Neuronal acetylcholine receptor subunit alpha-4

Overview
NameNeuronal acetylcholine receptor subunit alpha-4
Smed IDSMED30000621
Length (bp)1635
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha-4 (SMED30000621) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-4 (SMED30000621) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-4 (SMED30000621) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-4 (SMED30000621) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000621

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30000621h1SMcG0002038 dd_Smed_v4_2019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000621h1SMcG0002038 dd_Smed_v4_2019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000621h1SMcG0002038 dd_Smed_v4_2019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA10 (cholinergic receptor nicotinic alpha 10 subunit [Source:HGNC Symbol;Acc:HGNC:13800])

HSP 1 Score: 166.777 bits (421), Expect = 3.426e-45
Identity = 114/428 (26.64%), Postives = 205/428 (47.90%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI-PLPVCFQKFLYSSAAQFFC---------------FSFTKQHKQ---------FTDYQVLFKNST--NATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYIL 1452
            L   +F  Y     P+   ++ L++ +++ L Q+ D+DE  Q LTL +WI   W D  + WDP  Y  +  I  P+  +W PD+ +Y                + V + +DG ++  A  + ++ CRV++A FPFD+Q C +TF +W        + ++P+    S   FV   N EW V  + A   +  +   +     E + +VTFTL L+R+       L+ PC+L+  +A + F LP  SGEKV L  T+LL+L VF L++++ +P  ++S+PLI K++ + + +V+     T++++NL +    + P+P   +  L    A+  C                S + Q  +           + + L +     +    I+ T+      Q  ++ W +L +++DR FL I+  +   +SL +L
Sbjct:   33 LFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSA----STNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHG--GHQLDVRPRGAAASLADFVE--NVEWRVLGMPARRRVLTYGCCS-----EPYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMP-PAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQSRPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWKRLARVMDRFFLAIFFSMALVMSLLVL 446          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNB3 (cholinergic receptor nicotinic beta 3 subunit [Source:HGNC Symbol;Acc:HGNC:1963])

HSP 1 Score: 158.688 bits (400), Expect = 3.550e-42
Identity = 114/433 (26.33%), Postives = 203/433 (46.88%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFS-----------------------FTKQHKQFTDYQ----VLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            + LL H+F+GY     P+   N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P +Y  I  I  P+  +W PD+ +++   G +E  +     +KV +  +G +        K+ C +++  FPFD Q C + F +W  D  + ++ +    + D    F    NGEW +   + +  +K    G     + ++  +T++  L+R P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    ++       +  C                           K+ KQ +D +       + + ++   IS             + W  + Q+LDR+FL ++LI+    S+ I T
Sbjct:   30 DALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLM----TKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILI-NENVDRKDFF---DNGEWEI---LNAKGMK----GNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIVSVTGSVLIFT 447          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 159.458 bits (402), Expect = 6.200e-42
Identity = 100/318 (31.45%), Postives = 170/318 (53.46%), Query Frame = 1
Query:  214 GPKRTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSH 1167
            GP          L   + + YNPL  P+   ++PL +   + L Q+ D+DE  Q LT ++W+ ++W D  + W+  EY  +K +  P   IW PD+ +Y      ++        + V +N  G  Q     + K+ C +++  FPFD Q C + F +W+      ++ M  +  + SG+      NGEW++  +    S + +     E   E + +VTFT+ ++R+  +    L+ PC+L+  +A + F+LP  SGEK+ L  T+LLSL VF+L++++ +P TSDS+PLIA++F S + +V L ++ TVIVL   H
Sbjct:   46 GPVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATF----HTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM--QEADISGY----IPNGEWDLVGIPGKRSERFY-----ECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHH 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 158.688 bits (400), Expect = 6.758e-42
Identity = 98/306 (32.03%), Postives = 168/306 (54.90%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSH 1167
            L   + + YNPL  P+   ++PL +   + L Q+ D+DE  Q LT ++W+ ++W D  + W+  EY  +K +  P   IW PD+ +Y      ++        + V +N  G  Q     + K+ C +++  FPFD Q C + F +W+      ++ M  +  + SG+      NGEW++  +    S + +     E   E + +VTFT+ ++R+  +    L+ PC+L+  +A + F+LP  SGEK+ L  T+LLSL VF+L++++ +P TSDS+PLIA++F S + +V L ++ TVIVL   H
Sbjct:   29 LYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATF----HTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM--QEADISGY----IPNGEWDLVGIPGKRSERFY-----ECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHH 319          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 158.688 bits (400), Expect = 6.758e-42
Identity = 98/306 (32.03%), Postives = 168/306 (54.90%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSH 1167
            L   + + YNPL  P+   ++PL +   + L Q+ D+DE  Q LT ++W+ ++W D  + W+  EY  +K +  P   IW PD+ +Y      ++        + V +N  G  Q     + K+ C +++  FPFD Q C + F +W+      ++ M  +  + SG+      NGEW++  +    S + +     E   E + +VTFT+ ++R+  +    L+ PC+L+  +A + F+LP  SGEK+ L  T+LLSL VF+L++++ +P TSDS+PLIA++F S + +V L ++ TVIVL   H
Sbjct:   29 LYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATF----HTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM--QEADISGY----IPNGEWDLVGIPGKRSERFY-----ECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHH 319          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-9 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q18556])

HSP 1 Score: 159.458 bits (402), Expect = 2.699e-42
Identity = 105/317 (33.12%), Postives = 165/317 (52.05%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAP--AHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNK-----DLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            LL  +   Y+P   P+   ++PL + + ++L Q+ D+DE  Q +TL  WI+  W D  + WDP EY  IK I  P  A+ IW PD+ +Y     N++    V       ++Y G +      +LK  C+++I  FPFD Q+C + F +W       DLR+     K   DE     +    NGEWN+  + A      F    DE   + +  + F L ++R+  +    L+ P  L+  +  + F LP  +GEK+ L  TILLS+  FL +++D  P TS+++PLI  FF  C+ +VS  ++FTV+VLNL +R  +
Sbjct:   31 LLADLRHNYDPYERPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWIEYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPV----NYVVSYTGDVLQVPPGILKLSCKIDITYFPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDEGIDVQYY-VQNGEWNLLAVPARHETNIF----DE---QPYPSLFFYLIIQRRTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASVVFTVLVLNLHNRKPE 335          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 158.688 bits (400), Expect = 5.948e-42
Identity = 103/325 (31.69%), Postives = 176/325 (54.15%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKD---LRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGL-VSLGMIFTVIVLNLSHRSSQIPLPVCFQKFL 1212
            L   + E YN LA P+   ++ + +++ M   Q+ D+DE  Q +  +VW+ ++W D  ++WDP E+ NIK++  P ++IW PD+ +Y  +   ++    V       + Y G +      ++++ C ++IA FPFD+Q C + F +W        + N T+ P              NGEW +  L +  SI  +     E   E + +VTFT+ ++R+  +    L+ PC+L+  +A ++F LP   GEK+ L  TI +SL VF++++++ +P TSD++PLI + +FSCI   V   ++ TVI LN  HRS +   P+   KFL
Sbjct:   28 LYAKLAENYNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPV----NAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDLINTTISPA---------TYKPNGEWELLGLTSQRSIFFY-----ECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLI-QIYFSCIMFQVGASVVATVIALNFHHRSPEQYKPM--NKFL 331          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 158.303 bits (399), Expect = 8.819e-42
Identity = 103/325 (31.69%), Postives = 176/325 (54.15%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKD---LRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGL-VSLGMIFTVIVLNLSHRSSQIPLPVCFQKFL 1212
            L   + E YN LA P+   ++ + +++ M   Q+ D+DE  Q +  +VW+ ++W D  ++WDP E+ NIK++  P ++IW PD+ +Y  +   ++    V       + Y G +      ++++ C ++IA FPFD+Q C + F +W        + N T+ P              NGEW +  L +  SI  +     E   E + +VTFT+ ++R+  +    L+ PC+L+  +A ++F LP   GEK+ L  TI +SL VF++++++ +P TSD++PLI + +FSCI   V   ++ TVI LN  HRS +   P+   KFL
Sbjct:   34 LYAKLAENYNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPV----NAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDLINTTISPA---------TYKPNGEWELLGLTSQRSIFFY-----ECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLI-QIYFSCIMFQVGASVVATVIALNFHHRSPEQYKPM--NKFL 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 153.68 bits (387), Expect = 8.691e-41
Identity = 96/314 (30.57%), Postives = 167/314 (53.18%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHD--IWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSS---NGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSS 1176
            L   + +GYNPL  P+   ++PL + I ++L Q+ D+DE  Q ++++ W+   W D  + W+PK+Y  I+ I  P     IW PD+ +Y     +++       +S +   + G +      +LK  C++++  FPFD QVC + F +W      + + ++   D +   S   S+   NGEW V    A   +  +         E +  V + LH++R+  +    L+ P LL+  +A + F+ P  +GEK+ L  TILL++  FL ++S+  P TS+++PLI  FF  C+ +VS  ++FT++VLNL  RS+
Sbjct:   29 LFTDLLKGYNPLERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLYNSAAEDFDSTF----KSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWT--FHGYAIDLQIDDDTNGTQSMDLSTYLVNGEWQVISTNAKRVVSYYKCCP-----EPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSA 331          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 150.214 bits (378), Expect = 2.389e-39
Identity = 92/310 (29.68%), Postives = 162/310 (52.26%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            L + +   YN L  P+   ++P+ + + + L Q+ D+DE  Q + ++ W+D  W D ++ WD  EY NI  +  PA  IW PD+ +Y  +  N++       ++ + +   G++      + K  C+++I  FPFD Q C   F +W  D   + + ++P         ++  SNGEW +       + K +         E + +V F LH++R+  +    L+ PC+L   +  + F LP  +GEK+ L  T+LLS+  FL I+S+  P TS+++PL+  FF  C+ +V+   +FTV VLNL +R+ +
Sbjct:   26 LYEDLMRNYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTY----QTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYD--GYKLDLQPATGGFDISEYI--SNGEWALPLTTVERNEKFYDCCP-----EPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPE 322          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0332872)

HSP 1 Score: 156.762 bits (395), Expect = 1.593e-41
Identity = 100/318 (31.45%), Postives = 169/318 (53.14%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSS--------NGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            L D +   YN L  P+      L + I + L QL D++   Q +T ++W++ +W D  + W+PKEY  +  +  P+  IW PD+ +Y    GN+E    V   +K  I  +G+++     + K+ C +++  FPFD Q C + F +W  D   F + ++   DE  G + V           + EW++ ++ A  + K F+   DE  L    ++TF + ++RK  F    ++ PC+ + ++  +TF LP  SGEKV L  +IL+SL VF L++ + +P TS  +PL+ K+    + LVS+ +  TV+VLN+  RS Q
Sbjct:   15 LYDDLLSNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFE----VTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYD--GFKVDLR-HMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEK-FYTCCDEPYL----DITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQ 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0300118)

HSP 1 Score: 157.147 bits (396), Expect = 2.377e-41
Identity = 100/318 (31.45%), Postives = 169/318 (53.14%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSS--------NGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            L D +   YN L  P+      L + I + L QL D++   Q +T ++W++ +W D  + W+PKEY  +  +  P+  IW PD+ +Y    GN+E    V   +K  I  +G+++     + K+ C +++  FPFD Q C + F +W  D   F + ++   DE  G + V           + EW++ ++ A  + K F+   DE  L    ++TF + ++RK  F    ++ PC+ + ++  +TF LP  SGEKV L  +IL+SL VF L++ + +P TS  +PL+ K+    + LVS+ +  TV+VLN+  RS Q
Sbjct:   15 LYDDLLSNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFE----VTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYD--GFKVDLR-HMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEK-FYTCCDEPYL----DITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQ 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha3 (gene:FBgn0015519 transcript:FBtr0339652)

HSP 1 Score: 154.836 bits (390), Expect = 9.946e-40
Identity = 101/318 (31.76%), Postives = 170/318 (53.46%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNS--------SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            L D +   YN L  P+      L + I + L QL D++   Q +T ++W++ +W D  + W+PKEY  ++ +  P+  IW PD+ +Y    GN+E    V   +K  +NY G ++     + K+ C +++  FPFD Q C + F +W  D   F + ++   DE +G + V          ++ EW++ ++ A  + K F+   DE  L    ++TF + ++RK  F    L+ PC+ + ++  + F LP  SGEKV L  +ILLSL VF L++++ +P TS  +PL+ KF    + L +  +  TV+VLN+  RS Q
Sbjct:   29 LYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFE----VTLATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYD--GFQVDLR-HIDELNGTNVVEVGVDLSEFYTSVEWDILEVPAVRNEK-FYTCCDEPYL----DITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVLVLNIHFRSPQ 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha3 (gene:FBgn0015519 transcript:FBtr0289988)

HSP 1 Score: 154.836 bits (390), Expect = 9.946e-40
Identity = 101/318 (31.76%), Postives = 170/318 (53.46%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNS--------SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            L D +   YN L  P+      L + I + L QL D++   Q +T ++W++ +W D  + W+PKEY  ++ +  P+  IW PD+ +Y    GN+E    V   +K  +NY G ++     + K+ C +++  FPFD Q C + F +W  D   F + ++   DE +G + V          ++ EW++ ++ A  + K F+   DE  L    ++TF + ++RK  F    L+ PC+ + ++  + F LP  SGEKV L  +ILLSL VF L++++ +P TS  +PL+ KF    + L +  +  TV+VLN+  RS Q
Sbjct:   29 LYDDLLSNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFE----VTLATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYD--GFQVDLR-HIDELNGTNVVEVGVDLSEFYTSVEWDILEVPAVRNEK-FYTCCDEPYL----DITFNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVLVLNIHFRSPQ 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRbeta2 (gene:FBgn0004118 transcript:FBtr0084681)

HSP 1 Score: 151.754 bits (382), Expect = 1.359e-39
Identity = 98/317 (30.91%), Postives = 168/317 (53.00%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKH-DEDSGHSFVNSS--------NGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS 1173
            L D +   YN L  P+    + L + + + L QL +++   Q +T ++W+   W D  + WDP+EY  ++Q+  P+  IW PD+ +Y    GNYE  +     +K  + Y G +      + K+ C + +  FP+D Q+C + F +W  +    ++    KH D+  G + V           + EW++ ++ A+ + + +        LE FS++TF L ++RK  F    L+ PC+ L ++  + F LP  SGEKV L  +IL+SL VF L++++ +P TS ++PL+ K+    + LVSL +  TV VLN+  RS
Sbjct:   33 LYDDLLSNYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLM----TKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDL----KHLDQIPGSNLVQVGIDLTEFYLSVEWDILEVPATKNEEYY-----PDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRS 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 167.162 bits (422), Expect = 1.741e-45
Identity = 122/444 (27.48%), Postives = 199/444 (44.82%), Query Frame = 1
Query:  217 PKRTNVSIYE---PLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDN--------------------------KQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            P R  VS+ E    LL  +F+GY     PI   N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P+ Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  + Y+G+I        K+ C +++  FPFD Q C + F +W  D  +  + +   H  D    F    NGEW +            H G+      ++  +T++  LKR P F   +L+ PCL L ++  + F LP   GEKV L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    +           C         +   +    +     ++  P   +GDG  + N                          + W  + Q+LDR+FL  +L +    ++ I T
Sbjct:   20 PAREFVSLAEREDALLRDLFQGYQRWVRPILHANHTVKVRFGLKISQLVDVDEKNQLMTTNVWLYEEWLDYKLRWNPENYGGITFIRVPSESIWLPDIVLYENADGRFEGSIM----TKAIVRYNGLITWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVELVLV-NHQVDRSDFF---DNGEWEILSATG-------HKGSRRDGHYSYPYITYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRTLFLQRLPDLLCMRGNTDRYHYPQMEPQSPD-LKPRSKKGPPGPEGDGQALINMLEQATNSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIFT 447          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrna4b (cholinergic receptor, nicotinic, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-090505-3])

HSP 1 Score: 162.155 bits (409), Expect = 1.289e-42
Identity = 104/316 (32.91%), Postives = 169/316 (53.48%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNS----SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            E LL  +F  YN L+ P+   +  + +   + + QL D+DE  Q +T +VW+   W D  + W+P+EY N+  I  P+  IW PD+ +Y    G++     V   +K ++ Y+G I+     + K+ C +++  FPFD Q C + F +W  D        + K D  S  S V+      +GEW +   V + +IK +     E   E + ++T++  ++R P F    L+ PCLL+  +  + F LP    EK+ L  ++LLSL VFLL+I++ +P TS  IPLI ++    +  V+L +I TV VLN+ HRSS+
Sbjct:   32 ERLLQSLFINYNKLSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYNNADGDFA----VTHLTKAQVFYNGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYD--------RAKIDLISMASDVDQMDYWESGEWVIINAVGTYNIKKY-----ECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSR 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 159.073 bits (401), Expect = 1.807e-42
Identity = 99/349 (28.37%), Postives = 171/349 (49.00%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQV 1284
            + LL ++F GY     P+   N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P++Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  + ++G I        K+ C +++  FPFD Q C + F +W  D  + ++T+   +  D    F    NGEW +              G+    + ++  +T++  LKR P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+  +I TV V+N+ HRSS    P+    +        +  C        Q+ D ++
Sbjct:   25 DTLLRNLFRGYQKWVRPVLHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWEEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLM----TKAIVRFNGTIMWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLTLVDAY-VDRKDFF---DNGEWEILNATGQR-------GSRRDGIYSYPYLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMRGHTDRYQYPDIEL 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 159.073 bits (401), Expect = 2.105e-42
Identity = 99/349 (28.37%), Postives = 171/349 (49.00%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQV 1284
            + LL ++F GY     P+   N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P++Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  + ++G I        K+ C +++  FPFD Q C + F +W  D  + ++T+   +  D    F    NGEW +              G+    + ++  +T++  LKR P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+  +I TV V+N+ HRSS    P+    +        +  C        Q+ D ++
Sbjct:   33 DTLLRNLFRGYQKWVRPVLHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWEEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLM----TKAIVRFNGTIMWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLTLVDAY-VDRKDFF---DNGEWEILNATGQR-------GSRRDGIYSYPYLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMRGHTDRYQYPDIEL 366          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrnb4 (cholinergic receptor, nicotinic, beta 4 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-120809-1])

HSP 1 Score: 157.147 bits (396), Expect = 2.190e-41
Identity = 100/300 (33.33%), Postives = 159/300 (53.00%), Query Frame = 1
Query:  274 YNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS 1173
            YN L  P     + + +++ + L QL  ++E +Q +T +VW+  NW D  +SWDP EY  I ++  P+  IW PD+ +Y    G YE  +F    +   + ++G I      + K+ C++E+  FPFD Q C + F +W  D    ++ +  K D  S   F  S  GEW++  L    ++              + ++T+   +KRKP F    L+ PC+L+  +A + F LP   GEK+ L  ++LL+L VFLL+IS  VP TS  +PLI K+    + LV+  +I +V VLN+ HRS
Sbjct:   50 YNKLIRPALNRTERVTVLLQVSLAQLISVNEREQIMTTNVWLTQNWNDYRLSWDPAEYEGIDKLRIPSRHIWLPDIVLYNNADGTYEVTVF----TNAIVLFNGSIAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDLLL--KSDAASMDDFTPS--GEWDILALPGRRTVSPLDA--------TYVDLTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIITSVCVLNVHHRS 333          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: ENSXETT00000021532.1 (cholinergic receptor, nicotinic alpha 7 [Source:NCBI gene;Acc:100493611])

HSP 1 Score: 156.377 bits (394), Expect = 4.093e-41
Identity = 99/306 (32.35%), Postives = 163/306 (53.27%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSH 1167
            L   + + YNPL  P+   + PL +   M L Q+ D+DE  Q LT ++W+ + W D  + W+  EY  +K +  P   IW PD+ +Y      ++        + V +N  G  Q     + K+ C +++  FPFD Q C + F +W       ++ M     E     ++  SNGEW++  +    S   +     E   E + +VTFT+ ++R+  +    L+ PC+L+  +A + F+LP  SGEK+ L  T+LLSL VF+L++++ +P TSDS+PLIA++F S + +V L ++ TVIVL   H
Sbjct:   31 LYKELMKNYNPLERPVLNDSHPLTVYFGMSLMQIMDVDEKNQVLTTNIWLQMQWIDYYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDASF----HTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDIQKCNLKFGSWTYGGWSLDLQML----ESDISEYI--SNGEWDLVGVPGKRSENYY-----ECCKEPYLDVTFTIIMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHH 321          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: HTR3A (5-hydroxytryptamine (serotonin) receptor 3A, ionotropic [Source:NCBI gene;Acc:101731577])

HSP 1 Score: 155.221 bits (391), Expect = 6.734e-41
Identity = 116/419 (27.68%), Postives = 206/419 (49.16%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLH-GNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTM--KPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSS-QIPLPVCFQKFLYSSAAQFFC------FSFTKQHKQFTDYQVLFKNSTNAT---TEISPTWTDGDGNQIDN---------------KQWDQLGQLLDRVFLVIYLI 1422
            L DH+ EGY     P+    +   + ID+ +Y +  +DE  Q LT  +W    W D  ++WDPK++ N+ QI  P   IW PD+ I + +  G   +  +V+      +N++G +Q    + + T C + I  FPFD Q C +TF++W   ++  N+++   P+  ++    F+N  NGEW +  +++    + F    D     +F+E+ F + +KR+P F    L+ P + L+ +  I F LP  SGE+V    T+LL   VFL+I+SD +P T+   PLI  +F  C+ L+ + +  T++++ L H+   Q  +P   ++ +        C      F   + H     +Q+  +NS+      ++ +P   D   ++I +               K+W Q+G +LD +   IYL+
Sbjct:   46 LSDHLMEGYKKGVRPVLDWRQTTTVYIDVMVYAILGVDEKNQVLTTYIWYRQFWVDEFLTWDPKKFENVSQISIPTEKIWVPDILINEFVDVGKSPDIPYVY------VNHEGRVQNYKPIQVVTACSLNIYNFPFDVQNCSLTFTSWLHTIQDINVSLWRTPEEVKEDKSLFMN--NGEWELLSVLS--QYRKFVENED-----SFAEMKFHVVIKRRPLFYAVNLLLPSMFLMVMDIIGFYLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLTETILIVRLVHKQDLQTHVPEWLKRLVLEKITALLCIRDKKKFGAVRVHSSDISHQM--ENSSTGVLVPSKENPLVVDNILHEIASIRQYLEKRDQCRDIAKEWLQVGYVLDILLFRIYLV 447          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: HTR3A (5-hydroxytryptamine (serotonin) receptor 3A, ionotropic [Source:NCBI gene;Acc:101731577])

HSP 1 Score: 154.066 bits (388), Expect = 1.384e-40
Identity = 115/419 (27.45%), Postives = 205/419 (48.93%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLH-GNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTM--KPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSS-QIPLPVCFQKFLYSSAAQFFC------FSFTKQHKQFTDYQVLFKNSTNAT---TEISPTWTDGDGNQIDN---------------KQWDQLGQLLDRVFLVIYLI 1422
            L DH+ EGY     P+    +   + ID+ +Y +  +DE  Q LT  +W    W D  ++WDPK++ N+ QI  P   IW PD+ I + +  G   +  +V+      +N++G +Q    + + T C + I  FPFD Q C +TF++W   ++  N+++   P+  ++    F+N  NGEW +  +++    + F    D     +F+E+ F + +KR+P F    L+ P + L+ +  I F LP  SGE+V    T+LL   VFL+I+SD +P T+   PLI  +F  C+ L+ + +  T++++ L H+   Q  +P   ++ +        C      F   + H     +Q+   +S +     ++ +P   D   ++I +               K+W Q+G +LD +   IYL+
Sbjct:   32 LSDHLMEGYKKGVRPVLDWRQTTTVYIDVMVYAILGVDEKNQVLTTYIWYRQFWVDEFLTWDPKKFENVSQISIPTEKIWVPDILINEFVDVGKSPDIPYVY------VNHEGRVQNYKPIQVVTACSLNIYNFPFDVQNCSLTFTSWLHTIQDINVSLWRTPEEVKEDKSLFMN--NGEWELLSVLS--QYRKFVENED-----SFAEMKFHVIIKRRPLFYAVNLLLPSMFLMVMDIIGFYLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLTETILIVRLVHKQDLQTHVPEWLKRLVLEKITALLCIRDKKKFGAVRVHSSDISHQMENSSSRDRVLVPSKENPLVVDNILHEIASIRQYLEKRDQCRDIAKEWLQVGYVLDILLFRIYLV 435          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: arid2 (AT-rich interaction domain 2 [Source:Xenbase;Acc:XB-GENE-6070950])

HSP 1 Score: 154.451 bits (389), Expect = 1.414e-40
Identity = 112/435 (25.75%), Postives = 204/435 (46.90%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS-SQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLF------------------------------KNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILTAK 1461
            L++ +F+ YN +  P+      + + + + L QL ++DE  Q +T +V +   W+D  + W+P++Y  IK++   + DIW PD+ +Y    G++     + +E+KV ++Y G I      + K++C + +  FPFD Q C +    W  D  +  + + P+ D     +F+ S  GEW +           +    +   L    ++T+   L+R P +    +V PCLL  ++  + F LP  SGEK+ L  ++LLSL VFLL+I + +P TS ++PLI K+    +  V   ++ TVIV+N  HRS S   +P   +K    +  +   FS  K+  Q    + +F                              K++      I+ T      +   +++W  +  +LD + L +++I+C   +L I   +
Sbjct:   41 LINDLFKSYNKVVRPVKAFKDKVVVTLGLQLIQLINVDEVNQIVTTNVRLKQQWEDVHLKWNPEDYGGIKKVRISSGDIWRPDIVLYNNADGDFA----IVQETKVLLDYTGKIIWTPPAIFKSYCEMIVTYFPFDLQNCSMKLGTWTYDGSL--VVINPESDRPDLSNFMES--GEWYMKDYRGWKHWVYYDCCPETPYL----DITYHFLLQRLPLYFIVNVVIPCLLFSFLTGLVFYLPTDSGEKITLSVSVLLSLVVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVITSIVITVIVINTHHRSPSTHIMPQWLKKIFIETIPRVMFFSTMKRPAQDQQKKKIFTEDIDISDISGKLGPAAVKYQSPILKNPDVKSAIEGAKYIAETMKSDQESNKASEEWKFVAMVLDHLLLAVFMIVCIIGTLAIFAGR 463          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: arid2 (AT-rich interaction domain 2 [Source:Xenbase;Acc:XB-GENE-6070950])

HSP 1 Score: 154.066 bits (388), Expect = 1.697e-40
Identity = 112/435 (25.75%), Postives = 204/435 (46.90%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS-SQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLF------------------------------KNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILTAK 1461
            L++ +F+ YN +  P+      + + + + L QL ++DE  Q +T +V +   W+D  + W+P++Y  IK++   + DIW PD+ +Y    G++     + +E+KV ++Y G I      + K++C + +  FPFD Q C +    W  D  +  + + P+ D     +F+ S  GEW +           +    +   L    ++T+   L+R P +    +V PCLL  ++  + F LP  SGEK+ L  ++LLSL VFLL+I + +P TS ++PLI K+    +  V   ++ TVIV+N  HRS S   +P   +K    +  +   FS  K+  Q    + +F                              K++      I+ T      +   +++W  +  +LD + L +++I+C   +L I   +
Sbjct:   30 LINDLFKSYNKVVRPVKAFKDKVVVTLGLQLIQLINVDEVNQIVTTNVRLKQQWEDVHLKWNPEDYGGIKKVRISSGDIWRPDIVLYNNADGDFA----IVQETKVLLDYTGKIIWTPPAIFKSYCEMIVTYFPFDLQNCSMKLGTWTYDGSL--VVINPESDRPDLSNFMES--GEWYMKDYRGWKHWVYYDCCPETPYL----DITYHFLLQRLPLYFIVNVVIPCLLFSFLTGLVFYLPTDSGEKITLSVSVLLSLVVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVITSIVITVIVINTHHRSPSTHIMPQWLKKIFIETIPRVMFFSTMKRPAQDQQKKKIFTEDIDISDISGKLGPAAVKYQSPILKNPDVKSAIEGAKYIAETMKSDQESNKASEEWKFVAMVLDHLLLAVFMIVCIIGTLAIFAGR 452          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna10 (cholinergic receptor, nicotinic, alpha polypeptide 10 [Source:MGI Symbol;Acc:MGI:3609260])

HSP 1 Score: 165.236 bits (417), Expect = 7.401e-45
Identity = 114/425 (26.82%), Postives = 201/425 (47.29%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI-PLPVCFQKFLYSSAAQFFCFSF-------TKQHKQFTDYQVLFKNSTNATTE----------------ISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYIL 1452
            L   +F  Y     P+   ++ L++ +++ L Q+ D+DE  Q LTL +WI   W D  + WDPK Y ++  I  P+  +W PD+ +Y                + V + +DG ++  A  + ++ CRV+++ FPFD+Q C +TF +W        + ++P+    S   FV   N EW V  + A   +  +   +     E + +VTFTL L+R+       L+ PC+ +  +A + F LP  SGEKV L  T+LL+L VF LI+++ +P  ++S+PLI K++ + + +V+     T++++NL +      P+P   +  L    A+  C          +K  +     Q           E                I+ T+      Q  ++ W +L +++DR FL I+  +   +SL +L
Sbjct:   33 LFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIRIPSSLVWRPDIVLYNKADTQPPASA----STNVVVRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFGSWTHG--GHQLDVRPRGTSASLADFVE--NVEWRVLGMPARRRVLTYGCCS-----EPYPDVTFTLLLRRRAAAYVCNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLILAESMP-PAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAWARVLLLGHLAKGLCVRERGEPCGQSKPLESAPSLQPPAGPPAGPCHEPRCLCHQEALLHHVASIAGTFRSHRAAQRRHEDWKRLARVMDRFFLGIFFCMALVMSLLVL 443          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 166.007 bits (419), Expect = 7.975e-44
Identity = 107/322 (33.23%), Postives = 167/322 (51.86%), Query Frame = 1
Query:  226 TNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNS----SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            T     E LL  +F GYN  + P+   +  + +   + + QL D+DE  Q +T +VW+   W D  + WDP +Y N+  I  P+  IW PD+ +Y    G++     V   +K  + YDG +Q     + K+ C +++  FPFD Q C + F +W  D        K K D  S HS V+      +GEW     V  D++  ++    E   E + ++T+   ++R P F    L+ PCLL+  +  + F LP   GEKV L  ++LLSL VFLL+I++ +P TS  IPLI ++    +  V+L ++ TV VLN+ HRS +
Sbjct:   34 TRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFA----VTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD--------KAKIDLVSMHSRVDQLDFWESGEW-----VIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPR 338          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 165.622 bits (418), Expect = 8.353e-44
Identity = 107/322 (33.23%), Postives = 167/322 (51.86%), Query Frame = 1
Query:  226 TNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNS----SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            T     E LL  +F GYN  + P+   +  + +   + + QL D+DE  Q +T +VW+   W D  + WDP +Y N+  I  P+  IW PD+ +Y    G++     V   +K  + YDG +Q     + K+ C +++  FPFD Q C + F +W  D        K K D  S HS V+      +GEW     V  D++  ++    E   E + ++T+   ++R P F    L+ PCLL+  +  + F LP   GEKV L  ++LLSL VFLL+I++ +P TS  IPLI ++    +  V+L ++ TV VLN+ HRS +
Sbjct:   34 TRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFA----VTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD--------KAKIDLVSMHSRVDQLDFWESGEW-----VIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPR 338          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 158.303 bits (399), Expect = 7.630e-42
Identity = 97/306 (31.70%), Postives = 168/306 (54.90%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSH 1167
            L   + + YNPL  P+   ++PL +   + L Q+ D+DE  Q LT ++W+ ++W D  + W+  EY  +K +  P   IW PD+ +Y      ++        + V +N  G  Q     + K+ C +++  FPFD Q C + F +W+      ++ M+    E    S++   NGEW++  +    + K +     E   E + +VT+T+ ++R+  +    L+ PC+L+  +A + F+LP  SGEK+ L  T+LLSL VF+L++++ +P TSDS+PLIA++F S + +V L ++ TVIVL   H
Sbjct:   29 LYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATF----HTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ----EADISSYI--PNGEWDLMGIPGKRNEKFY-----ECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHH 319          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrnb3 (cholinergic receptor, nicotinic, beta polypeptide 3 [Source:MGI Symbol;Acc:MGI:106212])

HSP 1 Score: 154.836 bits (390), Expect = 5.006e-41
Identity = 97/346 (28.03%), Postives = 172/346 (49.71%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTD 1275
            + LL H+F+GY     P+   +  + +   + + QL D+DE  Q +T +VW+   W D  + W+P++Y  I  I  P+  +W PD+ +++   G +E  +     +K  +   G +        K+ C +++  FPFD Q C + F +W  D  + ++ +    + D    F    NGEW +   + +  +K    G       ++  VT++  L+R P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    ++       ++ C    +    F D
Sbjct:   36 DALLRHLFQGYQKCVRPVLNSSDIIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPDIVLFENADGRFEGSLM----TKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDKQNCSMKFGSWTYDGTMVDLILI-NENVDRKDFF---DNGEWEI---LNAKGMK----GNRREGFYSYPFVTYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLEKLPRWLCMKDPRDRFSFPD 366          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P43679|ACHB3_CHICK (Neuronal acetylcholine receptor subunit beta-3 OS=Gallus gallus OX=9031 GN=CHRNB3 PE=2 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 2.224e-47
Identity = 122/433 (28.18%), Postives = 215/433 (49.65%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFC-------FSFT----------------KQHKQFTDYQ----VLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            + LL H+F+GY     P+   N  + ++  + + QL D+DE  Q +T +VW+   W D  +SW+P+EY  I  I  P+  +W PD+ +++   G +E  +     +K  + Y+GV+Q       K+ C +E+  FPFD Q C + F +W  D  + ++ +    + D+   F    NGEW +   + +  +K    G  +  L ++  VT++  L+R P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    ++       +  C       +SF+                ++HKQ  D +       + + ++   IS         +   + W  + Q+LDR+FL ++L++    S+ I T
Sbjct:   27 DALLRHLFQGYQKWVRPVENSNDTIKVLFGLKISQLVDVDEKNQLMTTNVWLKQEWMDHKLSWNPEEYGGITAIRVPSESLWLPDIVLFENADGRFEGSLM----TKAIVKYNGVVQWMPPASYKSSCTMELTFFPFDRQNCSMKFGSWTYDGSMVDLIL-VDENVDTKDFF---DNGEWEI---LNAKGMK----GNRKDGLYSYPFVTYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMAPWVKRLFLQKLPRLLCMKGHVDRYSFSDTEEKETTLKSKLPGKQKHKQAKDGEKVVIAFLEKAADSIRYISRHVKKDAFIRQVVQDWKFVAQVLDRIFLWLFLVVSVTGSVLIFT 444          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|Q9GZZ6|ACH10_HUMAN (Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.645e-44
Identity = 114/428 (26.64%), Postives = 205/428 (47.90%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI-PLPVCFQKFLYSSAAQFFC---------------FSFTKQHKQ---------FTDYQVLFKNST--NATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYIL 1452
            L   +F  Y     P+   ++ L++ +++ L Q+ D+DE  Q LTL +WI   W D  + WDP  Y  +  I  P+  +W PD+ +Y                + V + +DG ++  A  + ++ CRV++A FPFD+Q C +TF +W        + ++P+    S   FV   N EW V  + A   +  +   +     E + +VTFTL L+R+       L+ PC+L+  +A + F LP  SGEKV L  T+LL+L VF L++++ +P  ++S+PLI K++ + + +V+     T++++NL +    + P+P   +  L    A+  C                S + Q  +           + + L +     +    I+ T+      Q  ++ W +L +++DR FL I+  +   +SL +L
Sbjct:   33 LFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSA----STNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHG--GHQLDVRPRGAAASLADFVE--NVEWRVLGMPARRRVLTYGCCS-----EPYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMP-PAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQSRPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWKRLARVMDRFFLAIFFSMALVMSLLVL 446          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|Q9JLB5|ACH10_RAT (Neuronal acetylcholine receptor subunit alpha-10 OS=Rattus norvegicus OX=10116 GN=Chrna10 PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.303e-44
Identity = 114/425 (26.82%), Postives = 200/425 (47.06%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI-PLPVCFQKFLYSSAAQFFCFSF----TKQHKQFTDYQVLFKNSTNAT-------------------TEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYIL 1452
            L   +F  Y     P+   ++ L++ +++ L Q+ D+DE  Q LTL +WI   W D  + WDPK Y ++  I  P+  +W PD+ +Y                + V + +DG ++  A  + ++ CRV+++ FPFD+Q C +TF +W        + ++P+    S   FV   N EW V  + A   +  +   +     E + +VTFTL L+R+       L+ PC+ +  +A + F LP  SGEKV L  T+LL+L VF LI+++ +P  ++S+PLI K++ + + +V+     T++++NL +      P+P   +  L    A+  C         Q K       L     +                       I+ T+      Q  ++ W +L +++DR FL I+  +   +SL +L
Sbjct:   33 LFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIRIPSRLVWRPDIVLYNKADTQPPASA----STNVVVRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFGSWTHG--GHQLDVRPRGTSASLADFVE--NVEWRVLGMPARRRVLTYGCCS-----EPYPDVTFTLLLRRRAAAYVCNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLILAESMP-PAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAWARVLLLGHLAKGLCVRERGEPCGQSKPLESAPSLQPPPASPAGPCHEPRCLCHQEALLHHIASIASTFRSHRAAQRRHEDWKRLARVMDRFFLGIFFCMALVMSLIVL 443          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P09482|ACHA4_CHICK (Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.380e-43
Identity = 109/326 (33.44%), Postives = 170/326 (52.15%), Query Frame = 1
Query:  214 GPKRTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNS----SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            G   T     E LL  +F GYN  + P+   +  + +   + + QL D+DE  Q +T +VW+   W D  + WDP+EY N+  I  P+  IW PD+ +Y    G++     V   +K  + YDG I+     + K+ C +++  FPFD Q C + F +W  D        K K D  S HS V+      +GEW +   V + + K +     E   E + ++T++  ++R P F    L+ PCLL+  +  + F LP   GEK+ L  ++LLSL VFLL+I++ +P TS  IPLI ++    +  V+L +I TV VLN+ HRS +
Sbjct:   23 GHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVLYNNADGDFA----VTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYD--------KAKIDLVSMHSHVDQLDYWESGEWVIINAVGNYNSKKY-----ECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPR 331          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P13908|ACHN2_CARAU (Neuronal acetylcholine receptor subunit non-alpha-2 OS=Carassius auratus OX=7957 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.915e-43
Identity = 117/444 (26.35%), Postives = 203/444 (45.72%), Query Frame = 1
Query:  217 PKRTNVSIYE---PLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDN--------------------------KQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            P R  VS+ E    LL  +F+GY     P+   N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P+ Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  + Y+G+I        K+ C +++  FPFD Q C + F +W  D  +  + +  +  + S        NGEW +   +++  +K    G+ +    ++  +T++  LKR P F   +L+ PCL L ++  + F LP   GEKV L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I T+ V+N+ HRSS    P+    +           C         + + +           +  P   +G+G  + N                          + W  + Q+LDR+FL  +L +    ++ I T
Sbjct:   20 PAREFVSLAEREDALLRELFQGYQRWVRPVQHANHSVKVRFGLKISQLVDVDEKNQLMTTNVWLWQEWLDYKLRWNPENYGGITSIRVPSESIWLPDIVLYENADGRFEGSLM----TKAIVRYNGMITWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVKLVLINQQVDRSDF----FDNGEWEI---LSATGVK----GSRQDSHLSYPYITYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTIFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCMRGNTDRYHYPELEP-HSPDLKPRNKKGPPGPEGEGQALINLLEQATNSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWTFLTVSVLGTILIFT 447          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A267DIL7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026767g3 PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 2.832e-103
Identity = 192/434 (44.24%), Postives = 262/434 (60.37%), Query Frame = 1
Query:  214 GPKRTNVSIYEPLLDHIFEG----YNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMK---PKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADES--QLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYS-----------SAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            GPK T   IY+ LL ++FE     Y   A+PIC+  K L +  DM L QLFDLDEP Q LT+DVW++  WKDC ++WDPK +NNI   V  A +IW+PDL  Y+ LHGN+EEGMF++ ESK +I  DG IQLGAQ + K+FCR+ IA+FP+D Q C ITFS+W KD   F +  K   P   ED  H+FV++SNGEW V    + D +    VG DE+  +   +SEV F L LKRK  F + Y++FPC+LL W+    FI+P   GEK+  ++TILLSL VFLL++SD +P + D++P++  +F   I LVSL  I T+I  N+S +     +P CF K L S           + A     SF  + +Q     V      ++   +S T  +    Q +NK W  LG +LDRVFL+IY +L   +S++ILT
Sbjct:   31 GPKNT---IYDGLLAYLFENETTPYKANAMPICELGKKLKIQQDMLLIQLFDLDEPTQMLTVDVWVESTWKDCRLTWDPKRFNNIDNFVIKAEEIWYPDLIFYESLHGNFEEGMFIYGESKARIFSDGSIQLGAQAVFKSFCRINIAQFPYDRQRCNITFSSWTKDTSNFLLVKKEEAPGKKED--HAFVSASNGEWMVEGFPSFDRVADRKVGLDEASGRSRQYSEVAFQLRLKRKYMFQQVYMLFPCMLLTWLTLFVFIMPTECGEKIAYVTTILLSLMVFLLMVSDNIPRSGDAVPVLGIYFCIAIALVSLANIKTIISYNISLKGKDFCMPACFIKILESGKYVGLPLTHHNEAAVKVISFAMKPRQAGQNPV--TRHEDSEVPLSTTNPESHFGQDENK-WRFLGIILDRVFLIIYFVLNLAVSIWILT 456          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A267DU95 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026767g2 PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 3.437e-103
Identity = 192/434 (44.24%), Postives = 262/434 (60.37%), Query Frame = 1
Query:  214 GPKRTNVSIYEPLLDHIFEG----YNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMK---PKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADES--QLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYS-----------SAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            GPK T   IY+ LL ++FE     Y   A+PIC+  K L +  DM L QLFDLDEP Q LT+DVW++  WKDC ++WDPK +NNI   V  A +IW+PDL  Y+ LHGN+EEGMF++ ESK +I  DG IQLGAQ + K+FCR+ IA+FP+D Q C ITFS+W KD   F +  K   P   ED  H+FV++SNGEW V    + D +    VG DE+  +   +SEV F L LKRK  F + Y++FPC+LL W+    FI+P   GEK+  ++TILLSL VFLL++SD +P + D++P++  +F   I LVSL  I T+I  N+S +     +P CF K L S           + A     SF  + +Q     V      ++   +S T  +    Q +NK W  LG +LDRVFL+IY +L   +S++ILT
Sbjct:   31 GPKNT---IYDGLLAYLFENETTPYKANAMPICELGKKLKIQQDMLLIQLFDLDEPTQMLTVDVWVESTWKDCRLTWDPKRFNNIDNFVIKAEEIWYPDLIFYESLHGNFEEGMFIYGESKARIFSDGSIQLGAQAVFKSFCRINIAQFPYDRQRCNITFSSWTKDTSNFLLVKKEEAPGKKED--HAFVSASNGEWMVEGFPSFDRVADRKVGLDEASGRSRQYSEVAFQLRLKRKYMFQQVYMLFPCMLLTWLTLFVFIMPTECGEKIAYVTTILLSLMVFLLMVSDNIPRSGDAVPVLGIYFCIAIALVSLANIKTIISYNISLKGKDFCMPACFIKILESGKYVGLPLTHHNEAAVKVISFAMKPRQAGQNPV--TRHEDSEVPLSTTNPESHFGQDENK-WRFLGIILDRVFLIIYFVLNLAVSIWILT 456          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A267GZR6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026767g5 PE=3 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 4.499e-103
Identity = 192/434 (44.24%), Postives = 262/434 (60.37%), Query Frame = 1
Query:  214 GPKRTNVSIYEPLLDHIFEG----YNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMK---PKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADES--QLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYS-----------SAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            GPK T   IY+ LL ++FE     Y   A+PIC+  K L +  DM L QLFDLDEP Q LT+DVW++  WKDC ++WDPK +NNI   V  A +IW+PDL  Y+ LHGN+EEGMF++ ESK +I  DG IQLGAQ + K+FCR+ IA+FP+D Q C ITFS+W KD   F +  K   P   ED  H+FV++SNGEW V    + D +    VG DE+  +   +SEV F L LKRK  F + Y++FPC+LL W+    FI+P   GEK+  ++TILLSL VFLL++SD +P + D++P++  +F   I LVSL  I T+I  N+S +     +P CF K L S           + A     SF  + +Q     V      ++   +S T  +    Q +NK W  LG +LDRVFL+IY +L   +S++ILT
Sbjct:   31 GPKNT---IYDGLLAYLFENETTPYKANAMPICELGKKLKIQQDMLLIQLFDLDEPTQMLTVDVWVESTWKDCRLTWDPKRFNNIDNFVIKAEEIWYPDLIFYESLHGNFEEGMFIYGESKARIFSDGSIQLGAQAVFKSFCRINIAQFPYDRQRCNITFSSWTKDTSNFLLVKKEEAPGKKED--HAFVSASNGEWMVEGFPSFDRVADRKVGLDEASGRSRQYSEVAFQLRLKRKYMFQQIYMLFPCMLLTWLTLFVFIMPTECGEKIAYVTTILLSLMVFLLMVSDNIPRSGDAVPVLGIYFCIAIALVSLANIKTIISYNISLKGKDFCMPACFIKILESGKYVGLPLTHHNEAAVKVISFAMKPRQAGQNPV--TRHEDSEVPLSTTNPESHFGQDENK-WRFLGIILDRVFLIIYFVLNLAVSIWILT 456          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A1I8JJQ2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.132e-99
Identity = 178/424 (41.98%), Postives = 257/424 (60.61%), Query Frame = 1
Query:  214 GPKRTNVSIYEPLLDHIFEG----YNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDS-GHSFVNSSNGEWNVTKLVASDSIKAFHVGADES--QLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTW---TDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            GPK+T   IY+ LL H+FE     Y P A+PIC+P   LH+  DM L QLFDLDEP Q LT+DVW++  WKDC ++WDP ++  I      A +IW PDL  ++ LHGN+EEGMF++ E+  +I  DG +QLG Q + K FCRV+I+ FP+DSQ C ITFS+W KD   F +T KP  +  S  H+F ++SNGEW V    + ++I +  VG DES  +  +++EV F L LKRK  F + Y++FPC+LL W+    F+LP  SGEK+G ++TILLSLFVFLL+++D +P + DSIP +  +F   I LVSL  +  VI  N+S +     +P   +  L  S ++F      +      +     +    A++E        +DG   Q D  QW  LG +LDR+F ++Y  +   ++++IL+
Sbjct:   21 GPKKT---IYDGLLRHLFENDTLPYRPGAMPICEPGGKLHVNQDMLLLQLFDLDEPTQMLTVDVWVESIWKDCRLNWDPAKFGGIDNFAIKASEIWFPDLLFFESLHGNFEEGMFIYGEATARIFSDGSVQLGTQAVFKIFCRVDISSFPYDSQQCNITFSSWTKDASTFVLTKKPSDESSSDDHAFQSASNGEWQVEGFPSFNTISSRQVGVDESGGRSRDYTEVVFQLRLKRKYLFYQAYMLFPCILLTWLTLFVFLLPAESGEKMGYVTTILLSLFVFLLLVADNIPRSGDSIPTVGVYFCLAIALVSLANVKAVISYNISLKGRDFCMPRNLKWLL--SRSRFVGLRLGRGAVPTEESPAPDEGGGAASSEAKEKLNGTSDGHSKQ-DENQWRYLGIMLDRIFFIVYFFVNLAVTIWILS 438          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A1I8J004 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.167e-99
Identity = 178/424 (41.98%), Postives = 257/424 (60.61%), Query Frame = 1
Query:  214 GPKRTNVSIYEPLLDHIFEG----YNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDS-GHSFVNSSNGEWNVTKLVASDSIKAFHVGADES--QLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTW---TDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            GPK+T   IY+ LL H+FE     Y P A+PIC+P   LH+  DM L QLFDLDEP Q LT+DVW++  WKDC ++WDP ++  I      A +IW PDL  ++ LHGN+EEGMF++ E+  +I  DG +QLG Q + K FCRV+I+ FP+DSQ C ITFS+W KD   F +T KP  +  S  H+F ++SNGEW V    + ++I +  VG DES  +  +++EV F L LKRK  F + Y++FPC+LL W+    F+LP  SGEK+G ++TILLSLFVFLL+++D +P + DSIP +  +F   I LVSL  +  VI  N+S +     +P   +  L  S ++F      +      +     +    A++E        +DG   Q D  QW  LG +LDR+F ++Y  +   ++++IL+
Sbjct:   22 GPKKT---IYDGLLRHLFENDTLPYRPGAMPICEPGGKLHVNQDMLLLQLFDLDEPTQMLTVDVWVESIWKDCRLNWDPAKFGGIDNFAIKASEIWFPDLLFFESLHGNFEEGMFIYGEATARIFSDGSVQLGTQAVFKIFCRVDISSFPYDSQQCNITFSSWTKDASTFVLTKKPSDESSSDDHAFQSASNGEWQVEGFPSFNTISSRQVGVDESGGRSRDYTEVVFQLRLKRKYLFYQAYMLFPCILLTWLTLFVFLLPAESGEKMGYVTTILLSLFVFLLLVADNIPRSGDSIPTVGVYFCLAIALVSLANVKAVISYNISLKGRDFCMPRNLKWLL--SRSRFVGLRLGRGAVPTEESPAPDEGGGAASSEAKEKLNGTSDGHSKQ-DENQWRYLGIMLDRIFFIVYFFVNLAVTIWILS 439          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 164.081 bits (414), Expect = 1.638e-44
Identity = 115/438 (26.26%), Postives = 199/438 (45.43%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQV--------------------------------LFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            + LL ++F GY     P+   N  + +   + + QL D+DE  Q +T +VW+   W D  + WDP++Y  I  I  P+ +IW PD+ +Y+   G +E  +     +K  + YDG I        K+ C +++  FPFD Q C + F +W  D  + ++ +  +H  D    F    NGEW +              G+    + ++  VT++  LKR P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+  +I TV V+N+ HRSS    P+    +        +  C        ++ D ++                                + + +T++   IS         +   + W  + Q+LDR+FL  +L +    ++ I T
Sbjct:   19 DTLLRNVFRGYQKWVRPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGRFEGSLM----TKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLALVDQH-VDRKDFF---DNGEWEILDATGRR-------GSRRDGIYSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMHGHTDRYRYPDMELHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIFT 441          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 164.466 bits (415), Expect = 1.944e-44
Identity = 125/450 (27.78%), Postives = 207/450 (46.00%), Query Frame = 1
Query:  199 TGSYGGPKRTNVSIYE-PLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEI--SPTWTDGDGNQIDN--------------------------KQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            T + GG +  +++  E  LL  +F+GY     P    N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P++Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  I Y+G +        K+ C +++  FPFD Q C + F +W  D  + +M +   +  D    F    NGEW +   +++  +K    G       ++  VT++  LKR P F   +L+ PCL L ++  + F LP   GEKV L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    +           C    + H     Y  L   S      I  +P   +G+G  + N                          + W  + Q+LDR+FL  +L +    ++ I T
Sbjct:   19 TSTTGGGEFVSLAEREDALLRDLFQGYQRWVRPTQHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGRFEGSLM----TKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDMVLM-NYQVDRRDFF---DNGEWEI---LSATGMK----GNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCM---RGHTDRYHYPELEPQSPELKPRIRKAPPGPEGEGQALVNMLEKATCSVRYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIFT 450          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 164.081 bits (414), Expect = 2.711e-44
Identity = 125/450 (27.78%), Postives = 207/450 (46.00%), Query Frame = 1
Query:  199 TGSYGGPKRTNVSIYE-PLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEI--SPTWTDGDGNQIDN--------------------------KQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            T + GG +  +++  E  LL  +F+GY     P    N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P++Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  I Y+G +        K+ C +++  FPFD Q C + F +W  D  + +M +   +  D    F    NGEW +   +++  +K    G       ++  VT++  LKR P F   +L+ PCL L ++  + F LP   GEKV L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    +           C    + H     Y  L   S      I  +P   +G+G  + N                          + W  + Q+LDR+FL  +L +    ++ I T
Sbjct:   19 TSTTGGGEFVSLAEREDALLRDLFQGYQRWVRPTQHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGRFEGSLM----TKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDMVLM-NYQVDRRDFF---DNGEWEI---LSATGMK----GNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCM---RGHTDRYHYPELEPQSPELKPRIRKAPPGPEGEGQALVNMLEKATCSVRYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIFT 450          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 163.696 bits (413), Expect = 2.822e-44
Identity = 115/438 (26.26%), Postives = 199/438 (45.43%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQV--------------------------------LFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            + LL ++F GY     P+   N  + +   + + QL D+DE  Q +T +VW+   W D  + WDP++Y  I  I  P+ +IW PD+ +Y+   G +E  +     +K  + YDG I        K+ C +++  FPFD Q C + F +W  D  + ++ +  +H  D    F    NGEW +              G+    + ++  VT++  LKR P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+  +I TV V+N+ HRSS    P+    +        +  C        ++ D ++                                + + +T++   IS         +   + W  + Q+LDR+FL  +L +    ++ I T
Sbjct:   33 DTLLRNVFRGYQKWVRPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGRFEGSLM----TKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLALVDQH-VDRKDFF---DNGEWEILDATGRR-------GSRRDGIYSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMHGHTDRYRYPDMELHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIFT 455          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 162.925 bits (411), Expect = 4.823e-44
Identity = 121/434 (27.88%), Postives = 199/434 (45.85%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEI--SPTWTDGDGNQIDN--------------------------KQWDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
            + LL  +F+GY     P    N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P++Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  I Y+G +        K+ C +++  FPFD Q C + F +W  D  + +M +   +  D    F    NGEW +   +++  +K    G       ++  VT++  LKR P F   +L+ PCL L ++  + F LP   GEKV L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    +           C    + H     Y  L   S      I  +P   +G+G  + N                          + W  + Q+LDR+FL  +L +    ++ I T
Sbjct:   28 DALLRDLFQGYQRWVRPTQHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGRFEGSLM----TKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDMVLM-NYQVDRRDFF---DNGEWEI---LSATGMK----GNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCM---RGHTDRYHYPELEPQSPELKPRIRKAPPGPEGEGQALVNMLEKATCSVRYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIFT 443          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 155.992 bits (393), Expect = 3.277e-42
Identity = 98/327 (29.97%), Postives = 166/327 (50.76%), Query Frame = 1
Query:  217 PKRTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVC 1197
            P  +   + + LL  + + Y     P+ K +  + +   + + QL D+DE  Q +T +VW+   W D ++ W+P +Y  I  I  PA  IW PD+ +Y    G +E  +     +K  + +DG I+     + K+ C +++  FPFD Q C + F +W  D  + ++ M    D D G  F    NGEW       +  ++      D  +   +  +T++  ++R P F   +L+ PCL L ++    F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+ 
Sbjct:   27 PSLSLAELEDRLLKRMLKDYQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIV----TKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMV-NSDVDRGEYF---DNGEWEFLNATGNKGVR-----LDGHRF--YPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMA 338          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 140.969 bits (354), Expect = 1.167e-36
Identity = 90/315 (28.57%), Postives = 164/315 (52.06%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYE-EGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSN----GEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            L   +F  YNP   P+   + P+ +  ++ + QL  LDE  Q +  ++W+   W D    W+P ++  ++ I  P+  IW PD+ +Y    G+++ EG     ++K  + YDG +      + K+ C++++  FPFD Q C + F +W  D        K K D     + +N  +    GEW +  +        ++        + + ++T++++++R P F    L+ PCLL+ ++  + F LP   GEKV L  ++LLSL VFLL+I++ +P TS  IPLI ++    +  V+L ++ T+ VLN+ +R+ +
Sbjct:   11 LYKTLFTSYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEG-----KTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYD--------KAKIDLVLVGTKINLKDFWESGEWVIIDVPGYKHDIKYNCCE-----QIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPE 307          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 138.658 bits (348), Expect = 9.069e-36
Identity = 97/317 (30.60%), Postives = 166/317 (52.37%), Query Frame = 1
Query:  244 EPLLDHIF--EGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMK-PKHDEDSGHSFVNSS----NGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS 1173
            E LL  +F  + Y  L  P       + + + M L QL  L   + ++TL   I L+W+D  +SWDP+ Y+N++ I      +W PD+ +     GN++ G++V     V ++Y G ++     + ++ C +++  FPFD Q C + F ++  D    N+     +H ++  H  ++ S    +GEW +    +  +           +   + ++TF L ++RKP F    +V PC+L+   A  TF LP  +GEK+GL  ++LL+L VFLL+++D VP TS  +P+I  +    + +V+  +I TVIVLNL  RS
Sbjct:   25 ENLLKDLFVVQQYKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYV----HVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQEIRHIIIDESTFPVSGEWQIKHKPSRKNTNP--------RDPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRS 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: htr3a (5-hydroxytryptamine (serotonin) receptor 3A [Source:ZFIN;Acc:ZDB-GENE-071012-5])

HSP 1 Score: 136.732 bits (343), Expect = 3.967e-35
Identity = 97/332 (29.22%), Postives = 167/332 (50.30%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLH-GNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSS-QIPLPVCFQKFLYSSAAQFFC 1239
            L   +  GY+    P+    +P+ + ID+ LY + ++DE  Q LT  +W    W D  + WDP +Y+ I+QI  P ++IW PD+ I + +  G   +  +V+      ++Y+G +     L + + C ++I  FPFD Q C +TF++W       N+T+    +E      +  + GEW +     S   +  H    E++   FSE+   + ++R+P F    L+ P   L+ V    F LP  SGE+V    T+LL   VFL+++ D +P T    PLIA +F  C+ L+ + ++ T+ ++ L H+   Q  +P   +K+L S  +   C
Sbjct:   38 LSSRLSSGYDKGVRPVKNWRQPIIVAIDVMLYAILNVDEKNQVLTAYIWYRQRWTDEFLQWDPVQYDGIEQISIPTNNIWVPDIMISEFVDVGKSPDIGYVY------LSYNGTVMNYKPLQVVSACSLDIYSFPFDVQNCTLTFTSWLHTSNDINLTLWRTTEEIKEDKSIFLNFGEWELI----SVPNELLHPLYGENR---FSELKIYVVIRRRPLFYVVNLIMPSAFLM-VMDAGFYLPPDSGERVSFKITLLLGYSVFLIVVQDTLPATPIGTPLIAVYFVVCMALLVISLMETIFIVRLVHKQDVQSHVPPWLKKWLLSRGSVILC 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 137.117 bits (344), Expect = 6.003e-35
Identity = 87/276 (31.52%), Postives = 145/276 (52.54%), Query Frame = 1
Query:  346 QLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS 1173
             L D DE  Q +T +VW+   W D  + WDP EY N+  I  P+  IW PD+ +Y    G++     V   +K  + + G ++     + K+ C +++  FPFD Q C + F +W  D    ++    + D D    +    +GEW +   V + + K +     +   + + ++T++  ++R P F    L+ PCLL+  +  + F LP   GEK+ L  ++LLSL VFLL+I++ +P TS  IPLI ++    +  V+L ++ TV VLN+ HRS
Sbjct:    9 HLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFA----VTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMAR-DVDLKDYW---ESGEWAIVHAVGTYNTKKY-----DCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRS 271          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO45564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH5])

HSP 1 Score: 162.155 bits (409), Expect = 2.382e-45
Identity = 96/315 (30.48%), Postives = 176/315 (55.87%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPV 1194
            L+  +F+ Y   A P+   ++ + + +D+   QL DLD   Q L+  VWI   W++  +SW+P +Y  ++ I   ++ +W PD+ +Y  +       M+ F ++KV I+ DG     A   +K+ C+++I  FPFD+Q CPI F +W       N+       + S ++     +GEW +       ++  +           + +VT+T++++RK  F    L+ PC++L  +   +F+LP +SGE++ L+ TILL L VF+L+ ++ VP TS+ IPLIAK+ F+ +  V++ ++ T +V+ + H++S +PLP+
Sbjct:    5 LITTLFKDYQRDARPVYNKSEAVRVSLDIAYSQLIDLDGKNQILSSKVWIRQVWRNPFLSWNPDDYGGLESINVNSNLVWKPDIILYNNIGIGQTGAMYNF-DTKVVIDSDGTNSWYAPTEIKSICQIDITYFPFDAQSCPIIFGSWTYTGNYLNLVNARNQSDLSKYTI----SGEWELKSAPVVRNVVKYSCCKHP-----YIDVTYTINIRRKVLFYLNNLILPCMVLAILTVCSFLLPPASGERISLVITILLGLTVFMLVFTESVPRTSEVIPLIAKYSFAVMCEVAVSLLLTCVVMRIYHKNSPMPLPM 309          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO46927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI2])

HSP 1 Score: 164.081 bits (414), Expect = 1.309e-44
Identity = 102/322 (31.68%), Postives = 173/322 (53.73%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLY 1215
            LL+ +F+ YN  A P+   ++ + +  DM   QL +L+   Q L   VW    W +  ++WDPK Y  +  I    + IW PD+ +Y  + G  E G     +++  I ++G  +  A   + + C ++I  FPFD Q C + F +W+   R  N+T K     DS      + +GEW++  + A  ++  +    D      F ++TFT+H++RK  F  T L+ PC++L  +   +F LP+ SGE++GL+ TI L L VF+L+ ++ VP TS+ IPLI K+ FS + +VS  +I T  +L + ++   I +   F+K ++
Sbjct:   30 LLNDLFKDYNKEARPVLNKSEAIEVQFDMAYAQLINLNSKDQILQSKVWFRQRWVNPFLTWDPKMYGGLTSINVNPNMIWKPDIVLYHNI-GFGETGAIYKFDTRATIMHNGYTEWFAPTEIHSICAIDITYFPFDEQFCKMKFGSWSYSGRQLNLTSKG----DSADLSKYTKSGEWDLLGMRAVRNVVKYSCCPDP-----FIDITFTMHIRRKVLFYLTNLIAPCIVLATLTVFSFQLPLESGERIGLVITIWLGLTVFMLVFTENVPRTSEVIPLIGKYSFSVMCVVSCSLIVTCCILKVFNKDPNIKMSSWFKKLIF 341          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO49045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV9])

HSP 1 Score: 152.525 bits (384), Expect = 8.701e-42
Identity = 88/306 (28.76%), Postives = 160/306 (52.29%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSH 1167
            LL+ +         PI    +P ++ +D+    + D+DE  Q L+  VWI  +W   ++SWDP EY  + QIV  +  +W PD  +Y  +   ++  +     ++V++   G +      + KT C++++  FPFDSQ CPITF AW  D    N+     +   +  +     NGEW V K+     +  +    ++     + E++F +H++R+  F    LV P  L+  +A  +F +PV  GE++  + T+LLS+ VFLL++++ +P TS+++P+I  ++  CI  V L ++ T I   +++
Sbjct:   15 LLERLINASGSGVRPILDLARPTNVTLDITFNSIIDVDEKHQILSSSVWIRQSWIAETLSWDPAEYGGVNQIVVSSQLLWQPDTVLYNNIFEEFDSRLDT-TVTRVRVYSSGFVYWAMPYVFKTMCKIDVTDFPFDSQRCPITFGAWQYDQNEVNLI---NNKRLATVASTRVENGEWTVEKVAIERRVIFYQCCPNQP----YPEISFVIHMQRRSLFYVVNLVLPNFLITLLAFFSFFIPVECGERMSFVITVLLSMTVFLLLVAESIPPTSEAVPVIGVYYTFCIVEVFLALVATGISFRINY 312          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO37424 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFW9])

HSP 1 Score: 149.443 bits (376), Expect = 5.588e-41
Identity = 85/306 (27.78%), Postives = 163/306 (53.27%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSH 1167
            L+  I + Y+    P+      +++  D+    + D++E +Q LT+ +W+   W +   +WDP+EY  +K++V  A D+W PD+ +YQ +  ++ +G      ++V+I   G+       ++ T C + ++ FPFD+Q C +TF +W  D    N+    K    +  +     NGEW +  +     +  +     +     + EV F +++KRK  F    L+ P +L+  +A  +F +PV  GE++  + T+LLS+ VF+L+++D +P TS+++PLI  F+ + +  V L +I T I L +++
Sbjct:    3 LVRDILKNYDKRVRPVRNSKDAVNVTFDITFNNIIDVEEKRQILTISLWLRQTWLNQLTTWDPEEYGGVKEVVLQARDVWQPDIILYQNIIQDF-DGRLDHTNTRVRITSSGMTYWSMPFVVVTLCTINVSDFPFDTQQCKLTFGSWQHDGNEINLINDRKQ---ALLAKTRVKNGEWQIQNITVDRRVVYYQCCPGQP----YPEVGFIVNMKRKSLFYFVNLLLPNILICLLAFFSFFIPVECGERISFVITVLLSMTVFMLLVADSIPPTSEAVPLIGIFYSASMIEVFLALIATGISLKINY 300          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 146.362 bits (368), Expect = 5.914e-40
Identity = 89/294 (30.27%), Postives = 164/294 (55.78%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSG-HSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSL 1128
            LL  +F  YNP   P+ K    + + + + L+Q+ DLDE  Q L  ++W+   W +  ++WDP  + N+  I      +W PDL +Y     + +  +  F  +KV++ +DG     A ++ K+ C+ ++A FPFD Q C + F +W  D    N+   P++  D G   FV  SNGEW +T + A+ ++  +     +  +E + +VTFTL ++R   F    ++ PC L+  +  +++ILP  SGE++ L+ T LL+  V+LL++S+ +P  ++ +PLI+ ++ + + +V++
Sbjct:    5 LLKDLFSNYNPSVRPVLKATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFY-TKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNIV--PENGTDIGIDKFV--SNGEWELTGVSANRNVMFY-----DCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIYYTTAMFMVTV 288          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:101162690])

HSP 1 Score: 160.614 bits (405), Expect = 5.297e-43
Identity = 121/462 (26.19%), Postives = 205/462 (44.37%), Query Frame = 1
Query:  202 GSYGGPKR--TNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVL------FKNSTNATTEISPTWTDGDGNQIDNKQ----------------------------------WDQLGQLLDRVFLVIYLILCSFLSLYILT 1455
             +   PKR  +   + + LL ++F+GY     PI +PN  + +   + + QL D+DE  Q +T +VW+   W D  + W+P +Y  I  I  P+ +IW PD+ +Y+   G +E  +     +K  + ++G +        K+ C +++  FPFD Q C + F +W  D  + ++ +      D    F    NGEW +     +        G  +  L  +  +T +  LKR P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+L +I TV V+N+ HRSS    P+    +        +  C    + H     Y  L       K+ +     I    + G  +  D K+                                  W  + Q+LDR+FL I+L +    ++ I T
Sbjct:   19 AAITAPKRFVSLAEMEDDLLKNLFQGYQRWVRPIQRPNDTVRVRFGLKISQLVDVDEKNQLMTTNVWLRQEWIDYKLRWNPDKYGGITSIRVPSENIWLPDIVLYENADGKFEGSLM----TKAIVKFNGAVTWMPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVDLVLMDSQ-VDRKDFF---DNGEWEILSATGAK-------GNRKDGLYFYPFITCSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQKLPRLLCM---RGHADRYHYPELAPESPALKSRSGGRRGIQRMSSGGQQSTYDGKEEEAYSTMLEKAIYSVRYISRHIRKDHFIREVVQDWKFVAQVLDRIFLWIFLSVSVLGTILIFT 462          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101158195])

HSP 1 Score: 160.999 bits (406), Expect = 3.946e-42
Identity = 103/316 (32.59%), Postives = 167/316 (52.85%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNS----SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQ 1179
            E LL ++F  YN L+ P+   +  + +   + + QL D+DE  Q +T +VW+   W D  + W+P++Y N+  I  P+  IW PD+ +Y    G++     V   +K  + YDG I+     + K+ C +++  FPFD Q C + F +W  D        + K D  S  S V+      +GEW +   V   + K +   A     E ++++T+   ++R P F    L+ PCLL+  +  + F LP   GEK+ L  ++LLSL VFLL+I++ +P TS  IPLI ++    +  V+L +I T+ VLN+ HRS Q
Sbjct:   46 ERLLQNLFARYNKLSRPVQNTSDTVLVHFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPEDYENVTSIRIPSEIIWRPDIVLYNNADGDFA----VTHLTKAHLFYDGQIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYD--------RAKIDLISMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCA-----EIYADITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMVFVTLSIIITIFVLNVHHRSPQ 344          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrna10a (neuronal acetylcholine receptor subunit alpha-9-like [Source:NCBI gene;Acc:101158786])

HSP 1 Score: 157.147 bits (396), Expect = 4.288e-42
Identity = 114/431 (26.45%), Postives = 212/431 (49.19%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI-PLPVCFQKFLYSSAAQFFCFSFT----------KQHKQFTDY-----QVLFKNSTNAT------------TEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYIL 1452
            + LL  +   Y    IP+   N  L++ + + L Q+ D+DE  Q LT  +WI   W D  + W+ ++++ +  I  P   +W PD+ +Y      +   M    ++ V I +DG +   +  + K+ C+V+++ FPFD+Q C  T+ +W  +    ++    ++  +S        N EW V  + A  +I  +   AD      + +VTFTL LKR+  F    L+ PC+++ ++A + F LP  SGEKV L  T++L+L VF L++++ +P  S+++PLI K++ + + +++     T+ ++N+ H      P+P   +K +    A+  CF +           ++H++  D        + KN TN                I+  + D    Q    +W ++ ++LDR F+ ++ IL  F+SL I+
Sbjct:   22 KKLLTDLMSNYTKALIPVEDTNIILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWFDAHLKWNKEDFDGLDTIRIPGSYVWRPDIVLYNSADDRFTGPM----DTNVVIRHDGQMMWDSPYITKSSCKVDVSFFPFDAQQCRFTYGSWTYNGNQLDI----QNAMESADLADLVENVEWEVLGMPAKKNIVLYGCCADP-----YPDVTFTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMP-PSENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPDAKPVPKWAKKVILQYMAR-VCFVYEVGENCMMSQPEKHEEDLDQLTSLSSSVRKNQTNNCPWQSGHLLLRDIEYIANYYRDQRATQKRTGEWKKVAKVLDRFFMWMFFILVFFMSLLIM 437          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrnb3a (neuronal acetylcholine receptor subunit non-alpha-3 [Source:NCBI gene;Acc:101168098])

HSP 1 Score: 157.147 bits (396), Expect = 8.665e-42
Identity = 100/349 (28.65%), Postives = 169/349 (48.42%), Query Frame = 1
Query:  244 EPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI--PLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQV 1284
            + LL ++F+GY     P+   N  + +   + + QL D+DE  Q +T +VW+   W D  + W+P +Y  I  I  P+  IW PD+ +Y+   G +E  +     +K  + +DG I        K+ C +++  FPFD Q C + F +W  D  + ++ +   H  D    F    NGEW +              G+   ++  +  +T++  LKR P F   +L+ PCL L ++  + F LP   GEK+ L +++L+SL VFLL+I + +P +S  IPLI ++    +  V+  +I TV V+N+ HRSS    P+    +        +  C         F D ++
Sbjct:   35 DSLLRNLFKGYQKWVRPVQHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDVKLKWNPDDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLM----TKAIVRWDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGNMVDLVLV-DHYVDRKDFF---DNGEWEILNATGQR-------GSRRDEMYWYPFLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQKLPRLLCMRGHTDRYHFPDIEM 368          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrnb5b (neuronal acetylcholine receptor subunit beta-2-like [Source:NCBI gene;Acc:101163178])

HSP 1 Score: 154.451 bits (389), Expect = 1.307e-40
Identity = 102/314 (32.48%), Postives = 167/314 (53.18%), Query Frame = 1
Query:  238 IYEPLLDHIF--EGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS 1173
            + E L++H+   E YN L  P    ++ + + I + L QL +++E +Q +T + W+   W D  + WDP EY+ IK+I  P+  IW PD+ +Y    G YE   +    S   ++ +G +      + K+ C++E+  FPFD Q C + F +W  D    ++ +    D  S   F  S  GEW++  L             D + +  + ++T+   +KRKP F    L+ PC+L+  +A + F LP   GEK+ L  ++LL+L VFLL+IS  VP TS ++PLI K+    + LV+  ++ +V VLN+ HRS
Sbjct:   24 VEERLVNHLLSPERYNKLIRPAVNNSQQVTIYIQVSLAQLINVNEREQIMTTNCWLTQGWNDYRLMWDPDEYDGIKKIRLPSQHIWLPDIVLYNNADGTYEVSFY----SNAVVSNNGEVAWLPPAIYKSACKIEVRDFPFDQQNCTLKFRSWTYDHTEIDLIL--LSDYASRDDFKPS--GEWDIVSLPGRK-------NEDPNDIR-YLDITYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFAMVLVTFSIVTSVCVLNVHHRS 321          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000027550.1 (SMESG000027550.1)

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 456/457 (99.78%), Postives = 457/457 (100.00%), Query Frame = 1
Query:   91 MKFLAIQWKXXXXXXXXXXXXYHTNAGGGGGSRYVNTGSYGGPKRTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLSLYILTAK 1461
            MKFLAIQWKVIFIVQIILVLIYHTNAGGGGGSRYVNTGSYGGPKRTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGLISTILLSLFVFLLIISDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLG+LLDRVFLVIYLILCSFLSLYILTAK
Sbjct:    1 MKFLAIQWKVIFIVQIILVLIYHTNAGGGGGSRYVNTGSYGGPKRTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGLISTILLSLFVFLLIISDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDNKQWDQLGKLLDRVFLVIYLILCSFLSLYILTAK 457          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000045280.1 (SMESG000045280.1)

HSP 1 Score: 380.948 bits (977), Expect = 1.364e-127
Identity = 196/415 (47.23%), Postives = 281/415 (67.71%), Query Frame = 1
Query:  223 RTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADES-QLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLFKNSTNATTEISPTWTDGDGNQIDN-KQWDQLGQLLDRVFLVIYLILCSFLSLYILTAK 1461
            +T+ SIY PL+D++ +GYNPLA+P+C      H+ +D+WLYQLFDLDEP Q LT+DVW++++W DC ++WDP ++N + QI  PA +I+HPDL  YQ LHGN+EEGMF+F +S  +I  +G++QLGAQ LLK+FCRV+I  FP+D+Q C +TF++WN+D  +FN+T K   D   GHSF N+SNGEW V +  A +++  + +G+DES     ++EVTF L L+RKP F+K YL+FPC+LL+W++A+TFILP+ SGEKV L  TILLS+ VFLL++S+ +P TSD IP +  FF   IGLV L ++ T IVLN+  +S  + +P   ++ L S   +F C      HK    ++    NS +          D + N  +    W +L  LLDRVFL++YLIL   ++LYI   +
Sbjct:   35 KTHKSIYLPLIDYLKQGYNPLAVPVCDNKTKFHVFMDIWLYQLFDLDEPTQMLTIDVWMEMSWFDCMLTWDPHDFNGLDQITLPAGEIYHPDLIWYQSLHGNFEEGMFLFPQSVARIRSNGMVQLGAQALLKSFCRVDIRLFPYDTQRCNLTFASWNRDASIFNITKKDAGDS-KGHSFKNASNGEWEVVEFPAYNTLSKYKLGSDESGNGSYYAEVTFQLTLQRKPTFIKVYLIFPCVLLVWISALTFILPIESGEKVNLSVTILLSVIVFLLLVSENIPRTSDGIPTLGMFFCMSIGLVCLSVLMTAIVLNVGEKSKDVKMPKFLKRILNS---RFLCL----HHKTHNKFRSGSANSKD---------NDNEENICEKLTYWRRLATLLDRVFLIVYLILAILITLYIFVQE 432          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000002905.1 (SMESG000002905.1)

HSP 1 Score: 164.081 bits (414), Expect = 4.630e-44
Identity = 105/333 (31.53%), Postives = 176/333 (52.85%), Query Frame = 1
Query:  250 LLDHIFE-----GYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSS------NGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSS-QIPLPVCFQKFL 1212
            LL H+F+      +N L  P     K L + I ++L Q+ D+DE  Q L  +VWIDL W D    WDP  YNNI  +V PA+ +W PD+ +Y      ++        + + + YDG +      + K+ C++ I  +PFD+Q C + F +W  +  + ++     +      +F   +      NGEW+V    A  S+  +         E + ++++ L +KR+  +    L+ PC+++  +A + F++P  +GEK+ L  TILLSL VFL+++++ +P TS +IPLI  +F   + + SL ++FTV+VLN  HRSS  I +P    K +
Sbjct:   26 LLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATF----PANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCP-----ETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGVTILLSLTVFLMMVAEKMPPTSKAIPLIGMYFTCVMIVCSLSLVFTVLVLNFHHRSSDSIDVPESLHKVV 349          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000028455.1 (SMESG000028455.1)

HSP 1 Score: 157.147 bits (396), Expect = 3.486e-41
Identity = 100/340 (29.41%), Postives = 175/340 (51.47%), Query Frame = 1
Query:  250 LLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRS-SQIPLPVCFQKFLYSSAAQFFCF-SFTKQHK 1263
            L   + + Y P   P+   +KP+   + + L Q+FD+DE  Q L  +VW+D  W D  + W+  E+ +I ++  P+  IW PD+ +Y     ++ + M     +   +  DG +       LK+ C++++  FPFDSQ+C + F +W  D     +      D D     +   NGEW + K     +   +         E + +VTF L+L+R+  +   ++++PC+++  +  + F LP  SGEK+ L  T+LL+  V +L I++ +P TS+S+PLI+ +  + + + S+ +I TV VLNL HR  ++ P+P   Q+ +      F C  S TK  K
Sbjct:   45 LFKKLMKDYEPSVRPVRNSSKPVIAKMGITLTQIFDMDEKNQVLVTNVWLDQQWYDEYLQWNTSEFPSISKLRIPSEKIWKPDIVLYNN-AADFADKMM---PALAMVKNDGEVFWPVPTKLKSSCKIDVTYFPFDSQICTLKFGSWTYDGFQVELDKLKGVDLD-----MYVENGEWKLKKTKVLRNNIVYTCCP-----EPYYDVTFVLYLERRILYFIYHVIYPCIMMSTLTLLVFCLPPDSGEKIALGITVLLAFSVLMLSIAEKLPETSESVPLISIYLTTVMSMTSVSVIMTVFVLNLHHRGPNKSPIPKWMQRLMICKNRYFSCKGSLTKNRK 370          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000015383.1 (SMESG000015383.1)

HSP 1 Score: 152.91 bits (385), Expect = 3.154e-40
Identity = 120/455 (26.37%), Postives = 214/455 (47.03%), Query Frame = 1
Query:  223 RTNVSIYEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLDVWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEGMFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAWNKD-----LRVFNMTMKPKHDEDSGHSFVNS--------SNGEWNVTKLVASDSIKAFHVGADESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGEKVGXXXXXXXXXXXXXXXXXDYVPHTSDSIPLIAKFFFSCIGLVSLGMIFTVIVLNLSHRSSQI----------------PL-----PVCFQK------FLY--------SSAAQFFCFSFTKQHKQ---FTDYQVLFK-NSTNATTE-ISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILC 1428
            ++ V +Y+ LLD     YN L  P+ +    +     + L QL DL+   Q+LT +VW+   W+D ++ W+P++Y  ++ +  P++ IW PD+ +Y    G YE  +     +K K+ +DG ++     + ++ C + +  FP+D Q C +TF++W  +     L+ +     P     SG   +N         ++ E+++ +L A   I+ F     + + E F EVTF + ++RK  F    L+ PCL + +++ + F LP  SGEK+                + + +P TS  IPLI K+    I L+SL +I TVIVLN++ RS+                  P+     P+  +K      F+Y        +S ++    +F ++ K+     D  +  K N T A  + +     D D      ++W  +  ++DRVFL+++L  C
Sbjct:   26 KSAVQLYQKLLDE--NNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNTADGKYEVKLM----TKAKVFHDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQF-----QGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEKIS---------------LIETIPSTSLVIPLIGKYLLFTIILISLSIIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSERCFMYCNKTMFKEASVSKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSAC 454          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA103.426e-4526.64cholinergic receptor nicotinic alpha 10 subunit [S... [more]
CHRNB33.550e-4226.33cholinergic receptor nicotinic beta 3 subunit [Sou... [more]
CHRNA76.200e-4231.45cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA76.758e-4232.03cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.16.758e-4232.03cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-92.699e-4233.12AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-195.948e-4231.69AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-198.819e-4231.69AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-118.691e-4130.57AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-162.389e-3929.68Acetylcholine receptor subunit alpha-type acr-16 ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha41.593e-4131.45gene:FBgn0266347 transcript:FBtr0332872[more]
nAChRalpha42.377e-4131.45gene:FBgn0266347 transcript:FBtr0300118[more]
nAChRalpha39.946e-4031.76gene:FBgn0015519 transcript:FBtr0339652[more]
nAChRalpha39.946e-4031.76gene:FBgn0015519 transcript:FBtr0289988[more]
nAChRbeta21.359e-3930.91gene:FBgn0004118 transcript:FBtr0084681[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b1.741e-4527.48cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna4b1.289e-4232.91cholinergic receptor, nicotinic, alpha 4b [Source:... [more]
chrnb3a1.807e-4228.37cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3a2.105e-4228.37cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb42.190e-4133.33cholinergic receptor, nicotinic, beta 4 (neuronal)... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021532.14.093e-4132.35cholinergic receptor, nicotinic alpha 7 [Source:NC... [more]
HTR3A6.734e-4127.685-hydroxytryptamine (serotonin) receptor 3A, ionot... [more]
HTR3A1.384e-4027.455-hydroxytryptamine (serotonin) receptor 3A, ionot... [more]
arid21.414e-4025.75AT-rich interaction domain 2 [Source:Xenbase;Acc:X... [more]
arid21.697e-4025.75AT-rich interaction domain 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna107.401e-4526.82cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna47.975e-4433.23cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna48.353e-4433.23cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna77.630e-4231.70cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrnb35.006e-4128.03cholinergic receptor, nicotinic, beta polypeptide ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P43679|ACHB3_CHICK2.224e-4728.18Neuronal acetylcholine receptor subunit beta-3 OS=... [more]
sp|Q9GZZ6|ACH10_HUMAN1.645e-4426.64Neuronal acetylcholine receptor subunit alpha-10 O... [more]
sp|Q9JLB5|ACH10_RAT2.303e-4426.82Neuronal acetylcholine receptor subunit alpha-10 O... [more]
sp|P09482|ACHA4_CHICK1.380e-4333.44Neuronal acetylcholine receptor subunit alpha-4 OS... [more]
sp|P13908|ACHN2_CARAU2.915e-4326.35Neuronal acetylcholine receptor subunit non-alpha-... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DIL72.832e-10344.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DU953.437e-10344.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GZR64.499e-10344.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JJQ21.132e-9941.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J0041.167e-9941.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3a1.638e-4426.26cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3b1.944e-4427.78neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb3b2.711e-4427.78neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb3a2.822e-4426.26cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3b4.823e-4427.88neuronal acetylcholine receptor subunit non-alpha-... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b3.277e-4229.97cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna31.167e-3628.57cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb1l9.069e-3630.60cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
htr3a3.967e-3529.225-hydroxytryptamine (serotonin) receptor 3A [Sourc... [more]
chrna2a6.003e-3531.52cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455642.382e-4530.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469271.309e-4431.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490458.701e-4228.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374245.588e-4127.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436425.914e-4030.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b5.297e-4326.19neuronal acetylcholine receptor subunit non-alpha-... [more]
chrna4b3.946e-4232.59neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna10a4.288e-4226.45neuronal acetylcholine receptor subunit alpha-9-li... [more]
chrnb3a8.665e-4228.65neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb5b1.307e-4032.48neuronal acetylcholine receptor subunit beta-2-lik... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027550.10.000e+099.78SMESG000027550.1[more]
SMESG000045280.11.364e-12747.23SMESG000045280.1[more]
SMESG000002905.14.630e-4431.53SMESG000002905.1[more]
SMESG000028455.13.486e-4129.41SMESG000028455.1[more]
SMESG000015383.13.154e-4026.37SMESG000015383.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000621 ID=SMED30000621|Name=Neuronal acetylcholine receptor subunit alpha-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1635bp
TGACTACAATGCAATATTGTTACTATAAATTATGAAGGCAGCCAATCGTT
GTTTAGTAAATTTAGCATTGAATTTCAGTGTGACATTAAAATGAAATTTC
TAGCTATTCAATGGAAAGTTATCTTTATTGTCCAGATTATATTGGTTTTA
ATTTATCATACTAATGCCGGTGGTGGTGGTGGCAGTAGATATGTTAATAC
TGGTTCTTATGGTGGTCCTAAACGGACCAACGTGAGCATATATGAACCTT
TACTTGATCACATTTTTGAAGGATATAATCCACTAGCAATCCCAATTTGC
AAACCAAACAAACCACTTCACATGATGATTGACATGTGGCTCTATCAATT
ATTTGATCTTGACGAACCGAAACAAGAACTTACTTTAGATGTGTGGATAG
ATTTGAATTGGAAAGACTGTTCTATTTCTTGGGACCCAAAAGAATATAAT
AACATAAAACAGATCGTTGCTCCTGCACATGACATTTGGCACCCAGATCT
ATTTATTTATCAAGGTCTCCATGGAAATTATGAAGAAGGAATGTTCGTAT
TTCGTGAATCGAAAGTCAAAATCAATTATGATGGTGTGATTCAATTAGGT
GCTCAATTATTATTAAAAACGTTTTGTCGTGTAGAAATTGCTAAATTTCC
TTTTGATTCTCAGGTATGTCCAATAACATTTTCCGCGTGGAATAAGGATC
TGCGGGTATTCAACATGACAATGAAGCCAAAACATGATGAAGATTCTGGA
CACAGTTTTGTAAATTCAAGCAATGGTGAATGGAATGTTACAAAACTTGT
TGCTTCGGATTCAATCAAAGCATTTCATGTCGGTGCCGATGAATCTCAGT
TGGAAAATTTCTCCGAAGTGACATTCACTCTGCATTTGAAACGGAAACCG
GGATTCATGAAGACATATTTAGTTTTTCCGTGTCTCCTTCTGATATGGGT
TGCCGCTATTACGTTCATATTGCCAGTGAGTTCAGGTGAAAAGGTTGGGT
TAATTAGCACGATACTGTTGTCTTTATTTGTGTTTCTCCTCATTATCTCT
GATTACGTTCCTCACACTTCTGATAGTATCCCTTTGATTGCTAAGTTTTT
TTTCAGTTGTATTGGTCTGGTATCTTTAGGAATGATTTTTACAGTCATTG
TTCTCAACCTCAGTCATAGGTCCTCACAAATCCCATTACCTGTTTGTTTT
CAAAAGTTTCTCTATTCGAGTGCTGCGCAATTCTTTTGCTTTTCTTTCAC
GAAACAGCACAAGCAGTTCACAGATTATCAAGTATTGTTCAAAAACTCTA
CGAATGCTACAACGGAGATCAGTCCGACTTGGACTGACGGAGATGGCAAC
CAAATTGATAACAAACAATGGGACCAATTGGGACAATTGCTAGATCGCGT
ATTCCTCGTCATCTATCTGATTCTGTGCTCCTTCTTGAGCTTGTACATTC
TCACAGCTAAATGATCTAGGCGATTGGTGATGACAAAAGCGATTATTTCA
ACTGGGGACAAATCCAATTCGGATTTATTTGTTTGCTAAGTATGCTTGAA
TGTGCTAATGAAATTTGATTATTATTTATATTTATTTTGATTTCGATTTC
GATTTCGAGCCGTTTTATATCAATGAGGTTGATTG
back to top

protein sequence of SMED30000621-orf-1

>SMED30000621-orf-1 ID=SMED30000621-orf-1|Name=SMED30000621-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MKFLAIQWKVIFIVQIILVLIYHTNAGGGGGSRYVNTGSYGGPKRTNVSI
YEPLLDHIFEGYNPLAIPICKPNKPLHMMIDMWLYQLFDLDEPKQELTLD
VWIDLNWKDCSISWDPKEYNNIKQIVAPAHDIWHPDLFIYQGLHGNYEEG
MFVFRESKVKINYDGVIQLGAQLLLKTFCRVEIAKFPFDSQVCPITFSAW
NKDLRVFNMTMKPKHDEDSGHSFVNSSNGEWNVTKLVASDSIKAFHVGAD
ESQLENFSEVTFTLHLKRKPGFMKTYLVFPCLLLIWVAAITFILPVSSGE
KVGLISTILLSLFVFLLIISDYVPHTSDSIPLIAKFFFSCIGLVSLGMIF
TVIVLNLSHRSSQIPLPVCFQKFLYSSAAQFFCFSFTKQHKQFTDYQVLF
KNSTNATTEISPTWTDGDGNQIDNKQWDQLGQLLDRVFLVIYLILCSFLS
LYILTAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0005216ion channel activity
GO:0005515protein binding
GO:0015464acetylcholine receptor activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0006810transport
GO:0006811ion transport
GO:0098655cation transmembrane transport
GO:0001508action potential
GO:0001666response to hypoxia
GO:0006281DNA repair
GO:0006816calcium ion transport
GO:0006979response to oxidative stress
GO:0007165signal transduction
GO:0007271synaptic transmission, cholinergic
GO:0007274neuromuscular synaptic transmission
GO:0007585respiratory gaseous exchange
GO:0007626locomotory behavior
GO:0014059regulation of dopamine secretion
GO:0019233sensory perception of pain
GO:0035094response to nicotine
GO:0035095behavioral response to nicotine
GO:0035640exploration behavior
GO:0042113B cell activation
GO:0042391regulation of membrane potential
GO:0050877neurological system process
GO:0050890cognition
GO:0051899membrane depolarization
GO:0060079excitatory postsynaptic potential
GO:0060080inhibitory postsynaptic potential
GO:0095500acetylcholine receptor signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0005892acetylcholine-gated channel complex
GO:0009897external side of plasma membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 131..142
score: 38.54
coord: 264..276
score: 28.4
coord: 98..114
score: 28.16
coord: 179..193
score: 43.56
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 93..447
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 53..270
e-value: 6.5E-44
score: 150.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 44..269
e-value: 2.7E-51
score: 176.1
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 53..270
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 277..363
e-value: 1.7E-18
score: 67.6
NoneNo IPR availablePANTHERPTHR18945:SF796NICOTINIC ACETYLCHOLINE RECEPTOR ALPHA6, ISOFORM Ecoord: 93..447
NoneNo IPR availableCDDcd18997LGIC_ECD_nAChRcoord: 80..269
e-value: 6.32727E-48
score: 160.734
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 276..370
e-value: 8.22372E-31
score: 112.841
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..26
score: 0.53
NoneNo IPR availableTMHMMTMhelixcoord: 302..319
NoneNo IPR availableTMHMMTMhelixcoord: 275..297
NoneNo IPR availableTMHMMTMhelixcoord: 437..456
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 364..386
NoneNo IPR availableTMHMMTMhelixcoord: 332..354
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 179..193
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 271..455