SMED30000612

Overview
NameSMED30000612
Smed IDSMED30000612
Length (bp)1356
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000612

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30000612h1SMcG0021949 Contig44648uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000612h1SMcG0021949 Contig44648newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000612h1SMcG0021947 Contig44648uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000612h1SMcG0021947 Contig44648newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000612h1SMcG0021948 Contig44648uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000612h1SMcG0021948 Contig44648newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000612 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009696:5163..6502 -6368
Homology
BLAST of SMED30000612 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 3.259e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  351 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 433          
BLAST of SMED30000612 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 3.391e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  434 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 516          
BLAST of SMED30000612 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 3.391e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  434 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 516          
BLAST of SMED30000612 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 3.712e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  409 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 491          
BLAST of SMED30000612 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 63.5438 bits (153), Expect = 3.712e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  409 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 491          
BLAST of SMED30000612 vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 59.6918 bits (143), Expect = 1.336e-9
Identity = 43/155 (27.74%), Postives = 83/155 (53.55%), Query Frame = -3
Query:  215 PNIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSA-------KLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKLV 658
            P I + VV     K    +  +SQPFY+   GY+M A        L F ++Y  ++V L++G++DD+L WPF+ ++ F++++  ++ E LTK +  +   P+   +  RP+   +  G +G  +F+ +          ++EF  +  I+I+IK++
Sbjct:  165 PKIGLTVVKATKNKSHRSI--YSQPFYSHGYGYKMMAVAAPYGDGLAF-REYFSVFVCLMKGEWDDILEWPFRCDVTFSILSD-DKKELLTKTIYVNEM-PEIQEFLERPEGLRN--GTFGFQNFLPLA--------KVTEFAADGDIFIQIKVL 304          
BLAST of SMED30000612 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 49.6766 bits (117), Expect = 2.963e-6
Identity = 38/157 (24.20%), Postives = 73/157 (46.50%), Query Frame = -3
Query:  218 IYVVDKFCEKLSE-----ELEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ---VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 646
            I+ +DK  ++ +E     +   +S PF +   GY+M A      D       I +YV L++G+FD  L WPF   I  +L++Q    E+  ++T ++ P     +E  +  RP+   +    +G   F  +          +  +V+++ IY++I +
Sbjct:  266 IWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANE-KFLARPRGERN--AAFGSQSFCSL--------AILQNYVKDDKIYVQIDV 411          
BLAST of SMED30000612 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 60.4622 bits (145), Expect = 1.633e-9
Identity = 43/169 (25.44%), Postives = 82/169 (48.52%), Query Frame = -3
Query:  218 AISKPNI-----YIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEET--ESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 670
            A+SK +I      ++ +  +  K++E      LE  S PFYTS  GY++ A +  N +      ++ +Y+K++ G++D LL WPF + I FTL  Q  ++    + +   P P     +  + RP      L G+G   FI    +      +   F++ + +++++K+
Sbjct:  321 AVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDP----TWENFQRPSNEPDQL-GFGFPRFISHELL------HSRPFIKGDTVFLRVKV 478          
BLAST of SMED30000612 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 60.4622 bits (145), Expect = 1.650e-9
Identity = 37/137 (27.01%), Postives = 68/137 (49.64%), Query Frame = -3
Query:  218 LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEET--ESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 604
            LE  S PFYTS  GY++ A +  N +      ++ +Y+K++ G++D LL WPF + I FTL  Q  ++    + +   P P     +  + RP      L G+G   FI    +      +   F++ + +++++K+
Sbjct:  344 LELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDP----TWENFQRPSNEPDQL-GFGFPRFISHELL------HSRPFIKGDTVFLRVKV 469          
BLAST of SMED30000612 vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 71.2478 bits (173), Expect = 1.732e-13
Identity = 41/131 (31.30%), Postives = 66/131 (50.38%), Query Frame = -3
Query:  218 SQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 592
            S PFYTS  GY++S +     D      ++ +Y+ ++ GDFD  L WPF+  I  TL++Q      ++    P   + D +    RP  TS      G + FI  C ++ P N   + FVR+  ++IK+K+
Sbjct:  132 SSPFYTSRSGYKLSVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLDQSGTRNHMSHTFIP-DVNSDSFH---RP--TSDANVATGFTRFISHCDLENPRN---AVFVRDETLFIKVKV 253          
BLAST of SMED30000612 vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 64.6994 bits (156), Expect = 1.010e-10
Identity = 29/83 (34.94%), Postives = 48/83 (57.83%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            +S+ L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q    + L    KP P
Sbjct:  439 VSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDP 521          
BLAST of SMED30000612 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 56.9954 bits (136), Expect = 2.373e-8
Identity = 40/170 (23.53%), Postives = 82/170 (48.24%), Query Frame = -3
Query:  218 AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG----GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 670
            ++S   + I+ +  +  KL E       E +S PFYT   GY++      N +      ++ IY++++ G++D+LL WPF  ++ F++++Q    + + + +T+   P P     +  + +P  + + L     G+G   FI    IK         ++R+N I++K  +
Sbjct:  303 SVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDP----NWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKK------RNYIRDNSIFLKASI 462          
BLAST of SMED30000612 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 56.9954 bits (136), Expect = 2.373e-8
Identity = 40/170 (23.53%), Postives = 82/170 (48.24%), Query Frame = -3
Query:  218 AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG----GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 670
            ++S   + I+ +  +  KL E       E +S PFYT   GY++      N +      ++ IY++++ G++D+LL WPF  ++ F++++Q    + + + +T+   P P     +  + +P  + + L     G+G   FI    IK         ++R+N I++K  +
Sbjct:  303 SVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDP----NWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKK------RNYIRDNSIFLKASI 462          
BLAST of SMED30000612 vs. Ensembl Zebrafish
Match: traf4b (tnf receptor-associated factor 4b [Source:ZFIN;Acc:ZDB-GENE-040305-2])

HSP 1 Score: 54.6842 bits (130), Expect = 1.276e-7
Identity = 40/175 (22.86%), Postives = 82/175 (46.86%), Query Frame = -3
Query:  218 SKPNIYIYVVDKFCEKLSEE-------LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVE----ETESLTKILKPHPC-------DPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISE--FVRNNIIYIKIKL 664
            S+    ++ +  F ++L E        LE +S  FY+ + GYR+      N +      ++ +Y++++ G++D LL WPF   ++F+L++Q +    + + +T+   P P         P   G  IR       + G+G   FI        S++ + +  ++R+N ++IK  +
Sbjct:  305 SRDGTLLWKLTDFSQRLQEAKTRTSGCLELFSPAFYSHNYGYRLQVSAFLNGNGSGEDTHMSVYLRVLPGEYDGLLEWPFPYRVSFSLLDQCDPALTKPQHITETFSPDPTWKNFQRPRPGALGS-IRGGCLDESMLGFGYPKFI--------SHEEMKKRNYIRDNAVFIKASI 470          
BLAST of SMED30000612 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 63.929 bits (154), Expect = 2.671e-10
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK +++  L++Q      L    KP P
Sbjct:  427 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDP 509          
BLAST of SMED30000612 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 63.5438 bits (153), Expect = 2.971e-10
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK +++  L++Q      L    KP P
Sbjct:  402 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDP 484          
BLAST of SMED30000612 vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 61.2326 bits (147), Expect = 1.509e-9
Identity = 39/170 (22.94%), Postives = 81/170 (47.65%), Query Frame = -3
Query:  218 AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG----GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 670
            ++S   + I+ +  +  K+ E       E +S PFYT   GY++      N +      Y+ +Y++++ G++D+LL WPF   + F+L++Q    + + + +T+   P P     +  + +P  + + L     G+G   FI    I+         +VR+N I+++  +
Sbjct:  303 SVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDP----NWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRK------RNYVRDNAIFLRASV 462          
BLAST of SMED30000612 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 59.3066 bits (142), Expect = 7.045e-9
Identity = 25/76 (32.89%), Postives = 44/76 (57.89%), Query Frame = -3
Query:  386 WSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 595
            +SQ FYTS  GYR+ A+   N D      ++ +Y  +++G+FD +L WPFK ++   L++Q  +   +T + +  P
Sbjct:  408 FSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADP 483          
BLAST of SMED30000612 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 58.9214 bits (141), Expect = 8.532e-9
Identity = 25/76 (32.89%), Postives = 44/76 (57.89%), Query Frame = -3
Query:  386 WSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 595
            +SQ FYTS  GYR+ A+   N D      ++ +Y  +++G+FD +L WPFK ++   L++Q  +   +T + +  P
Sbjct:  358 FSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADP 433          
BLAST of SMED30000612 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.929 bits (154), Expect = 2.225e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  433 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 515          
BLAST of SMED30000612 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.5438 bits (153), Expect = 2.659e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  408 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 490          
BLAST of SMED30000612 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.5438 bits (153), Expect = 2.659e-10
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  408 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 490          
BLAST of SMED30000612 vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 60.8474 bits (146), Expect = 4.809e-10
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = -3
Query:  218 WSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 595
            +SQPFYTS  GYR+ A+   N D      ++ +Y  ++ G+FD LL WPF+  +   L++Q  +   + +  K    DP+   +  RP    +     G   F+    ++   N YI    +++ +++K+ +
Sbjct:  121 FSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFK---ADPNSSSF-KRPDGEMNIAS--GCPRFVSHSTLENSKNTYI----KDDTLFLKVAV 242          
BLAST of SMED30000612 vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 60.8474 bits (146), Expect = 4.809e-10
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = -3
Query:  218 WSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 595
            +SQPFYTS  GYR+ A+   N D      ++ +Y  ++ G+FD LL WPF+  +   L++Q  +   + +  K    DP+   +  RP    +     G   F+    ++   N YI    +++ +++K+ +
Sbjct:  121 FSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFK---ADPNSSSF-KRPDGEMNIAS--GCPRFVSHSTLENSKNTYI----KDDTLFLKVAV 242          
BLAST of SMED30000612 vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 1.557e-9
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  433 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 515          
BLAST of SMED30000612 vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.628e-9
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = -3
Query:  386 LSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 616
            + + L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q      L    KP P
Sbjct:  434 MGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP 516          
BLAST of SMED30000612 vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 4.952e-9
Identity = 35/132 (26.52%), Postives = 65/132 (49.24%), Query Frame = -3
Query:  218 WSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 595
            +SQPFYTS  GYR+ A+   N D      ++ +Y  ++ G+FD LL WPF+  +   L++Q  +   + +  K    DP+   +  RP    +     G   F+    ++   N YI    +++ +++K+ +
Sbjct:  429 FSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKA---DPNSSSFK-RPDGEMNI--ASGCPRFVSHSTLENSKNTYI----KDDTLFLKVAV 550          
BLAST of SMED30000612 vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 1.471e-7
Identity = 35/132 (26.52%), Postives = 66/132 (50.00%), Query Frame = -3
Query:  218 WSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 595
            +SQ FYTS  GYR+ A+   N D      ++ +Y  ++ G+FD LL WPF+  +   L++Q    +++ +  KP   DP+   +  RP    +     G   F+    ++   N YI    +++ +++K+ +
Sbjct:  429 FSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIMETFKP---DPNSSSFK-RPDGEMNI--ASGCPRFVAHSVLENAKNAYI----KDDTLFLKVAV 549          
BLAST of SMED30000612 vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 3.010e-7
Identity = 45/184 (24.46%), Postives = 85/184 (46.20%), Query Frame = -3
Query:  218 NKFSTLREDFK--AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPD-----EYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 703
             +   LR + +  +I    + I+ +  +  +L E      LE +S  FYT   GY++      N +      ++ IY++++ G FD+LL WPF   + F+L++Q    + + + +T+   P   DP+     + G W R     S L G+G   FI    I+         +VR++ ++I+  +
Sbjct:  290 QELQELRRELEELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHP---DPNWKNFQKPGTW-RGSLDESSL-GFGYPKFISHQDIRK------RNYVRDDAVFIRASV 462          
BLAST of SMED30000612 vs. TrEMBL
Match: A0A183B927 (MATH domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS15712 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.175e-26
Identity = 59/161 (36.65%), Postives = 90/161 (55.90%), Query Frame = -3
Query:  215 NIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPK---------YTSSC-----LGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKLV 655
            N YI+ ++ +C   + E   WS+PFY    GYR  AK+ F   ++GI+++L+ G++DD L WPF+  I F LI+Q     +L++ILKP P D DE G W RP+          ++ C        WGL DF     + GP     +++VRN+ +Y+ I+LV
Sbjct:  266 NAYIWTINSYCAIEAAECGFWSEPFYLGEPGYRFRAKIEFTTFHMGIFIQLLPGEYDDSLQWPFRCSIQFVLIDQTMSGRNLSRILKPFPEDEDERGVWDRPRPDDWSSVMSESNRCTIVGKTDAWGLPDFAPRSLLGGPKPHGRNDYVRNDRMYVAIRLV 426          
BLAST of SMED30000612 vs. TrEMBL
Match: A0A504YL97 (TNF receptor-associated factor 4 OS=Fasciola gigantica OX=46835 GN=FGIG_08623 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 6.594e-26
Identity = 59/166 (35.54%), Postives = 92/166 (55.42%), Query Frame = -3
Query:  215 REDFKAIS-KPNIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCL--------GGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKLV 685
            +  F A+S + N+YI+ +  +C   S     WS  FY    GYR  AKL F+  ++GI+++L+ G++D LL WPF++ + F +I+Q     +L++ LKP P D DE G W RP    S L          WGL DF+  C +     +  S +VRN+ +Y+ I+L+
Sbjct:  250 QASFPAVSNQCNVYIWTITSYCAVESLGCCYWSPSFYLGTPGYRFRAKLEFSSYHMGIFIQLIPGEYDALLPWPFRHIVQFMVIDQTMNGRNLSRTLKPFPEDEDERGVWDRPHNAESELKETAYDKCDAWGLPDFVPRCALNNGGQNEPSNYVRNDRLYVAIRLI 415          
BLAST of SMED30000612 vs. TrEMBL
Match: A0A5J4NF12 (MATH domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0013629 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 4.184e-25
Identity = 59/152 (38.82%), Postives = 86/152 (56.58%), Query Frame = -3
Query:  215 NIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGG-----WGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKLV 655
            N+YI+VV  F    S+    WS  FY  + GYR+ AKL F   ++GI+++L  G+FD  L WPF   + F LI+Q    ++L + LKP+P D DE G W RP   ++ L       WGL DF+    +   +    S++VRN+ IYI I+L+
Sbjct:  175 NLYIFVVPNFSAIESKSCGLWSDAFYLGNPGYRLRAKLEFTTYHMGIFIQLTPGEFDARLKWPFCEHVQFVLIDQTSSGKNLARTLKPYPDDADERGVWDRPVDNTATLDHKDRETWGLPDFVPRSMLLTEARKS-SKYVRNDQIYIAIRLI 325          
BLAST of SMED30000612 vs. TrEMBL
Match: A0A4S2LX15 (MATH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005726 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.515e-23
Identity = 62/175 (35.43%), Postives = 93/175 (53.14%), Query Frame = -3
Query:  215 NKFSTLREDFKAISKPNIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRP---------KYTSSCLGGWGLSDFID---MCCIKGPSNDYISEFVRNNIIYIKIKLV 703
            NK +  RE  +  SK  +YI+ +  +    +E    WS  FY    GYR   KL F + ++GI+V+LV G+FD+ L WPF++ + F LI+Q     ++T+ LKP P D DE G W RP            ++ +  WG  DF+    +C   G + DY    VRN+ +YI I+L+
Sbjct:  263 NKGTAARE--QVASKCTLYIWTIPDYPVVEAEGCSYWSDSFYLGTPGYRFRTKLEFTKRFVGIFVQLVAGEFDEQLVWPFRDHMQFVLIDQSVSGRNITRTLKPFPEDEDEKGVWERPLEAREAEVQGTKTTEVSAWGFHDFVPRSMLCDCGGKTTDY----VRNDRMYIAIRLL 431          
BLAST of SMED30000612 vs. TrEMBL
Match: A0A0X3P2E9 (MATH domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR96332 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.590e-23
Identity = 57/150 (38.00%), Postives = 83/150 (55.33%), Query Frame = -3
Query:  218 NIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG--GWGLSD--FIDMCCIKGPSNDYISEFVRNNIIYIKIKL 655
            N +I+ VD F E   +   +W +PFY    GYRM AKL F+    G Y++L+ GD+D  L WPF  +I F++++Q      + ++L+P+PCD DE G W RP+    C    GWGL D     + C K       S ++RN  +YI+I L
Sbjct:  250 NWFIWRVDNFAEVEEKCCGDWCEPFYLGQPGYRMQAKLEFSTYMFGAYIRLICGDYDACLQWPFDRDIYFSILDQTGCANHIVRVLRPYPCDSDEKGIWDRPR-AGECEKQIGWGLPDLGLRSLFCTK---MGKPSAYLRNGTLYIQISL 395          
BLAST of SMED30000612 vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 69.707 bits (169), Expect = 2.174e-12
Identity = 39/131 (29.77%), Postives = 67/131 (51.15%), Query Frame = -3
Query:  218 SQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 592
            S PFYTSH GY++SA++    +      ++ +YV L+ GDFD LL WPF+  +   +++Q      ++    P     +    + RP  TS      G   FI    ++ P N   + +VR++ ++IK+K+
Sbjct:  421 SPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNN----FRRP--TSETNAALGFPRFITHADLEAPRN---AAYVRDDTLFIKVKV 542          
BLAST of SMED30000612 vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.192e-11
Identity = 29/82 (35.37%), Postives = 47/82 (57.32%), Query Frame = -3
Query:  386 SEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 613
            S+ L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q    + L    KP P
Sbjct:   23 SKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDP 104          
BLAST of SMED30000612 vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 60.8474 bits (146), Expect = 1.169e-9
Identity = 41/172 (23.84%), Postives = 86/172 (50.00%), Query Frame = -3
Query:  218 AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG----GWGLSDFIDMCCIKGPSNDYISE--FVRNNIIYIKIKL 670
            ++S   + I+ ++ +  KL E       E +S PFYT   GY++      N +      ++ IY++++ G++D+LL WPF  ++ F++++Q    + + + +T+   P P     +  + +P  + + L     G+G   FI        S+D I +  ++R+N I++K  +
Sbjct:  303 SVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDP----NWKNFQKPSSSRNSLDESTLGFGYPKFI--------SHDEIRKRNYIRDNAIFLKASI 462          
BLAST of SMED30000612 vs. Ensembl Cavefish
Match: traf4b (TNF receptor-associated factor 4-like [Source:NCBI gene;Acc:103043275])

HSP 1 Score: 55.4546 bits (132), Expect = 6.006e-8
Identity = 40/175 (22.86%), Postives = 79/175 (45.14%), Query Frame = -3
Query:  218 SKPNIYIYVVDKFCEKLSE-------ELEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHP-------CDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISE--FVRNNIIYIKIKL 664
            S+  + ++ +  +C +L E         E +S  FY+   GYR+      N +      Y+ IY++++ G++D LL WPF   + F+L++Q    + + + + +   P P         P   G  IR       + G+G   FI        S++ + +  ++R+N I+I+  +
Sbjct:  305 SQDGVLLWKIPDYCRRLQEARTRTTGSAELFSPAFYSHRHGYRLQVSAFLNGNGSGEGSYLSIYIRVLPGEYDGLLEWPFPYRVTFSLLDQSDPALSKPQHIVESFSPDPNWKNFQRPQPGAMGS-IRAGSLDESMLGFGYPKFI--------SHEQMRKRNYIRDNAIFIQASI 470          
BLAST of SMED30000612 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 54.299 bits (129), Expect = 1.497e-7
Identity = 41/172 (23.84%), Postives = 82/172 (47.67%), Query Frame = -3
Query:  227 KFSTLREDFKA---ISKPNIYIYVVDKFCEKLSEEL-----EEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIK 700
            + S+L++   A   +S    +++ +    +KL E        ++S  FYTS  G+++  +L    D +G      ++  +++GD+D LL+WPFK ++ F LI+Q  + E +    +P          + RP    +   G  L  F  +  ++ P + Y    V+++ ++IK
Sbjct:  374 QISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQ-NQREHVVDAFRPDL----RSASFQRPVSEMNVASGCPL--FFPLSKLRSPKHAY----VKDDTLFIK 534          
BLAST of SMED30000612 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.326e-12
Identity = 39/133 (29.32%), Postives = 65/133 (48.87%), Query Frame = -3
Query:  224 LEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKI 604
            L  +SQPFYTS  GYRM A+   N D +G      ++  ++ G++D LL WPF+  +  TL++Q      L+   KP P        + RP    +   G  L  F+    ++  S      +++++ I+IK+
Sbjct:  347 LSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSS----FRRPTSDMNIASGCPL--FVSHVALESAS------YLQDDTIFIKV 467          
BLAST of SMED30000612 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.276e-11
Identity = 35/133 (26.32%), Postives = 65/133 (48.87%), Query Frame = -3
Query:  224 LEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKI 604
            L  +SQPFYTS  GY+M A+   N D +G      ++  ++ G++D LL WPF+  +  +L++Q      L+    P P      G + RP    +   G  L  F+    ++G      S ++ ++ +++++
Sbjct:  290 LSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPAS----GSFRRPDGDMNVASGCPL--FVSHVALEG------SSYLVDDTVFVRV 410          
BLAST of SMED30000612 vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 70.0922 bits (170), Expect = 6.478e-13
Identity = 36/108 (33.33%), Postives = 61/108 (56.48%), Query Frame = -3
Query:  383 KAISKPNIYIYVVDKFCEKLSEELEE-----WSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPC 673
            +AIS    +++ +DKF E+ +E         +S PFYT   GY++ A+L  N D      Y+ I++ L+ G++D +L WPF+  I  TLI+Q +   ++++   P PC
Sbjct:  374 QAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQ-DNGMNISETFDPDPC 480          
BLAST of SMED30000612 vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 67.0106 bits (162), Expect = 4.679e-12
Identity = 43/136 (31.62%), Postives = 72/136 (52.94%), Query Frame = -3
Query:  227 EELEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYI--SEFVRNNIIYIK 610
            EEL  +S PFYTS  GY++  K   N        ++ +Y+ +++GD+D LL WPFK +I F LI+Q E+    T +L P+   P+    + RP    +   G G   F+         N+ +   E+V++++++IK
Sbjct:  274 EELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENL--GIGNPCFV--------PNEVLESGEYVKDDVMFIK 399          
BLAST of SMED30000612 vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 60.8474 bits (146), Expect = 9.260e-12
Identity = 29/69 (42.03%), Postives = 43/69 (62.32%), Query Frame = -3
Query:  422 EELEEWSQPFYTSHIGYRMSAKLGFNQ------DYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEE 610
            EEL  +S PFYTS  GY++  K   N        ++ +Y+ +++GD+D LL WPFK +I F LI+Q E+
Sbjct:   23 EELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEK 91          
BLAST of SMED30000612 vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 62.3882 bits (150), Expect = 1.125e-10
Identity = 40/131 (30.53%), Postives = 66/131 (50.38%), Query Frame = -3
Query:  218 SQPFYTSHIGYRMSAKL---GFNQD---YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 592
            S PFYT   GY++ A+    G  Q    ++ +YV +++GD+D +L WPF+  + F LI+Q ++  S         CD +   Y+ RP    S   G+G   F+    +K         FVR+N ++I I++
Sbjct:  256 SPPFYTGQYGYKLRAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQDDDFTSRQNKTWRLTCDRNS-DYFGRPNKAKSL--GFGCPKFVSQETLKS------RNFVRDNTVFIMIEV 377          
BLAST of SMED30000612 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 62.7734 bits (151), Expect = 1.330e-10
Identity = 41/128 (32.03%), Postives = 70/128 (54.69%), Query Frame = -3
Query:  227 SQPFYTSHIGYRMSAKL---GFNQD---YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIK 592
            S PFYTS  GY+M  K    G+      ++ + +++++G++D +L WPF+ +I  +LINQ E+  S T  + P    PD+   + RP    +   G G S FI    ++  S DYI    ++++I+I+
Sbjct:  365 SLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYPDDATPDKKHKFERPIENENV--GCGYSCFISH--MELNSGDYI----KDDVIFIE 484          
BLAST of SMED30000612 vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 65.855 bits (159), Expect = 3.516e-11
Identity = 36/131 (27.48%), Postives = 68/131 (51.91%), Query Frame = -3
Query:  218 SQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 592
            S PF+T   GY+M+ K   N D      ++ +YV L+ GDFD LL WPFK  ++ ++++Q       +   +P P +      + +P   S+     G   FI +  ++ P N   + +V+++ +++K+K+
Sbjct:  454 SVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQSFNFRPDPTNT----CFHQPAAESASNVAVGFPCFISLDALEAPGN---AVYVKDDTLFVKVKV 577          
BLAST of SMED30000612 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 63.1586 bits (152), Expect = 1.986e-10
Identity = 28/79 (35.44%), Postives = 45/79 (56.96%), Query Frame = -3
Query:  386 LEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 604
            L  +SQPFYT + GY+M A++  N D +G      ++  ++ G++D LL WPFK ++   L++Q    + L    KP P
Sbjct:  320 LSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDP 398          
BLAST of SMED30000612 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 60.4622 bits (145), Expect = 1.853e-9
Identity = 41/170 (24.12%), Postives = 83/170 (48.82%), Query Frame = -3
Query:  218 AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG----GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 670
            ++S   + I+ ++ +  KL E       E +S PFYT   GY++      N +      ++ +Y++++ G++D+LL WPF  ++ F++++Q    + + + +T+   P P     +  + +P  T + L     G+G   FI    IK         ++R+N I+IK  +
Sbjct:  303 SVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDP----NWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKK------RNYIRDNCIFIKASI 462          
BLAST of SMED30000612 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 60.077 bits (144), Expect = 1.998e-9
Identity = 41/170 (24.12%), Postives = 83/170 (48.82%), Query Frame = -3
Query:  218 AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG----GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 670
            ++S   + I+ ++ +  KL E       E +S PFYT   GY++      N +      ++ +Y++++ G++D+LL WPF  ++ F++++Q    + + + +T+   P P     +  + +P  T + L     G+G   FI    IK         ++R+N I+IK  +
Sbjct:  296 SVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDP----NWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKK------RNYIRDNCIFIKASI 455          
BLAST of SMED30000612 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 60.077 bits (144), Expect = 2.025e-9
Identity = 41/170 (24.12%), Postives = 83/170 (48.82%), Query Frame = -3
Query:  218 AISKPNIYIYVVDKFCEKLSEE-----LEEWSQPFYTSHIGYRMSAKLGFNQD------YIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQ----VEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG----GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 670
            ++S   + I+ ++ +  KL E       E +S PFYT   GY++      N +      ++ +Y++++ G++D+LL WPF  ++ F++++Q    + + + +T+   P P     +  + +P  T + L     G+G   FI    IK         ++R+N I+IK  +
Sbjct:  303 SVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDP----NWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKK------RNYIRDNCIFIKASI 462          
BLAST of SMED30000612 vs. Planmine SMEST
Match: SMESG000004982.1 (SMESG000004982.1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 310/343 (90.38%), Postives = 314/343 (91.55%), Query Frame = -3
Query:  182 MNKYENYPVLYKELCVKTEELFGFXXXXXXXXXXXIGLMKGITNPRRTFTGSSELTSAITNLACELKKSVASQRSIESNLNEVMLSIRTCHKGIQCSKEIPTLCDEDNNDNRTIPHITNISSSPSPNRMTPTKDITEILSIPEYDXXXXXXXXXXXXXXXXXXXXXXTPNKFSTLREDFKAISKPNIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKLVE*FYKIFEIFS 1210
            MNKYENYPVLYKELCVKTEELFGFIEEQKKIQLEIIGLMKGITNPRRTFTGSSELTSAITNLACELKKSVASQRSIESNLNEVMLSIRTCHKGIQCSKEIPTLCDEDNNDNRTIPHITNISSSPSPNRMTPTKDITEILSIPEYDKCITKSSSKSLKSKICRKKSCSTPNKFSTLREDFKAISKPNIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVE               AFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEF++       IK  +  +KI   FS
Sbjct:    1 MNKYENYPVLYKELCVKTEELFGFIEEQKKIQLEIIGLMKGITNPRRTFTGSSELTSAITNLACELKKSVASQRSIESNLNEVMLSIRTCHKGIQCSKEIPTLCDEDNNDNRTIPHITNISSSPSPNRMTPTKDITEILSIPEYDKCITKSSSKSLKSKICRKKSCSTPNKFSTLREDFKAISKPNIYIYVVDKFCEKLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVE---------------AFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFIKRKST---IKAGKNHHKISSFFS 325          
BLAST of SMED30000612 vs. Planmine SMEST
Match: SMESG000028762.1 (SMESG000028762.1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.876e-17
Identity = 52/158 (32.91%), Postives = 80/158 (50.63%), Query Frame = -3
Query:  212 SKPNIYIYVVDKFCEKLSEELEEW--SQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLT-----KILKPHPCDPDEYGYWIRPKYTSSCLGGWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKLVE 664
            S  N YI+ +      +  + +E   ++ F  S  GY+M+A+   +  Y+GIYV LV G +D LL WPF+N I  +L+NQ +   + T     K +K  PC       W +P   +    G GL     +   K   N Y SEF+RN+ IY+K +L++
Sbjct:   20 SDNNFYIWTISGVKTLIYNDFKEILNTKVFKLSPYGYKMAAQAKLDSGYLGIYVILVPGKYDKLLNWPFENPIQISLLNQSKPNANHTVTIDPKTMKDEPC-------WHKP-ILNVHQKGCGLKTAFPLSIFKKNQNGYPSEFLRNDQIYLKFELLK 169          
BLAST of SMED30000612 vs. Planmine SMEST
Match: SMESG000039089.1 (SMESG000039089.1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.145e-12
Identity = 37/109 (33.94%), Postives = 59/109 (54.13%), Query Frame = -3
Query:  386 DFKAISKPNIYIYVVDKFCE-----KLSEELEEWSQPFYTSHIGYRMSAKLGFNQDYIG------IYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHP 679
            D K   +  ++I+ V+ F E     +    +   S+PFYT   GY+MS K+    D +G      ++  L++GDFDDLL WPFKN++  T+++Q  +T   +   KP P
Sbjct:  312 DEKINYRNGVFIWKVEHFPELKANAERGNRISVTSEPFYTKEFGYKMSMKIYPAGDGVGKSTHLSVFFTLMKGDFDDLLVWPFKNKVTLTILDQKNKTSDYSDTFKPDP 420          
BLAST of SMED30000612 vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.545e-11
Identity = 48/163 (29.45%), Postives = 79/163 (48.47%), Query Frame = -3
Query:  218 YIYVVDKFCEKL-----SEELEEWSQPFYTSHIGYRMSAKL------GFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG--------GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 649
            +++ VDKF +K+      + L  +S  FYT   GY+M  +L       +  +Y+ +++ L++ D DD+L WPF+N   F+LINQ        +   PH      Y  +   K    CL         G+G  DF+D+   K   N+   ++ RN+ I+IK K+
Sbjct:  283 FVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQ--------RTRLPHSRSTTTYDNFQMEK----CLDKPILERNVGYGYLDFMDL---KELFNN--DDWTRNDQIFIKFKV 428          
BLAST of SMED30000612 vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.144e-11
Identity = 48/163 (29.45%), Postives = 79/163 (48.47%), Query Frame = -3
Query:  218 YIYVVDKFCEKL-----SEELEEWSQPFYTSHIGYRMSAKL------GFNQDYIGIYVKLVEGDFDDLLAWPFKNEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLG--------GWGLSDFIDMCCIKGPSNDYISEFVRNNIIYIKIKL 649
            +++ VDKF +K+      + L  +S  FYT   GY+M  +L       +  +Y+ +++ L++ D DD+L WPF+N   F+LINQ        +   PH      Y  +   K    CL         G+G  DF+D+   K   N+   ++ RN+ I+IK K+
Sbjct:  295 FVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQ--------RTRLPHSRSTTTYDNFQMEK----CLDKPILERNVGYGYLDFMDL---KELFNN--DDWTRNDQIFIKFKV 440          
The following BLAST results are available for this feature:
BLAST of SMED30000612 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF33.259e-1033.73TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.391e-1033.73TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.391e-1033.73TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.712e-1033.73TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.712e-1033.73TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-21.336e-927.74TNF Receptor Associated Factor (TRAF) homolog [So... [more]
trf-12.963e-624.20TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf41.633e-925.44gene:FBgn0026319 transcript:FBtr0077429[more]
Traf41.650e-927.01gene:FBgn0026319 transcript:FBtr0334401[more]
back to top
BLAST of SMED30000612 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf51.732e-1331.30Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
traf31.010e-1034.94TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf4a2.373e-823.53tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a2.373e-823.53tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4b1.276e-722.86tnf receptor-associated factor 4b [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh22.671e-1033.73slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh22.971e-1033.73slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
sytl21.509e-922.94synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
slc12a17.045e-932.89solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a18.532e-932.89solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf32.225e-1033.73TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.659e-1033.73TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.659e-1033.73TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf54.809e-1026.52TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf54.809e-1026.52TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30000612 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE1.557e-933.73TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN1.628e-933.73TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE4.952e-926.52TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN1.471e-726.52TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|Q61382|TRAF4_MOUSE3.010e-724.46TNF receptor-associated factor 4 OS=Mus musculus O... [more]
back to top
BLAST of SMED30000612 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183B9271.175e-2636.65MATH domain-containing protein OS=Echinostoma capr... [more]
A0A504YL976.594e-2635.54TNF receptor-associated factor 4 OS=Fasciola gigan... [more]
A0A5J4NF124.184e-2538.82MATH domain-containing protein OS=Paragonimus west... [more]
A0A4S2LX151.515e-2335.43MATH domain-containing protein OS=Opisthorchis fel... [more]
A0A0X3P2E91.590e-2338.00MATH domain-containing protein OS=Schistocephalus ... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf52.174e-1229.77TNF receptor-associated factor 5 [Source:NCBI gene... [more]
ENSAMXT00000035169.11.192e-1135.37pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf4a1.169e-923.84TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4b6.006e-822.86TNF receptor-associated factor 4-like [Source:NCBI... [more]
traf11.497e-723.84TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000074.11.326e-1229.32pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.276e-1126.32pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000612 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352376.478e-1333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495454.679e-1231.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291459.260e-1242.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406651.125e-1030.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483941.330e-1032.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30000612 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001369.23.516e-1127.48TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf31.986e-1035.44TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a1.853e-924.12TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.998e-924.12TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a2.025e-924.12TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of SMED30000612 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004982.10.000e+090.38SMESG000004982.1[more]
SMESG000028762.14.876e-1732.91SMESG000028762.1[more]
SMESG000039089.11.145e-1233.94SMESG000039089.1[more]
SMESG000020135.12.545e-1129.45SMESG000020135.1[more]
SMESG000020135.13.144e-1129.45SMESG000020135.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000612 ID=SMED30000612|Name=SMED30000612|organism=Schmidtea mediterranea sexual|type=transcript|length=1356bp
AGCAGGTCGAGTGGTCGAGTCCACTGTACGCTTTGTATAATTAAAACTGA
AATACTGAAAACATATAATTTCGAGTTTGACCATTTATAGCTTTATTTAA
ATAATTATCATAATTGAAGGAATTCTTTAGACTACAATTTCAGAATTTTG
TAGAAAATAATGATCAAATATTATAATTATTTGAAAAAATTTCAAATATC
TTGTAAAATTATTCGACCAACTTAATTTTGATATAAATAATATTATTTCT
CACAAATTCTGAAATATAATCATTGCTTGGACCCTTGATGCAGCACATAT
CGATAAAGTCGCTCAAACCCCAGCCACCGAGACATGATGATGTATACTTA
GGTCGTATCCAATATCCATATTCATCTGGATCACAAGGATGGGGTTTCAG
AATCTTGGTTAAACTTTCTGTTTCTTCAACTTGATTAATCAGAGTAAAGG
CTATTTCATTTTTAAATGGCCAAGCTAATAAGTCATCAAAATCACCTTCG
ACAAGCTTTACATAGATTCCAATATAATCCTGATTAAAGCCTAATTTTGC
TGACATCCTGTACCCAATGTGACTTGTGTAAAATGGTTGAGACCATTCTT
CTAATTCTTCAGACAGCTTTTCGCAAAACTTATCAACCACATAAATATAA
ATATTTGGCTTGGAAATCGCTTTAAAATCCTCTCTTAACGTCGAAAATTT
ATTTGGTGTGCTGCATGACTTTTTTCTACATATTTTTGATTTTAAAGATT
TAGAAGAGGATTTTGTTATACATTTATCATATTCAGGAATGCTTAAGATT
TCGGTTATATCCTTTGTTGGAGTCATTCGGTTTGGAGAAGGACTTGATGA
AATGTTGGTTATATGTGGAATTGTTCTATTGTCATTATTGTCTTCATCAC
ATAAAGTCGGTATCTCTTTAGAGCACTGAATTCCCTTATGACAGGTTCTA
ATAGAAAGCATCACTTCGTTGAGATTGGACTCTATAGATCTTTGAGATGC
TACAGATTTCTTTAACTCGCACGCCAAATTCGTTATAGCACTTGTTAATT
CGCTGCTACCAGTGAAAGTGCGCCGAGGATTAGTTATACCCTTCATTAAA
CCTATTATTTCTAATTGTATTTTCTTCTGTTCTTCAATAAATCCAAATAA
TTCTTCAGTTTTTACGCAAAGTTCTTTGTATAATACGGGATAATTTTCAT
ATTTATTCATAACTTTTAAGAAGTATACAATGCATTTTATCAATAAATAA
TTATTAAAAATAATCTAAAGAATATCTAAAGTGTAGTTAGCAACATTTAA
TTTTTGACTGTTGTTTGAAGAAATCAATCAGTGAGCTCATTATTGAGGAC
ATAAAT
back to top

protein sequence of SMED30000612-orf-1

>SMED30000612-orf-1 ID=SMED30000612-orf-1|Name=SMED30000612-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MNKYENYPVLYKELCVKTEELFGFIEEQKKIQLEIIGLMKGITNPRRTFT
GSSELTSAITNLACELKKSVASQRSIESNLNEVMLSIRTCHKGIQCSKEI
PTLCDEDNNDNRTIPHITNISSSPSPNRMTPTKDITEILSIPEYDKCITK
SSSKSLKSKICRKKSCSTPNKFSTLREDFKAISKPNIYIYVVDKFCEKLS
EELEEWSQPFYTSHIGYRMSAKLGFNQDYIGIYVKLVEGDFDDLLAWPFK
NEIAFTLINQVEETESLTKILKPHPCDPDEYGYWIRPKYTSSCLGGWGLS
DFIDMCCIKGPSNDYISEFVRNNIIYIKIKLVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding