][more]
Dst9.757e-7128.09dystonin [Source:MGI Symbol;Acc:MGI:104627][more]
Dst9.864e-7127.81dystonin [Source:MGI Symbol;Acc:MGI:104627][more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91ZU6|DYST_MOUSE4.050e-7028.09Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2[more]
sp|D3ZHV2|MACF1_RAT1.241e-6727.69Microtubule-actin cross-linking factor 1 OS=Rattus... [more]
sp|Q03001|DYST_HUMAN1.426e-6627.66Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4[more]
sp|Q9UPN3|MACF1_HUMAN1.153e-6527.08Microtubule-actin cross-linking factor 1, isoforms... [more]
sp|Q9QXZ0|MACF1_MOUSE9.466e-6327.10Microtubule-actin cross-linking factor 1 OS=Mus mu... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KRX11.486e-10326.51Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210QRC31.656e-10131.07Dystonin OS=Mizuhopecten yessoensis OX=6573 GN=KP7... [more]
A0A0L8H1847.988e-9326.76Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8H2732.461e-9126.78Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8H0R39.646e-9026.35Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DST1.506e-6227.02dystonin [Source:HGNC Symbol;Acc:HGNC:1090][more]
MACF11.998e-6226.47microtubule actin crosslinking factor 1 [Source:HG... [more]
MACF13.780e-6226.17microtubule actin crosslinking factor 1 [Source:HG... [more]
macf1b3.231e-2837.22microtubule actin crosslinking factor 1b [Source:Z... [more]
ENSAMXT00000038065.12.147e-1137.50pep primary_assembly:Astyanax_mexicanus-2.0:3:1167... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MACF12.540e-6225.03microtubule actin crosslinking factor 1 [Source:HG... [more]
ENSPMAT00000006484.11.792e-2430.99pep scaffold:Pmarinus_7.0:GL476558:220668:227717:-... [more]
ENSPMAT00000006481.12.104e-2225.34pep scaffold:Pmarinus_7.0:GL476558:220668:230205:-... [more]
GAS2L11.087e-1041.89growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
GAS2L11.112e-1041.89growth arrest specific 2 like 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO377063.529e-5525.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278042.605e-1449.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330926.803e-1349.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299081.556e-619.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046669.19.658e-4524.47pep primary_assembly:ASM223467v1:15:24337939:24343... [more]
macf1b1.690e-2835.83microtubule actin crosslinking factor 1b [Source:Z... [more]
ENSORLT00000034832.14.086e-2337.72pep primary_assembly:ASM223467v1:11:16837571:16849... [more]
gas2l18.683e-1136.25growth arrest specific 2 like 1 [Source:NCBI gene;... [more]
gas2b2.290e-1042.86growth arrest-specific protein 2-like [Source:NCBI... [more]
back to top
BLAST of Microtubule-actin cross-linking factor 1-like isoform X28 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017519.10.000e+098.96SMESG000017519.1[more]
SMESG000017520.12.009e-15496.68SMESG000017520.1[more]
SMESG000017520.12.025e-15496.68SMESG000017520.1[more]
SMESG000043809.13.008e-5426.55SMESG000043809.1[more]
SMESG000043809.13.163e-5426.55SMESG000043809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000639 ID=SMED30000639|Name=Microtubule-actin cross-linking factor 1-like isoform X28|organism=Schmidtea mediterranea sexual|type=transcript|length=6631bp
GATGAAATTTCCTCTGAATTTAAAATATTATCACAAGAAAAGCATTATTA
TTTAACAACTTTCATGAATTATTCAATGAATCCTTTCCATCATCTGCTAA
AGCCTTGACAGCTGATATTGAAAATCTTTCTTCTCAGAAAGAAGATATCG
ATTCTCTATTCCTTGATGTGCAAGAATTTATTTTAAATTACAAAGTAATA
TTATCGGAAAATCAGAATTCTTCTATGGCTAATTCTCTACAAGATTCCAT
AAACAAATTGAAATTAAAATTGAATACAATGTTTCGTCAGATTAAAAAGT
ATTTGCCTTTCAAAAAATTGGAAGAAGTGAAAGGACTCTCGCAAAAAGAC
ATGTTAGAAACAATTGATACACTGAAATCATATCAACCAGATTTGTCATT
CGCCTTTGAATCCATTAATAAATTTGAGATCTCTTTGGCCAATGTTCAAG
CCATTCCCAAGTCATCTATCAAAGCTTTGTCCATCGAAGAGGATCTCTTT
TCATTAAAAGAATTGTTTACAAATATTTTTACGGAAGTCGAGTTAATTTT
AAATTGGTTGGAAAATCTTTTGAGTGAATTTTCAGCCAGGGAGAGCGATA
TCCAGGATATCAAATTCAACTTGAATGAGTTTGAAATCAAGTTTATTGAA
GAAATGAAATTCATTTCTATTAGTGATGAAAATCTGTGTAGATTTTCAAA
GAAATTATCAGTCCTTGAAAAAGATTTGTTAGAAATTGAGCAGTCTTTCA
AAAACTTTGATAAAGATTTTCCTTTGGATTTCAAAGAAATTAAATTATTT
GAATCATTGAATCTGGACTGTTTTGATTTAGCACAAAAGATCTTTGATTT
AAAAACCGGTTTTGATGTTAAATTAAATTTACTATCTCAGACGAAAACAA
GACTGGCAGAATTCTTTCAGATTTCAAATAAATTTAATGAAGCTTTAGAT
AAATTGACTCATGAACTAGGTCTTATTAAATCTAACAACAAAACTGACAA
ATCACTTCAAGATATCATTAATTTACGAAAGGAATTCATTGGAACTTTGG
ATGAATTTGAACGAATAAAAATCTCATGCGAGAGTTATATAAACAATTCT
TTCTTTCAAGATAAAGAGGATATTATCAATCTGTATAATAATACGAAAAC
TAAACAAAAAGATTTGTACTTGAGAATAAACGAGGAGTTGGTTTTTCAGG
TGGAATCAAAAATAAGTCTACTACTTATCGAATTGGGAAAATTGCAAATA
TTTGTCATGGATTTGCCAAAAAATTGGGACACAAATGTTTCAGACATCAA
AAATCGCATTGATGAAATAAAAATATATTTAGATAATTTACACATAATGG
AAAAAGATCTTCAAGGTATAGACAAAGCGTTATCGGAGGATTTGAGTGAC
CAGTTGGAAATCAACTTTGAACTTCTGGAAAAGGCAATAACGAATATTCA
GTACTGTGAAAAAGAGAGATTGCTAACGTATACGGACTTAGATAAAATCT
ACAATATTATATTGAACAATTATTTGCCAACAATTATTACTTATGAAAAT
AATAAGCAACTTGCAGAGAGTATCATTACGGAAACGAATATAAGCTTAGA
GGAGTTCATAAAGGATTTCAATAATTACACTACTTACACTAACGACAACG
AAACCCCGTTTGTAATTGACGCAATCAAATATCGAAAATCAAATTTACAA
AAATTGGAAAATATTCTATATGAAATTGAGCCGTTGGTTGAGGCGGTCGA
ATCATACGGTTTTGATTTAATTGAACAACTGATCGAATTGACTTCCGATT
ACGGATCTGACTGTTCGTTTCTCCAATCCATCAAAGATGACCTTCAAGAA
ATTCGCAATAAATTCAGAACACTAAAAAATCAAATCGCAGATCTTGATTC
CAAAATCATAGAATTGTTATCACCGAATTCAAAATCCCACATTTTAGAGA
AATTAACCAGTGAATATGAAATTTGGCATTCTTTAAATGATGTTTTGATA
AAACTTGATCCGGTGCAATCTTTCCCCGAAAAATTTAACAAACAATTTGA
AGAGGTATCTTTCCTCTATGATCAAGTGAAAAAGAAAGAAATTGCTTTTC
ATCCACTTAAACAAGCAATTAATAAATTGTTGTTGGATGACAATATGAGT
TGTACACAAGATGACATCAAAGAACAATTTGACGGTGTAGGCATAGATAA
CGAGGCTGTTCTATCAAACGATGCCGATGATTTGAAAGACCACTTGAAAG
AAGTCGAATGTCTAATCGAATCTGTATTCTACAAAGTTGATAATCGAATG
TCGATTCTCAATGAATTAAAAGATTTAGTTAATTTGTATTGGTCTGAAAT
TTCTGAAATATTTTCCAGCATAAAGCATATTCAAAAAAATGCAATGTCAA
TAGAAGCTTTTCCTTATAATAAAGATGATAAAAATAAAATTCTTGAACCT
CAAATCGCTCACTCAGATTCAATAAGCACTCTTACAGATGCTGATAATAA
ATCCACAACTAGCAGTGTAGGTTTTGAATTGGATGAAAAATTTGATGAAG
ATTCTAAATTGGAATTACCGAATTTAACCGAATCTAAATTTCCGGAAGAA
ATAATAAGTCAGGATCTTGTAAAACAACAATATTCTTCTCTCAAAAAAAT
GGGAAAAGATGTCACTCAATTTGTCGAAAAATTGGAAACTGATTTGGTTC
CTAAAGCTAACCAAATTGTGAAAATTGGTGGTCAATTTTGTGAGCTAGAA
ATCAGTGAATTTACAGAGTCTCTTTTGGAAGAAATAGGAATCACCGAGGA
CGCAATAGAGGAAAAGGATATATTATTTAACAAAGCTTTATATTTCGTAG
ACTTTCTATCAGATGAAATTAAAAAAGTATTCGAATGGTTTGAAGTCATG
GAAAATCGTCTTATTAATTTTGGAGAAATAACTCCTGATCAAAAGCTCAT
TGAAATCAATCTATTGGAATTAAAATCTTTAAATACTGAAATTTTCTCTA
AAGCTCAACAGTTGGACAAAATAGGTTCTGCAATTAGTGAAATTTTAAGT
TATCCATATGTTCCAAATAAAAACACGTTAGAAGAAATGAAATTAAATAT
TAAAGAAAAATATTCAGAACTTGTTAAAGGAATCATAGAAAAACATAATG
ACCTTCAAAAGAAATACAGTGATATCGGTGAATTGGATTTTTCTTTGGAT
GATAACATTGGCATCCTTCAAGAATTTGAAAATCAAATAAAAAACTTGAC
GCCACAATCATGTAAAGGAGATCCAGAATATACATTTTCATGTTTTAAAA
ATTTAAAATTTTTGGATGATGAGTTCAATGGATTGCAGTCTGATTTTCAA
AATCTTTGCGAAAGAATATCAGCTCATGGAGACATTGAAGATAATACAAA
TTTGCGATGTAGAGGAACTCTCTCGATTTTCGGGAAATTAAAGGAAATGA
AAATTTTGACTGAACAAATTAGGGTTCTAATTCCCGAAAAATATGTTATG
ATTCAAGAAATTTTGAAAAATGAGAAATTGCTCTCTAAAGAAATCCATTT
GCACATTGACTATTTAGAGAAGCTAAATAATTACTTGAAATTGCCACCGA
AATTGGGATTCAGTCAAGAATCTGTTGAACAATCGAATTTGATTTTTTCA
AATTATATCGGCGATTTAAATAAACAACGAAATTCGATTGAGAATTCGTT
AAAATTGGCAAGCAGCCATATTGAAAGCTGTCAATATGATAAATGTACAT
TTCTCAGTACAGCTATCAAAACCTTATTCCATAAATATAAACGTTGTCAA
CACCTGGCAGCAAAGCGCAAGGAAAAACTGAGCATTTATTCCAAGTTAAT
ATTGGAGTATGATGCAGACAAACAGACGTTGCAAAAAGACATATTGGAGC
TGGAGAACTTGTCCATTAAACGAATGAATCCAAGCAAAATCACGGTAACT
TGTGCTGAGCAAATCAAATCTATAAAAATTAGTATTCAAACTGCTGATAA
AAACTTTGATATTTATGAACATTTAACCATTCGATCGTTTGATATCAAAT
GTTTCGGAAATAGAATTGACAATTCTCAGTTAATTTTAGAACTTAAAGAA
TACGGATTAAAGTTGGCTAAAATACAAAAACGGCTGCGTGAAAGAATCAG
AATTTTTAATCAGGCTTATCGTGAAGATAAATTGTTTAGTGATTCTTATG
CAAATTTAAATGCCTGGCTTGATGAAAGCTATGTTATGATCGAGAATTTC
AAGGATCAACCTACCAAAGTTTTGGATCATTTGGATAAATTGAAAAATTT
GTGCAAGCAGTTAAGTTGTCAATATGCCAATTTTCATTGCACCTTACGGT
ACGGCAGTTATTTGAAAGATAAATGTACAGTTGAAGACCCTGAAAAATAT
ATTTTACTAGAAATGCTTAAAACTTTGCGTGCAAAATGGAATAAAATCAG
AATTTCAATAGTTACTGAGAAATCTACGTTAAATCGTAAACTGATCAAGA
CGGGCAATATTTATGACGCAATGAAATGCGTCAATTACTGGATAAACGAT
TCCATAGCAAAATTCGTTCCTGACTTGAAATTACTTGGTGATTTAGATAC
TGTTGAAGTTTTGATTGACGAGTGCCATATGACAGAAAATGAAATAAATA
ATCACAAGGAAGATTTCAAAAATTTAAAATTAAGAATGTTGAACGAAATA
AAGAATTACGAAGAAAGCGATATCAGAAATACTATAGAGGAAATTGAAAA
CCAATTTTCTCTTTTTGTCAATAATGTTCAACAACGTTCCAAATCTTTGC
AGGAGTCTCTTCAATTGGCCAAAGAATTTAATTCAAAGCTTAATGAGCTT
GATGTATGGCTTAGAAAAGCAGAGAAATTGTTAAAAATTAAAAGTCTTCC
GAAATTTCAAAACGAAGCAGACTTAGTAGAATTAATAGAAAAACATGAAT
TTTTGGTGAAACAAGTGAAAGAAATGAAAACAACAATGACCAACTTCAAT
AACATTGGGAAAGTTATTCTCACCAATTGCCACCCTATGGCCACTAACTA
TGTTAATAGGTTAATTTTCAAAACCGGAAGTCGATGGAATCAAATAAACT
CGAGAAGTGAAGATCGCAGTAAAAAATTAAACGAATCTCTAGGATCTTTG
AGAGGTAGCACTGCTTTAATAGAAGAATTGATTTACAAAGTCGGAGAATG
CTTGAATAAAATTCAAAATGAGATTCGTATAGAAATTCCCTGTGATATGC
AAAATGTGAATGATATTATCAATAAGCACTTGATATTTATAAATGAACTT
TCTGAAATTGATAGTCAAATCAAAAGTTTAATTAAAGATTTCAAATTACA
AAATCCTTCATCGTTTCATAAAGCTCCAACAAAAAGATACCACGACAGAG
TGGAGTTTTACAAAAACATCTGGAGGAATTCCAAAGATAGTTTAAATAAA
AGTACGGATGATCTTTCAACCAACACTCGTCTTAACTTTCTAAATACTCA
ATTCAATAAGCTTTGGAAGTTATCTATAGAACACAAAGTAGCGTTGCAAA
ACCATTTAATGGATCTAAATGAAAAAGAACAATTGCGAAGATTTGACTTT
AATACGTGGAAAAAAGATTTTCTTACTTATATTAAAGTCAAGGGATTGAG
ATTGACAGATTTGTTTCGACGGCAACAATCTCGACGACCAGGATATCATG
TTTTGGAAGAATTTACGAACTGTATCATTAAATCTGGATTCCCCACAAAC
AAGTATCTATTACAACAAGTCTTCAATATATTTAATAAAAATAACAACAA
CGAAATTCCATATCAAGATTTTATAGATTCACTGAGACCCGAGAGACGAT
CACAAGTTGATAAAAACATCAATCTTAATGATAAAAAAGTTGTTACGCTA
ATTATTCATGATATTATTGAAAAAGAAGTTGCTGTGTGCACTTGCACTTT
GCGGTATTATGTAAAAAGAGAAGGTGATAATAAATATCGATTTGGTCAGA
ATAGCAAATTGTACATGGTTAGGTATCTCAATTCCACTGTTATGGTGAGA
ATTGGCGGTGGCTGGCAGACTATTACCGAATTTTTAAAGAAAAATGATCC
ATGTAGAATTGCCAATTCATTGGATCTTCAAAAATCAAAATCTATGAAAA
TGTCTTTTTCTACTGTTACAAAAGTAGTCAAAACTTTGAAGAAAACTGAT
GAGAAACCGACAGTGAAAAAGTCAATTCAATATCAAAAAGCGTCTTCGCT
ATCAAGCAGAATACCTACTGGACTTTCAAAGAAATGATGTTTCTGCTGAA
ATATTTTTTACCAAACTATTCTAATCTAAATGCGTTTTGTTTAATGACAG
ATTTTGTTACATTTATCATTGAATAAATTTTTAAATCCTAAAAAACATAT
CAAATTATTCAAGATCTTCGATTAACTTTCTGACCTAACTAATTCTAACT
AATTATCTAGTAAGTTAATAATAATGAAAGTAATATTAATAAATTTCAAT
TGAAATATAACAATATTTTTTTTAAAAAATTAAATTCAATATTTAGAAAT
ACTACTAGAAATATTATTTAATAAAGAAATTAATAATGAAGAATTAAAAT
ATTGTTTAAATAACTTGTTAACAAATTCTTC
back to top

protein sequence of SMED30000639-orf-1

>SMED30000639-orf-1 ID=SMED30000639-orf-1|Name=SMED30000639-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2021bp
MANSLQDSINKLKLKLNTMFRQIKKYLPFKKLEEVKGLSQKDMLETIDTL
KSYQPDLSFAFESINKFEISLANVQAIPKSSIKALSIEEDLFSLKELFTN
IFTEVELILNWLENLLSEFSARESDIQDIKFNLNEFEIKFIEEMKFISIS
DENLCRFSKKLSVLEKDLLEIEQSFKNFDKDFPLDFKEIKLFESLNLDCF
DLAQKIFDLKTGFDVKLNLLSQTKTRLAEFFQISNKFNEALDKLTHELGL
IKSNNKTDKSLQDIINLRKEFIGTLDEFERIKISCESYINNSFFQDKEDI
INLYNNTKTKQKDLYLRINEELVFQVESKISLLLIELGKLQIFVMDLPKN
WDTNVSDIKNRIDEIKIYLDNLHIMEKDLQGIDKALSEDLSDQLEINFEL
LEKAITNIQYCEKERLLTYTDLDKIYNIILNNYLPTIITYENNKQLAESI
ITETNISLEEFIKDFNNYTTYTNDNETPFVIDAIKYRKSNLQKLENILYE
IEPLVEAVESYGFDLIEQLIELTSDYGSDCSFLQSIKDDLQEIRNKFRTL
KNQIADLDSKIIELLSPNSKSHILEKLTSEYEIWHSLNDVLIKLDPVQSF
PEKFNKQFEEVSFLYDQVKKKEIAFHPLKQAINKLLLDDNMSCTQDDIKE
QFDGVGIDNEAVLSNDADDLKDHLKEVECLIESVFYKVDNRMSILNELKD
LVNLYWSEISEIFSSIKHIQKNAMSIEAFPYNKDDKNKILEPQIAHSDSI
STLTDADNKSTTSSVGFELDEKFDEDSKLELPNLTESKFPEEIISQDLVK
QQYSSLKKMGKDVTQFVEKLETDLVPKANQIVKIGGQFCELEISEFTESL
LEEIGITEDAIEEKDILFNKALYFVDFLSDEIKKVFEWFEVMENRLINFG
EITPDQKLIEINLLELKSLNTEIFSKAQQLDKIGSAISEILSYPYVPNKN
TLEEMKLNIKEKYSELVKGIIEKHNDLQKKYSDIGELDFSLDDNIGILQE
FENQIKNLTPQSCKGDPEYTFSCFKNLKFLDDEFNGLQSDFQNLCERISA
HGDIEDNTNLRCRGTLSIFGKLKEMKILTEQIRVLIPEKYVMIQEILKNE
KLLSKEIHLHIDYLEKLNNYLKLPPKLGFSQESVEQSNLIFSNYIGDLNK
QRNSIENSLKLASSHIESCQYDKCTFLSTAIKTLFHKYKRCQHLAAKRKE
KLSIYSKLILEYDADKQTLQKDILELENLSIKRMNPSKITVTCAEQIKSI
KISIQTADKNFDIYEHLTIRSFDIKCFGNRIDNSQLILELKEYGLKLAKI
QKRLRERIRIFNQAYREDKLFSDSYANLNAWLDESYVMIENFKDQPTKVL
DHLDKLKNLCKQLSCQYANFHCTLRYGSYLKDKCTVEDPEKYILLEMLKT
LRAKWNKIRISIVTEKSTLNRKLIKTGNIYDAMKCVNYWINDSIAKFVPD
LKLLGDLDTVEVLIDECHMTENEINNHKEDFKNLKLRMLNEIKNYEESDI
RNTIEEIENQFSLFVNNVQQRSKSLQESLQLAKEFNSKLNELDVWLRKAE
KLLKIKSLPKFQNEADLVELIEKHEFLVKQVKEMKTTMTNFNNIGKVILT
NCHPMATNYVNRLIFKTGSRWNQINSRSEDRSKKLNESLGSLRGSTALIE
ELIYKVGECLNKIQNEIRIEIPCDMQNVNDIINKHLIFINELSEIDSQIK
SLIKDFKLQNPSSFHKAPTKRYHDRVEFYKNIWRNSKDSLNKSTDDLSTN
TRLNFLNTQFNKLWKLSIEHKVALQNHLMDLNEKEQLRRFDFNTWKKDFL
TYIKVKGLRLTDLFRRQQSRRPGYHVLEEFTNCIIKSGFPTNKYLLQQVF
NIFNKNNNNEIPYQDFIDSLRPERRSQVDKNINLNDKKVVTLIIHDIIEK
EVAVCTCTLRYYVKREGDNKYRFGQNSKLYMVRYLNSTVMVRIGGGWQTI
TEFLKKNDPCRIANSLDLQKSKSMKMSFSTVTKVVKTLKKTDEKPTVKKS
IQYQKASSLSSRIPTGLSKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0045104intermediate filament cytoskeleton organization
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0008092cytoskeletal protein binding
GO:0005515protein binding
GO:0008017microtubule binding
GO:0003779actin binding
GO:0005509calcium ion binding
GO:0016887ATPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036534GAR_dom_sf
IPR043197Plakin
IPR029926Dystonin-like
IPR018159Spectrin/alpha-actinin
IPR003108GAR_dom
IPR011992EF-hand-dom_pair
IPR002017Spectrin_repeat
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1116..1154
NoneNo IPR availableCOILSCoilCoilcoord: 189..216
NoneNo IPR availableCOILSCoilCoilcoord: 865..885
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 1084..1372
e-value: 1.7E-19
score: 72.2
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1423..1544
e-value: 3.9E-5
score: 25.2
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 975..1083
e-value: 2.5E-5
score: 26.4
NoneNo IPR availableCDDcd00176SPECcoord: 1095..1295
e-value: 4.84127E-18
score: 82.4935
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1147..1292
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 498..634
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 962..1065
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1037..1141
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1275..1431
IPR003108GAR domainSMARTSM00243GAS2coord: 1550..1620
e-value: 1.9E-29
score: 113.8
IPR003108GAR domainPFAMPF02187GAS2coord: 1550..1617
e-value: 6.4E-26
score: 90.2
IPR003108GAR domainPROSITEPS51460GARcoord: 1541..1617
score: 27.052
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 1306..1431
e-value: 3.4
score: 4.6
coord: 1189..1292
e-value: 1.1E-6
score: 38.2
coord: 532..634
e-value: 3.0
score: 5.0
coord: 1083..1182
e-value: 2.5E-4
score: 30.4
IPR002017Spectrin repeatPFAMPF00435Spectrincoord: 1187..1293
e-value: 7.1E-8
score: 32.9
coord: 1091..1183
e-value: 3.1E-5
score: 24.4
IPR036534GAR domain superfamilyGENE3DG3DSA:3.30.920.20coord: 1545..1636
e-value: 7.0E-24
score: 85.5
IPR036534GAR domain superfamilySUPERFAMILYSSF143575GAS2 domain-likecoord: 1552..1624
IPR043197PlakinPANTHERPTHR23169ENVOPLAKINcoord: 812..1618
IPR029926Dystonin-likePANTHERPTHR23169:SF24DYSTONINcoord: 812..1618
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 1434..1526