Lethal(2) giant larvae-like protein

Overview
NameLethal(2) giant larvae-like protein
Smed IDSMED30000608
Length (bp)3037
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lethal(2) giant larvae-like protein (SMED30000608) t-SNE clustered cells

Violin plots show distribution of expression levels for Lethal(2) giant larvae-like protein (SMED30000608) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lethal(2) giant larvae-like protein (SMED30000608) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lethal(2) giant larvae-like protein (SMED30000608) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000608

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30000608h1SMcG0018037 dd_Smed_v4_11211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 63.929 bits (154), Expect = 1.397e-9
Identity = 53/180 (29.44%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  590 NKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKF--GIIDMEAFNKDLL--IFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNG-----LKDKNKILVLTTTECVVISRDNGVW 1096
            N++LI +  + G V+  D +   + + FL   Q       +I    + ++L+S   DG +    +  EA   + L  + PYGPFPCK+I + L      G+     +F GGMP  +Y D + +SV I D  +  F F   V+ F V+T         D   ++VL   E VVI      W
Sbjct:  202 NQILIGY--SRGLVVIWDLQGSRVLYHFLSSQQ-----LENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-IHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 63.5438 bits (153), Expect = 1.716e-9
Identity = 53/180 (29.44%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  590 NKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKF--GIIDMEAFNKDLL--IFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNG-----LKDKNKILVLTTTECVVISRDNGVW 1096
            N++LI +  + G V+  D +   + + FL   Q       +I    + ++L+S   DG +    +  EA   + L  + PYGPFPCK+I + L      G+     +F GGMP  +Y D + +SV I D  +  F F   V+ F V+T         D   ++VL   E VVI      W
Sbjct:  202 NQILIGY--SRGLVVIWDLQGSRVLYHFLSSQQ-----LENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-IHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 63.5438 bits (153), Expect = 1.775e-9
Identity = 53/180 (29.44%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  590 NKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKF--GIIDMEAFNKDLL--IFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNG-----LKDKNKILVLTTTECVVISRDNGVW 1096
            N++LI +  + G V+  D +   + + FL   Q       +I    + ++L+S   DG +    +  EA   + L  + PYGPFPCK+I + L      G+     +F GGMP  +Y D + +SV I D  +  F F   V+ F V+T         D   ++VL   E VVI      W
Sbjct:  202 NQILIGY--SRGLVVIWDLQGSRVLYHFLSSQQ-----LENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-IHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 57.3806 bits (137), Expect = 8.078e-8
Identity = 46/148 (31.08%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  590 NKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKF--GIIDMEAFNKDLL--IFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVIT 1015
            N++LI +  + G V+  D +   + + FL   Q++E    +I    + ++L+S   DG +    +  EA   + L  + PYGPFPCK+I + L      G+     +F GGMP  +Y D + +SV I D  +  F F   V+ F V+T
Sbjct:  202 NQILIGY--SRGLVVIWDLQGSRVLYHFLSS-QQLE----NIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-IHDGQQTAFDFTSRVIGFTVLT 339          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Human
Match: LLGL2 (LLGL scribble cell polarity complex component 2 [Source:HGNC Symbol;Acc:HGNC:6629])

HSP 1 Score: 57.3806 bits (137), Expect = 8.078e-8
Identity = 46/148 (31.08%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  590 NKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKF--GIIDMEAFNKDLL--IFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVIT 1015
            N++LI +  + G V+  D +   + + FL   Q++E    +I    + ++L+S   DG +    +  EA   + L  + PYGPFPCK+I + L      G+     +F GGMP  +Y D + +SV I D  +  F F   V+ F V+T
Sbjct:  202 NQILIGY--SRGLVVIWDLQGSRVLYHFLSS-QQLE----NIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-IHDGQQTAFDFTSRVIGFTVLT 339          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0078169)

HSP 1 Score: 58.151 bits (139), Expect = 4.526e-8
Identity = 33/87 (37.93%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  755 DGKFGI--IDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEK--CYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            DG +    ID      ++   PYGP PCKSI++    ++ G +      VFSGGMP   Y D N VSV   D  ++C  F   V+DF
Sbjct:  200 DGSYATWSIDNPEPPSNVNYVPYGPDPCKSINR----LYKGKRRSNDVIVFSGGMPRSAYGDHNCVSVHASDGHKVCLDFTSKVIDF 282          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0078167)

HSP 1 Score: 58.151 bits (139), Expect = 4.526e-8
Identity = 33/87 (37.93%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  755 DGKFGI--IDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEK--CYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            DG +    ID      ++   PYGP PCKSI++    ++ G +      VFSGGMP   Y D N VSV   D  ++C  F   V+DF
Sbjct:  200 DGSYATWSIDNPEPPSNVNYVPYGPDPCKSINR----LYKGKRRSNDVIVFSGGMPRSAYGDHNCVSVHASDGHKVCLDFTSKVIDF 282          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0078168)

HSP 1 Score: 58.151 bits (139), Expect = 4.526e-8
Identity = 33/87 (37.93%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  755 DGKFGI--IDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEK--CYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            DG +    ID      ++   PYGP PCKSI++    ++ G +      VFSGGMP   Y D N VSV   D  ++C  F   V+DF
Sbjct:  200 DGSYATWSIDNPEPPSNVNYVPYGPDPCKSINR----LYKGKRRSNDVIVFSGGMPRSAYGDHNCVSVHASDGHKVCLDFTSKVIDF 282          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306592)

HSP 1 Score: 58.151 bits (139), Expect = 4.734e-8
Identity = 33/87 (37.93%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  755 DGKFGI--IDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEK--CYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            DG +    ID      ++   PYGP PCKSI++    ++ G +      VFSGGMP   Y D N VSV   D  ++C  F   V+DF
Sbjct:  249 DGSYATWSIDNPEPPSNVNYVPYGPDPCKSINR----LYKGKRRSNDVIVFSGGMPRSAYGDHNCVSVHASDGHKVCLDFTSKVIDF 331          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Fly
Match: l(2)gl (gene:FBgn0002121 transcript:FBtr0306590)

HSP 1 Score: 58.151 bits (139), Expect = 4.734e-8
Identity = 33/87 (37.93%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  755 DGKFGI--IDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEK--CYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            DG +    ID      ++   PYGP PCKSI++    ++ G +      VFSGGMP   Y D N VSV   D  ++C  F   V+DF
Sbjct:  249 DGSYATWSIDNPEPPSNVNYVPYGPDPCKSINR----LYKGKRRSNDVIVFSGGMPRSAYGDHNCVSVHASDGHKVCLDFTSKVIDF 331          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Zebrafish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-060825-69])

HSP 1 Score: 53.9138 bits (128), Expect = 1.243e-6
Identity = 64/234 (27.35%), Postives = 99/234 (42.31%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVI--TNGLKD---KNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQITRMSNIIEV---------------------ENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTW-----FLTPDQCFLSESV-NLNKFYNSSSTEKQEKNILWPRFQKCG 1414
            PYGPFPCK+++K L     SG      +FSGGMP  +Y D + +++ ++D   +   F   V+DF  I  T+  KD    + ++VL   E VVI      W +     + P   S IT   +I  V                     EN+ I     ++ D K        Q +L    +++G+V  W      L P     + S+   +  +N S T+  E+   WP F+K G
Sbjct:  277 PYGPFPCKAVNKILWRTTESGA--PLVLFSGGMPRASYGDRHCLTI-LQDSSHVTLDFTSRVIDFFTIHCTDTEKDFDEPSALVVLLEEELVVIDLQMPGWPTVPAPYLAPLHSSAITCSCHISNVPPKLWERVISAGQQQCPLQNYENWPICGGKNLAPDPK--------QKELLLTGHEDGTVRFWDASGVSLKPLYKLSTASIFQTDCEHNDSLTQAGEEE--WPPFRKVG 497          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Zebrafish
Match: llgl1 (LLGL scribble cell polarity complex component 1 [Source:ZFIN;Acc:ZDB-GENE-060825-69])

HSP 1 Score: 53.9138 bits (128), Expect = 1.245e-6
Identity = 64/235 (27.23%), Postives = 99/235 (42.13%), Query Frame = 2
Query:  809 FPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVI--TNGLKD---KNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQITRMSNIIEV---------------------ENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTW-----FLTPDQCFLSESV-NLNKFYNSSSTEKQEKNILWPRFQKCG 1414
             PYGPFPCK+++K L     SG      +FSGGMP  +Y D + +++ ++D   +   F   V+DF  I  T+  KD    + ++VL   E VVI      W +     + P   S IT   +I  V                     EN+ I     ++ D K        Q +L    +++G+V  W      L P     + S+   +  +N S T+  E+   WP F+K G
Sbjct:  249 IPYGPFPCKAVNKILWRTTESGA--PLVLFSGGMPRASYGDRHCLTI-LQDSSHVTLDFTSRVIDFFTIHCTDTEKDFDEPSALVVLLEEELVVIDLQMPGWPTVPAPYLAPLHSSAITCSCHISNVPPKLWERVISAGQQQCPLQNYENWPICGGKNLAPDPK--------QKELLLTGHEDGTVRFWDASGVSLKPLYKLSTASIFQTDCEHNDSLTQAGEEE--WPPFRKVG 470          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Mouse
Match: Llgl2 (LLGL2 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:1918843])

HSP 1 Score: 56.9954 bits (136), Expect = 1.422e-7
Identity = 34/101 (33.66%), Postives = 48/101 (47.52%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITN-----GLKDKNKILVLTTTECVVISRDNGVW 1096
            PYGPFPCK+I K        G+     +F GGMP  +Y D + +SV + +  +  F F   V+DF V++         D   ++VL   E VVI      W
Sbjct:  274 PYGPFPCKAITKIFWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-VHNGQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Mouse
Match: Llgl2 (LLGL2 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:1918843])

HSP 1 Score: 56.9954 bits (136), Expect = 1.455e-7
Identity = 34/101 (33.66%), Postives = 48/101 (47.52%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITN-----GLKDKNKILVLTTTECVVISRDNGVW 1096
            PYGPFPCK+I K        G+     +F GGMP  +Y D + +SV + +  +  F F   V+DF V++         D   ++VL   E VVI      W
Sbjct:  274 PYGPFPCKAITKIFWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-VHNGQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Mouse
Match: Llgl1 (LLGL1 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:102682])

HSP 1 Score: 53.5286 bits (127), Expect = 1.407e-6
Identity = 34/99 (34.34%), Postives = 51/99 (51.52%), Query Frame = 2
Query:  725 ENNQILISTFDGKFGIIDMEA-----FNKDLLIFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            + + I+ S  DG + I   +          ++  PYGPFPCK+I+K L  +  SG  +   +FSGGMP  +Y D + VSV +  E  +   F   V+DF
Sbjct:  247 DGSSIISSHSDGSYAIWSTDTGSPPTLQPTVVTTPYGPFPCKAINKILWRSCESG--DHFIIFSGGMPRASYGDRHCVSV-LRAETLVTLDFTSRVIDF 342          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Mouse
Match: Llgl1 (LLGL1 scribble cell polarity complex component [Source:MGI Symbol;Acc:MGI:102682])

HSP 1 Score: 53.5286 bits (127), Expect = 1.484e-6
Identity = 34/99 (34.34%), Postives = 51/99 (51.52%), Query Frame = 2
Query:  725 ENNQILISTFDGKFGIIDMEA-----FNKDLLIFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            + + I+ S  DG + I   +          ++  PYGPFPCK+I+K L  +  SG  +   +FSGGMP  +Y D + VSV +  E  +   F   V+DF
Sbjct:  247 DGSSIISSHSDGSYAIWSTDTGSPPTLQPTVVTTPYGPFPCKAINKILWRSCESG--DHFIIFSGGMPRASYGDRHCVSV-LRAETLVTLDFTSRVIDF 342          
BLAST of Lethal(2) giant larvae-like protein vs. UniProt/SwissProt
Match: sp|Q5RCX2|L2GL2_PONAB (LLGL scribble cell polarity complex component 2 OS=Pongo abelii OX=9601 GN=LLGL2 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.228e-9
Identity = 56/180 (31.11%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  590 NKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKFGIIDM--EAFNKDLL--IFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITN-----GLKDKNKILVLTTTECVVISRDNGVW 1096
            N++LI +  + G V+  D +   + + FL   Q       +I    + ++L+S   DG +    M  EA   + L  + PYGPFPCK+I K L      G+     +F GGMP  +Y D +  SV I D  +  F F   V+DF V+T         D   ++VL   E VVI      W
Sbjct:  202 NQILIGY--SRGLVVIWDLQGSRVLYHFLSSQQ-----LENIWWQRDGRLLVSCHSDGSYCQWPMSSEAQQPEPLRSLVPYGPFPCKAITKILWLTTRQGL--PFTIFQGGMPRASYGDRHCTSV-IHDGQQTAFDFTSRVIDFTVLTEADPAAAFDDPYALVVLAEEELVVIDLQTAGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. UniProt/SwissProt
Match: sp|Q6P1M3|L2GL2_HUMAN (LLGL scribble cell polarity complex component 2 OS=Homo sapiens OX=9606 GN=LLGL2 PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 8.242e-9
Identity = 53/180 (29.44%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  590 NKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKF--GIIDMEAFNKDLL--IFPYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNG-----LKDKNKILVLTTTECVVISRDNGVW 1096
            N++LI +  + G V+  D +   + + FL   Q       +I    + ++L+S   DG +    +  EA   + L  + PYGPFPCK+I + L      G+     +F GGMP  +Y D + +SV I D  +  F F   V+ F V+T         D   ++VL   E VVI      W
Sbjct:  202 NQILIGY--SRGLVVIWDLQGSRVLYHFLSSQQ-----LENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-IHDGQQTAFDFTSRVIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. UniProt/SwissProt
Match: sp|Q08470|L2GL_DROPS (Protein lethal(2) giant larvae OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=l(2)gl PE=1 SV=3)

HSP 1 Score: 60.4622 bits (145), Expect = 7.668e-8
Identity = 37/107 (34.58%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  755 DGKFGI--IDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIK--EKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTE 1063
            DG +    ID     +++   PYGP PCKSI++    ++ G +      VFSGGMP   Y D N VSV + D  ++C  F   V+DF V      D  ++L++   E
Sbjct:  249 DGSYATWSIDNGEPPQNVNYVPYGPDPCKSINR----LYKGQRGTNDVIVFSGGMPRSAYGDHNCVSVHVSDGHKVCLDFTSKVIDFFVTYKEGSDDVEVLIVLLEE 351          
BLAST of Lethal(2) giant larvae-like protein vs. UniProt/SwissProt
Match: sp|P08111|L2GL_DROME (Lethal(2) giant larvae protein OS=Drosophila melanogaster OX=7227 GN=l(2)gl PE=1 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 4.745e-7
Identity = 33/87 (37.93%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  755 DGKFGI--IDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEK--CYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF 1003
            DG +    ID      ++   PYGP PCKSI++    ++ G +      VFSGGMP   Y D N VSV   D  ++C  F   V+DF
Sbjct:  249 DGSYATWSIDNPEPPSNVNYVPYGPDPCKSINR----LYKGKRRSNDVIVFSGGMPRSAYGDHNCVSVHASDGHKVCLDFTSKVIDF 331          
BLAST of Lethal(2) giant larvae-like protein vs. UniProt/SwissProt
Match: sp|Q3TJ91|L2GL2_MOUSE (LLGL scribble cell polarity complex component 2 OS=Mus musculus OX=10090 GN=Llgl2 PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 9.944e-7
Identity = 34/101 (33.66%), Postives = 48/101 (47.52%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCL-TAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITN-----GLKDKNKILVLTTTECVVISRDNGVW 1096
            PYGPFPCK+I K        G+     +F GGMP  +Y D + +SV + +  +  F F   V+DF V++         D   ++VL   E VVI      W
Sbjct:  274 PYGPFPCKAITKIFWLTTRQGL--PFTIFQGGMPRASYGDRHCISV-VHNGQQTAFDFTSRVIDFTVLSEADPAAAFDDPYALVVLAEEELVVIDLQTPGW 371          
BLAST of Lethal(2) giant larvae-like protein vs. TrEMBL
Match: A0A433UAG8 (WD_REPEATS_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_001417 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.945e-15
Identity = 97/363 (26.72%), Postives = 164/363 (45.18%), Query Frame = 2
Query:   80 GKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQIGKIS--HLQFLSKKGNLVGFGGELGLHFWISNNESNSYTYIFYKLELDS--RLFITSICECKNVVFENFSSENIPILIGCNNGAIEMCVVK---ETHVVRSNVI---KPEKFDLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTF-DGKFGIIDMEAFN----KDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNG---------LKDKNKILVLTTTECVVISRDNGVW 1096
            G  ++    A + KL+L ++ ++ G+I IF      +     G +S   + F+ ++G L+    +  LH W  NN   S   +  + E+DS   L + S+  C   +  +FSS    + +G  +G + +  VK   ETHV+  + I    PE F     K+    V  +A+  +      +KVLI F    G ++  ++++      F    Q++E+    +    N +  IS   DG +  I  EA N    K+  + PYGPFPCK+++K L  +     E   VFSGGMP  +Y D +TVS+    +  +       VVDF +I+             D   +++L   E VV+  ++  W
Sbjct:   33 GFPTKPSAMAYDSKLQLLAIGTKSGVIRIFGTPGFEVSATHEGDVSVTSIFFIPEEGRLITACSDSSLHLWEINNRDGSS--VLEEKEMDSGEALKVKSMSTCS--MSSDFSS----LFVGTESGNVHVIDVKTLTETHVINMDTIIQNVPEDF-----KVSPGAVEATASNPVN----SDKVLIGF--NRGLIVLWNTKDGAAEATF-NATQQLEY----LTWSRNGEEFISAHNDGSY--ITWEAKNSAEPKEQALTPYGPFPCKAVNKLLWKMTK--NEPMVVFSGGMPRASYGDRHTVSIMQGGDNHVVADLTSRVVDFIIISRADEKDAIETDRDDPRALVILAEEELVVLDLESEGW 367          
BLAST of Lethal(2) giant larvae-like protein vs. TrEMBL
Match: A0A158PLD8 (LLGL domain-containing protein OS=Angiostrongylus costaricensis OX=334426 GN=ACOC_LOCUS11235 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.875e-13
Identity = 124/542 (22.88%), Postives = 213/542 (39.30%), Query Frame = 2
Query:   80 GKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQIGK------ISHLQFLSKKGNLVGFGGELGLHFWISNNESNSYTYIFYKLELDSRLFITSICECKNVVFENFSSENIPILIGCNNG---AIEMCVVK--ETHVVRSNVIK--PEKFDLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQI-LISTFDGKFGIIDM---EAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKD---------------KNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQIT----RMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLT-PDQCFLSESVNLNKFYNSSSTEK----QEKNIL--------------WPRFQKCGIWKSMFAESISIESIKLIHDSNESIHLLICTNRKSLFLFKVD 1540
            G  S   CFA ++ L L ++ S DG I I+  +  +   +  GK      ++H+ F S  G L+    +     +       S   + ++  L     ITS C     + E  + ++  +LIG  +G   A+++  ++  E  V    +++  PE     K  +D +L     N  LTI+   ++ LI ++          + NE++      +  K      +I    N  + +++  DG +   +        +  L+F  GPFPC    K   A  S   E+  +FSGGMP  +Y D  TV+    D     F F+  V+DF +   G  D                   LVLT  E V I   +  W      QMFP   SQI     R++       + ++    +S + +  K     Q  L+   ++NG+V  W     D   L      N+F+  S  +K    +E  +               WP F+K G +   F +  S+   K++ D  +S H++I      + L+ ++
Sbjct:   31 GFPSHVSCFAYDKVLSLLAIGSLDGDINIYGGNGYMWSTEIPGKKGIGKSVAHMYFASGLGVLIVLCRDATFVRFSLEGSQLSARSVLHETRLKK---ITSCC-----MMERVNIQDAMLLIGTVSGNVFALDITTLELSEYIVFEDALLQRIPESSRREKYPVD-LLSVCPTNPRLTIMVFDHRHLIAYD---------SARNEVMGSSTFDVQCK------NITWSRNGGVFVVALHDGSYASCNPTTGAVIERPPLVF--GPFPCTPAKKAFLAETSSSSERIVLFSGGMPHASYGDRFTVTARQADR-TCVFDFSSPVIDFLLTYGGELDFCLCIFVQCPPSDSYHTCALVLTENELVCIDLRDRYWRVIATEQMFPLHASQIAAEAVRLNRKYSTGKWPLNARIPVSGETRSGKEVTKRQ--LYLTGHENGTVRVWCAGHADMKLLFVIDTRNEFHGFSEVDKDDAEKEPAVYDTESSDDEFQFTGEWPPFKKVGDYDP-FCDDASLSIQKVVFD-EKSGHIVIGARGGHVLLYSIE 541          
BLAST of Lethal(2) giant larvae-like protein vs. TrEMBL
Match: A0A553NU59 (LLGL domain-containing protein OS=Tigriopus californicus OX=6832 GN=TCAL_03771 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.236e-12
Identity = 119/487 (24.44%), Postives = 199/487 (40.86%), Query Frame = 2
Query:   62 NERKVLGKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQIGKISHLQFLSKKGNLVGFGGELGLHFWISNNESNSYTYIFYK--LELDSRLFITSICECKNVVFENFSSENIPILIGCNNGAI-----EMCVVKETHVVRSNVIK--PEKFDLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTFDGKFGIIDMEAFNKDLLI--FPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITN--GLKDKNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQIT---RMSNIIEVENYEISDDSGISTDDKIEK----------PYKSSQIK----LFAASYDNGSVSTWFLTPDQCFLSESVNLNKFY----NSSSTEKQEKNILWPRFQKCGIW 1420
            N+   +    + K  A+  K     V  Q G+  I  H+     +DQ   +S + F+  +G LV    +  LH W  N      T I  K    LD RL   S+  C + +       N+ +L+G   G I     E+  + E  + +  V+K  PE F +    ++ +L+  + +          ++LI +    G ++  D ++ + +  ++   Q     + +    + +Q + S  DG F I   +   + L     PYGP+PCKSI K L A  +G      VFSGGMP  +Y D  +VSV + ++    F  +  VV+F++  +         I VLT  E V I      W   +   +     S IT   ++SN+ E    ++ +       DK+            P KS++      L    +++GSV  W        L  SV  NKF+         E+ E    WP F++ G++
Sbjct:   56 NKPAAMAWDGELKLLAIATKHGALRVVGQPGVEFIGEHE-----QDQ--PVSKMIFIPGQGRLVTLTEDNFLHLWEING-----TEITEKSSTHLDGRLKRVSVM-CHDSIH------NM-VLLGTEGGNIYQLKLEIFTISENIIYQDIVMKGAPEDFKVNPGAVEGLLIQPNES---------ERILIGY--ARGLIVLWDRKSSVASQTYVTSQQLESLAWRN----DGSQFISSHNDGSFVIWSTQGNGEPLEPPNTPYGPYPCKSISKILWAHQNG--STWVVFSGGMPRASYGDKFSVSVMMGEDKHQVFDLSSKVVEFELFYDEESTNRPAGIFVLTEEELVTIDLATDSWPVFHAPYLNSIHASAITALIQVSNVSECVFTKLKEMGEAERKDKVSDREWPVNGGVVPEKSNKDASCHDLLVTGHEDGSVKLWSCGDSALALLLSVKTNKFFVGDELDEPFEEDEDEEEWPPFRRIGLY 505          
BLAST of Lethal(2) giant larvae-like protein vs. TrEMBL
Match: A0A4U8USY0 (LLGL domain-containing protein OS=Steinernema carpocapsae OX=34508 GN=L596_003567 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.050e-11
Identity = 96/446 (21.52%), Postives = 183/446 (41.03%), Query Frame = 2
Query:   80 GKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFED--QIGKISHLQFLSKKGNLVGFGGELGLHFWISN-NESNSYTYIFYKLELDSRLFITSICECKNVV-----FENFSSENIP-ILIGCNNGAI-----------EMCVVKETHVVRSNVIKPEKFDLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKD---KNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQITRMSNIIEV--------ENYEISDDSGISTDDK----------IEKPYKSSQIKLFAASYDNGSVSTW 1294
            G  S   CFAV+++L + ++ +  G + ++  ++  +     +   I+ + F+  +  L+           +SN +++ +  ++FYK E+  +    +     N +     FE   ++ I  +L+G   G +           E  +   T +   + +K E   +  + +D++                 K+ + F   +        +  +  F+  + I K+ F        EN+ +  +  DG +   +M++        P+GP+PC +I+K L    S I  +  +FSGGMP  +Y D  TVS+ I  E  + F F   VVDF V+ + L        +LVL   E V I   +  W       +FP   + IT +S + +V        E Y +   SG +T  K           E   + S  +++   +++GSV+ W
Sbjct:   32 GFPSGVSCFAVDDQLSILAIGTTTGELRLYGEENVELCGSLPEHKAITRIYFVPGQAELIA----------VSNGSDALAADHLFYKFEIVGQTLKRTDAPVHNCLKRITCFEMMDTDGITNLLLGTVTGNVFALSPKTLELDEWVIFDNTELKNVSALKEEDKSITDIFVDKLDS--------------QKISLVFNAAVIVSYNLQQDTVLFLFQAQQHISKVFF--------ENDFVYCAYGDGSYEKWNMKSGKSVESRMPFGPYPCTAIEKLLVISDSTISNEIIIFSGGMPNASYGDRFTVSL-ISAERTVVFDFGSEVVDFLVVRDTLGQNVTPTALLVLCKEELVAIDLLDPKWRPFALPYLFPLHYAPITCLSVVDDVPEHVRNNLEEYGLK-CSGQTTSRKWPIKFTFLNTTESKGRPSGTQVYLTGHEDGSVNVW 443          
BLAST of Lethal(2) giant larvae-like protein vs. TrEMBL
Match: A0A016SJI3 (LLGL domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0219.g2450 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.323e-11
Identity = 131/592 (22.13%), Postives = 234/592 (39.53%), Query Frame = 2
Query:   80 GKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQIGKISHLQFLSKKGNLVGFGGELGLHFWISNNESNSYTYIFYKLE----------LDSRLF-ITSICECKNVVFENFSSENIPILIGCNNG-----AIEMCVVKETHVVRSNVIK--PEKFDLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDS-ENEIINFEFLKIIQKIEFDFSHIELVENNQILISTFDGKFGIID-MEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNK-ILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQITRMSNIIEVENY------EISDD----------------SGISTDDKIEKPYKSSQIKLFAASYDNGSVSTW---FLTPDQCFLSESVNLNKFYNSSSTEKQEKNIL----------------WPRFQKCGIWKSMFAESISIESIKLIHDSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDY 1669
            G  S+  CFA ++ L L ++ + DG I I+  +  +   +  GK    + ++K    + F   LG+   +  +     T++ + LE           ++RL  ITS C     + +        +LIG  +G      I    + E  V   ++++  PE     K  +D +L     N  L ++    ++L+ ++ +   V+ T   + +  N  + +               E +Q +++  DG +   D   A   +     +GPFPC    K   A  S   EK  +FSGGMP  +Y D   V+    D     F F   V+DF ++T G    +   LVLT  E V I   +  W      QMFP   SQIT  ++   V+ +      +IS D                + I T D+     ++++ +L+   ++NG+V  W          F+ ++ N    ++    +  EK                   WP F+K G +   F +   + SI+ +    +S H+++      +FL+ ++  V+ +M  +    + C    S  + P RN K   A   +  Y
Sbjct:   31 GFPSRVSCFAYDDVLSLLAIGNLDGDINIYGGNGFIWSAEVPGK----KGIAKSAAHMYFACGLGVLIVLCRDS----TFVRFSLEGAAVTARSVLHETRLKKITSCC-----MLQKADLREAVLLIGTVSGNVFALDINTLELSEYIVFEDSILQRIPESMRRDKYPVD-LLSVCPTNPRLILMVFDQRLLLSYDSSTNEVLGTSVFDVQCKNITWTR---------------EGSQCVVALHDGSYASCDPARATIVERPAQVFGPFPCIPTKKAFFAETSRTSEKIVLFSGGMPHASYGDRFVVTARQGDR-TCVFDFASPVIDF-LLTKGADGYHTCALVLTENELVCIDLTDRYWRIIPTEQMFPLHASQITTSAHCSHVDEHVWNKMNKISADLLRNNRKYSSSAWPLNAKIPTSDEGRIVKEATKRQLYLTGHENGTVRVWSAGHAVMHLLFVIDTRNEFAGFSDEDKDVSEKEQASCDTDTSDDEFQITGDWPPFKKVGDYDP-FCDDAGL-SIQRVAFDEKSGHIVVGGRAGHVFLYTLEE-VEREMTPQTLKIELC--EASKLSVPARNSKPLPARTKSLKY 586          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Cavefish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:103026969])

HSP 1 Score: 53.9138 bits (128), Expect = 8.406e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKN 1036
            PYG FPCK+I K L  I +       +FSGGMP  +Y D + +SV I  +  +   F   ++DF VI +G + + 
Sbjct:  274 PYGSFPCKAISKILQ-ISTRQGPPFLIFSGGMPRASYGDRHCISV-IHSKTHVALDFTSRIIDFFVIRDGERHRG 346          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Cavefish
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:103026969])

HSP 1 Score: 53.9138 bits (128), Expect = 8.668e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKN 1036
            PYG FPCK+I K L  I +       +FSGGMP  +Y D + +SV I  +  +   F   ++DF VI +G + + 
Sbjct:  274 PYGSFPCKAISKILQ-ISTRQGPPFLIFSGGMPRASYGDRHCISV-IHSKTHVALDFTSRIIDFFVIRDGERHRG 346          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Nematostella
Match: EDO48036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR7])

HSP 1 Score: 49.6766 bits (117), Expect = 7.035e-6
Identity = 56/236 (23.73%), Postives = 102/236 (43.22%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDF----KVITNG-LKDKNKILVLTTTECVVISRDNGVWNSHNKGQMFP-FSKSQITRMSNIIEVENY-------EISDDSGISTDDKIEKPY--------------KSSQIK-LFAASYDNGSVSTWFLTPDQCFLSESVNLNKF-------YNSSSTEKQEKNILWPRFQKCG 1414
            P+GPFPCK+I K          +    F+GGMP  +Y D N +S+      ++ F F   V+DF     + T G L +   + VL   E VVI       +   K Q +P F K  +T + +     +Y       ++ +    +  D+I+  Y              + ++ K +    +++GSV  W ++  +  L  +++ +K        +++ + E +E+   WP F+K G
Sbjct:  272 PFGPFPCKAITKIE------WHDNSVFFAGGMPRASYGDKNCISLVQGSTTQVVFDFTSRVIDFITVIPLTTVGFLAEPACLAVLCEQELVVI-------DLKTKEQGYPTFMKPYLTCLHSSPITTSYHCHGCPSQLWNQICAAGKDQIQSEYSHESWPITGGKTLVEDAETKDILITGHEDGSVQFWDVSQVEMQLMYTLSTSKMFISDHEGHDNGTQEVEEEG--WPPFKKVG 492          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 52.7582 bits (125), Expect = 2.247e-6
Identity = 71/352 (20.17%), Postives = 127/352 (36.08%), Query Frame = 2
Query:   80 GKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDT--LIFEDQIGKISHLQFLSKKGNLVGFGGELGLHFWISNN--------ESNSYTYIFYKLELDSRLFITSICECKNVVFENFSSENIPILIGCNNGAIEM-----------CVVKETHVVRSNVIKPEKFDLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVEN-------NQILISTFDGKF-----GIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKN 1036
            G   Q         L+L ++ ++ G I ++       +   D+   ++ + FL  +  LV    +  LH W            E   +        L S   IT++    +       +E   + +    G  E+             V + ++ R N+   E         +++++     G+L +  L    L++  C    V    S   I+  +    +Q  E    + + +E+         IL S  DG +     G  D      D    PYG FPCK+I K +  + +       +FSGGMP  +Y D + ++V I  +  +   F   ++DF VI  G   K 
Sbjct:   50 GFPHQPSALGHSSSLQLLAIGTRSGAIKLYGAPGVEFMGLHDENAAVTQVHFLPHQVELVTLLDDNSLHMWTLKGHKGVSELLEIGRFVLTGPPGALPSVTRITAVLAHSSGELLLLGTEGGHVFVVEVPGFRELEERNISLEQVTSRVPDNYIGRRNLEHVEALQENPADANQVVIG-YGRGVLVVWDLKKHSLLQCICP-SQVRCPSSMGMILRMQLKGFMQSNEAPLLYFQALESVWWTEDGGCILSSHTDGSYCRWTVGETDGNEEKSDT---PYGTFPCKAISKIMQ-LPTAEGPPFLLFSGGMPRASYGDRHCITV-IHGKSHVALDFTSRIIDFFVIREGPHHKG 394          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Medaka
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:101167542])

HSP 1 Score: 51.9878 bits (123), Expect = 3.232e-6
Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDK 1033
            PYGPFPCK+I K L    + +     ++SGGMP  +Y D + +++  +D+  +   F   V+DF  + N   DK
Sbjct:  288 PYGPFPCKAITKILWRT-TQLSSPVILYSGGMPRASYGDRHCLTIQ-QDKEHVTLDFTSRVIDFFTVHNMDNDK 359          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Medaka
Match: LLGL1 (LLGL scribble cell polarity complex component 1 [Source:NCBI gene;Acc:101167542])

HSP 1 Score: 51.9878 bits (123), Expect = 3.654e-6
Identity = 26/74 (35.14%), Postives = 40/74 (54.05%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDK 1033
            PYGPFPCK+I K L   +        ++SGGMP  +Y D + +++  +D+  +   F   V+DF  + N   DK
Sbjct:  288 PYGPFPCKAITKIL---WRTTHSPVILYSGGMPRASYGDRHCLTIQ-QDKEHVTLDFTSRVIDFFTVHNMDNDK 357          
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Medaka
Match: llgl2 (LLGL scribble cell polarity complex component 2 [Source:NCBI gene;Acc:101172480])

HSP 1 Score: 50.8322 bits (120), Expect = 9.315e-6
Identity = 26/75 (34.67%), Postives = 39/75 (52.00%), Query Frame = 2
Query:  812 PYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKN 1036
            PYG FPCK+I K +  + +       +FSGGMP  +Y D + ++V I  +  +   F   ++DF VI  G   K 
Sbjct:  292 PYGTFPCKAISKIMQ-LPTAEGPPFLLFSGGMPRASYGDRHCITV-IHGKSHVALDFTSRIIDFFVIREGPHHKG 364          
BLAST of Lethal(2) giant larvae-like protein vs. Planmine SMEST
Match: SMESG000039127.1 (SMESG000039127.1)

HSP 1 Score: 1581.62 bits (4094), Expect = 0.000e+0
Identity = 793/799 (99.25%), Postives = 799/799 (100.00%), Query Frame = 2
Query:  527 KIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLIHDSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEKDYRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLSNMTILQLSLPDLCALKTFNINMGILNFXXXXXXXXXXXXAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNEVKNNMKNAVIPIDFMKEAKMSLNSLLM 2923
            KIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKI+QKIEFDFSHIEL+ENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQ+FPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLI+DSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEK+YRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLS+MTILQLSLPDLCALKTFNINMGILNFDLVSLDSDVVLVAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNEVKNNMKNAVIPIDFMKEAKMSLNSLLM
Sbjct:   23 KIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKILQKIEFDFSHIELLENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQIFPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLIYDSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEKEYRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLSHMTILQLSLPDLCALKTFNINMGILNFDLVSLDSDVVLVAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNEVKNNMKNAVIPIDFMKEAKMSLNSLLM 821          
BLAST of Lethal(2) giant larvae-like protein vs. Planmine SMEST
Match: SMESG000039127.1 (SMESG000039127.1)

HSP 1 Score: 1574.3 bits (4075), Expect = 0.000e+0
Identity = 790/804 (98.26%), Postives = 799/804 (99.38%), Query Frame = 2
Query:  512 DLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLIHDSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEKDYRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLSNMTILQLSLPDLCALKTFNINMGILNFXXXXXXXXXXXXAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNEVKNNMKNAVIPIDFMKEAKMSLNSLLM 2923
            ++ +LKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKI+QKIEFDFSHIEL+ENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQ+FPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLI+DSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEK+YRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLS+MTILQLSLPDLCALKTFNINMGILNFDLVSLDSDVVLVAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNE    MKNAVIPIDFMKEAKMSLNSLLM
Sbjct:   45 EVQELKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKILQKIEFDFSHIELLENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQIFPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLIYDSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEKEYRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLSHMTILQLSLPDLCALKTFNINMGILNFDLVSLDSDVVLVAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNE----MKNAVIPIDFMKEAKMSLNSLLM 844          
BLAST of Lethal(2) giant larvae-like protein vs. Planmine SMEST
Match: SMESG000039127.1 (SMESG000039127.1)

HSP 1 Score: 1570.44 bits (4065), Expect = 0.000e+0
Identity = 789/800 (98.62%), Postives = 796/800 (99.50%), Query Frame = 2
Query:  524 LKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKIIQKIEFDFSHIELVENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQMFPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLIHDSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEKDYRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLSNMTILQLSLPDLCALKTFNINMGILNFXXXXXXXXXXXXAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNEVKNNMKNAVIPIDFMKEAKMSLNSLLM 2923
            +KIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKI+QKIEFDFSHIEL+ENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQ+FPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLI+DSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEK+YRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLS+MTILQLSLPDLCALKTFNINMGILNFDLVSLDSDVVLVAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNE    MKNAVIPIDFMKEAKMSLNSLLM
Sbjct:   13 VKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENEIINFEFLKILQKIEFDFSHIELLENNQILISTFDGKFGIIDMEAFNKDLLIFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIEDEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSHNKGQIFPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKLFAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQKCGIWKSMFAESISIESIKLIYDSNESIHLLICTNRKSLFLFKVDPIVDGKMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDEFDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAGQPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNNENKFELFLGFTNGSIIGINFLVDKNSEFCIEKEYRKLFTNTNQEIINLYVFETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFNDNMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRFKFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFLFLSHMTILQLSLPDLCALKTFNINMGILNFDLVSLDSDVVLVAENFKCSSQLNILGNRKYKICKLIAEIKANQEENCNE----MKNAVIPIDFMKEAKMSLNSLLM 808          
BLAST of Lethal(2) giant larvae-like protein vs. Planmine SMEST
Match: SMESG000039124.1 (SMESG000039124.1)

HSP 1 Score: 317.775 bits (813), Expect = 1.535e-102
Identity = 155/157 (98.73%), Postives = 156/157 (99.36%), Query Frame = 2
Query:   56 MENERKVLGKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQIGKISHLQFLSKKGNLVGFGGELGLHFWISNNESNSYTYIFYKLELDSRLFITSICECKNVVFENFSSENIPILIGCNNGAIEMCVVKETHVVRSNVIKPEKFDLPKL 526
            MENERKVLGKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQIGKISHLQFLSKKGNLVGFGGELGLH WISNNESNSYTYIFYKLELDSRLFITSICECKNVVFENFSSENIPILIGCNNGAIEMCVVKETHVVR+NVIKPEKFDLPKL
Sbjct:    1 MENERKVLGKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQIGKISHLQFLSKKGNLVGFGGELGLHLWISNNESNSYTYIFYKLELDSRLFITSICECKNVVFENFSSENIPILIGCNNGAIEMCVVKETHVVRTNVIKPEKFDLPKL 157          
The following BLAST results are available for this feature:
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LLGL21.397e-929.44LLGL scribble cell polarity complex component 2 [S... [more]
LLGL21.716e-929.44LLGL scribble cell polarity complex component 2 [S... [more]
LLGL21.775e-929.44LLGL scribble cell polarity complex component 2 [S... [more]
LLGL28.078e-831.08LLGL scribble cell polarity complex component 2 [S... [more]
LLGL28.078e-831.08LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(2)gl4.526e-837.93gene:FBgn0002121 transcript:FBtr0078169[more]
l(2)gl4.526e-837.93gene:FBgn0002121 transcript:FBtr0078167[more]
l(2)gl4.526e-837.93gene:FBgn0002121 transcript:FBtr0078168[more]
l(2)gl4.734e-837.93gene:FBgn0002121 transcript:FBtr0306592[more]
l(2)gl4.734e-837.93gene:FBgn0002121 transcript:FBtr0306590[more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
llgl11.243e-627.35LLGL scribble cell polarity complex component 1 [S... [more]
llgl11.245e-627.23LLGL scribble cell polarity complex component 1 [S... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Llgl21.422e-733.66LLGL2 scribble cell polarity complex component [So... [more]
Llgl21.455e-733.66LLGL2 scribble cell polarity complex component [So... [more]
Llgl11.407e-634.34LLGL1 scribble cell polarity complex component [So... [more]
Llgl11.484e-634.34LLGL1 scribble cell polarity complex component [So... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RCX2|L2GL2_PONAB1.228e-931.11LLGL scribble cell polarity complex component 2 OS... [more]
sp|Q6P1M3|L2GL2_HUMAN8.242e-929.44LLGL scribble cell polarity complex component 2 OS... [more]
sp|Q08470|L2GL_DROPS7.668e-834.58Protein lethal(2) giant larvae OS=Drosophila pseud... [more]
sp|P08111|L2GL_DROME4.745e-737.93Lethal(2) giant larvae protein OS=Drosophila melan... [more]
sp|Q3TJ91|L2GL2_MOUSE9.944e-733.66LLGL scribble cell polarity complex component 2 OS... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433UAG83.945e-1526.72WD_REPEATS_REGION domain-containing protein OS=Ely... [more]
A0A158PLD82.875e-1322.88LLGL domain-containing protein OS=Angiostrongylus ... [more]
A0A553NU591.236e-1224.44LLGL domain-containing protein OS=Tigriopus califo... [more]
A0A4U8USY02.050e-1121.52LLGL domain-containing protein OS=Steinernema carp... [more]
A0A016SJI33.323e-1122.13LLGL domain-containing protein OS=Ancylostoma ceyl... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
llgl28.406e-737.33LLGL scribble cell polarity complex component 2 [S... [more]
llgl28.668e-737.33LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO480367.035e-623.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
llgl22.247e-620.17LLGL scribble cell polarity complex component 2 [S... [more]
LLGL13.232e-635.14LLGL scribble cell polarity complex component 1 [S... [more]
LLGL13.654e-635.14LLGL scribble cell polarity complex component 1 [S... [more]
llgl29.315e-634.67LLGL scribble cell polarity complex component 2 [S... [more]
back to top
BLAST of Lethal(2) giant larvae-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000039127.10.000e+099.25SMESG000039127.1[more]
SMESG000039127.10.000e+098.26SMESG000039127.1[more]
SMESG000039127.10.000e+098.63SMESG000039127.1[more]
SMESG000039124.11.535e-10298.73SMESG000039124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000608 ID=SMED30000608|Name=Lethal(2) giant larvae-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3037bp
TTTGTTATTTTAAAAATAGTACTAGTTGGATTTTTATTGCCTTAAGTTTA
TTAAAATGGAAAATGAGAGAAAAGTATTAGGAAAGGCCTCTCAGTGGAAA
TGTTTTGCCGTGGAAGAAAAATTGAAATTATTTTCTGTCGCTTCTCAAGA
TGGTTTAATACTAATATTTTCCCACGACGATACATTGATATTTGAGGATC
AGATTGGAAAGATCAGTCATTTACAGTTTCTTTCGAAAAAGGGTAACTTG
GTTGGCTTCGGAGGTGAATTAGGGTTACATTTTTGGATTTCGAACAATGA
ATCTAATTCGTATACATACATATTTTATAAATTAGAACTCGACTCAAGGT
TGTTTATCACTTCAATATGTGAATGTAAAAATGTCGTGTTTGAAAACTTT
TCAAGCGAAAACATCCCGATTTTGATTGGTTGTAATAATGGTGCAATAGA
AATGTGTGTCGTTAAGGAAACTCACGTGGTCAGATCCAATGTGATCAAGC
CGGAGAAATTTGATTTGCCAAAATTGAAAATTGATAGAATATTAGTGACG
AGATCTGCAAATGGAATTCTAACAATTTTGGCATTGGTCAATAAGGTTCT
CATAGAATTCGAATGCACAATTGGCAGTGTCATAGAAACTGATTCTGAGA
ATGAAATAATAAATTTTGAATTTCTCAAAATCATCCAGAAAATTGAATTC
GATTTTTCTCATATTGAACTAGTAGAAAACAATCAAATATTGATCTCCAC
ATTTGATGGAAAGTTTGGAATTATTGACATGGAGGCTTTCAATAAAGATT
TATTAATTTTTCCCTATGGTCCGTTTCCATGCAAATCTATTGACAAATGT
TTGACTGCTATATTTTCTGGAATCAAAGAAAAATGCTATGTATTTTCTGG
GGGAATGCCAGCAGTTACATATAAAGATCTAAATACTGTTTCTGTTTCCA
TTGAAGATGAACCAGAAATCTGTTTCACATTCAACGACATTGTAGTGGAT
TTCAAAGTTATTACAAATGGATTAAAAGATAAGAATAAAATTCTTGTATT
AACAACAACGGAATGCGTTGTCATTTCTCGTGATAATGGAGTTTGGAATT
CGCATAATAAAGGCCAAATGTTTCCTTTTTCTAAGAGTCAAATCACAAGA
ATGAGCAATATAATAGAAGTGGAAAATTACGAAATAAGCGACGACAGTGG
AATTTCAACTGACGACAAAATTGAAAAGCCGTATAAAAGTTCACAGATAA
AATTATTTGCTGCTTCTTACGACAACGGATCGGTATCCACTTGGTTTTTG
ACACCAGATCAATGTTTCTTAAGTGAAAGTGTTAATTTAAACAAGTTTTA
TAATTCTTCGTCAACTGAGAAACAAGAAAAAAACATACTATGGCCAAGAT
TCCAAAAATGTGGAATATGGAAATCGATGTTTGCGGAGAGTATATCAATT
GAATCAATCAAACTAATACATGATTCAAATGAATCAATTCATTTATTAAT
TTGCACCAATAGAAAATCGTTATTTTTATTCAAGGTAGATCCAATTGTGG
ACGGTAAAATGGAGAATAAAAGGTGTTATAGGCAATGGTGTCATCATCAC
ATATCTGTCAATAATGCTCCAATGAGAAATTATAAAATCAACACAGCGGC
TAACACAAATTCAGATTATCTTTATTTAATAACTTTGATTACGTTCGGTG
ATGAATTTGATTCGTTGATTGTGGATTTCAGCTTCAGGGGAAATATCTTG
AGTTTTGCTAGTAGAATCGGATTTTGTTGCGTGAATATTGCCAATGGGAA
GCACTTATTTTTGCCTTTCTCCTTATTTAAAATGGTTGATACTTTTAAAG
CTGGACAACCTTTCACAGAAAGAATACAGAGAAAAATACGAAAGAGAAAA
TCATTGGAGTATTCTATGGGGAAACTAGAATCTGAAGAAATAATAGACCT
GCGAAACTATGCTAGTTCCACGCAGCCGAAATCACTATTTCTGTGGCAGA
ATAATGAGAATAAATTTGAATTGTTTTTAGGATTTACAAATGGCTCTATT
ATTGGAATTAATTTCCTAGTGGATAAAAATTCAGAATTTTGTATTGAAAA
GGACTACAGAAAATTATTCACAAACACCAATCAAGAAATCATCAATCTTT
ACGTGTTTGAAACTCAGATTAATCCGTCTTTGATTACCGACTCGTTAAGC
CTAAGGGAAGGAATAAATCAAACCGACAATCATTCTATATCCACAAACAC
AAGTCCTGAATTGAATTCCTTGTGTGCAACGGATTGGAATAGTTCTTTTA
ATGACAATATGTCTATAAGAAGCTCAAAGTCCAAGACTTTATCATTCAAT
TGGCTTAAAGCTCGTGAATCTGAATTCAAAGAAAAAACATTATTATTAAG
AATAGATAAATATTCTATGAAAGTCATTGAAATTCAAAAAATGAAGACGA
GATTTAAATTCAAGGTCAATGAACATTATATGAAAGACTATTCGGTGATT
ACATCAAAAAGGAAAAACAAAACTCAAGATATTTCGATACCAATTATTCT
TGATTCTAGAATTAAAATTGCAGTGGAAAATCCTACGAAGTCGTTTTGCT
TTTTATTTTTATCCAATATGACTATCCTTCAATTATCATTGCCAGATCTA
TGTGCTTTAAAGACCTTTAATATTAACATGGGAATCTTGAATTTCGATCT
CGTTTCACTAGATTCAGATGTCGTTTTAGTAGCAGAAAATTTCAAATGCA
GCAGCCAGTTAAACATTTTGGGAAATCGGAAATATAAAATTTGCAAACTC
ATTGCAGAAATCAAGGCAAATCAGGAAGAAAATTGCAACGAAGTTAAAAA
TAATATGAAAAATGCAGTTATTCCAATTGATTTTATGAAAGAAGCTAAGA
TGAGTTTGAATTCATTGCTGATGTGACAAAGATTGCCGGATGTCCTTGAA
AATGAAGATATCTATATTTGAAAACTTATTTTAATTTTTTATGAAGAAAT
TTTAAAAATTGTTTTTGGATTTAAAAGTATATAAACC
back to top

protein sequence of SMED30000608-orf-1

>SMED30000608-orf-1 ID=SMED30000608-orf-1|Name=SMED30000608-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=957bp
MENERKVLGKASQWKCFAVEEKLKLFSVASQDGLILIFSHDDTLIFEDQI
GKISHLQFLSKKGNLVGFGGELGLHFWISNNESNSYTYIFYKLELDSRLF
ITSICECKNVVFENFSSENIPILIGCNNGAIEMCVVKETHVVRSNVIKPE
KFDLPKLKIDRILVTRSANGILTILALVNKVLIEFECTIGSVIETDSENE
IINFEFLKIIQKIEFDFSHIELVENNQILISTFDGKFGIIDMEAFNKDLL
IFPYGPFPCKSIDKCLTAIFSGIKEKCYVFSGGMPAVTYKDLNTVSVSIE
DEPEICFTFNDIVVDFKVITNGLKDKNKILVLTTTECVVISRDNGVWNSH
NKGQMFPFSKSQITRMSNIIEVENYEISDDSGISTDDKIEKPYKSSQIKL
FAASYDNGSVSTWFLTPDQCFLSESVNLNKFYNSSSTEKQEKNILWPRFQ
KCGIWKSMFAESISIESIKLIHDSNESIHLLICTNRKSLFLFKVDPIVDG
KMENKRCYRQWCHHHISVNNAPMRNYKINTAANTNSDYLYLITLITFGDE
FDSLIVDFSFRGNILSFASRIGFCCVNIANGKHLFLPFSLFKMVDTFKAG
QPFTERIQRKIRKRKSLEYSMGKLESEEIIDLRNYASSTQPKSLFLWQNN
ENKFELFLGFTNGSIIGINFLVDKNSEFCIEKDYRKLFTNTNQEIINLYV
FETQINPSLITDSLSLREGINQTDNHSISTNTSPELNSLCATDWNSSFND
NMSIRSSKSKTLSFNWLKARESEFKEKTLLLRIDKYSMKVIEIQKMKTRF
KFKVNEHYMKDYSVITSKRKNKTQDISIPIILDSRIKIAVENPTKSFCFL
FLSNMTILQLSLPDLCALKTFNINMGILNFDLVSLDSDVVLVAENFKCSS
QLNILGNRKYKICKLIAEIKANQEENCNEVKNNMKNAVIPIDFMKEAKMS
LNSLLM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016459myosin complex
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007605sensory perception of sound
GO:0006887exocytosis
GO:0007049cell cycle
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR013577LLGL2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013577Lethal giant larvae homologue 2PFAMPF08366LLGLcoord: 252..340
e-value: 6.7E-14
score: 52.1
NoneNo IPR availablePANTHERPTHR10241:SF29LETHAL(2) GIANT LARVAE PROTEINcoord: 15..373
NoneNo IPR availablePANTHERPTHR10241LETHAL 2 GIANT LARVAE PROTEINcoord: 15..373