Peroxiredoxin

Overview
NamePeroxiredoxin
Smed IDSMED30000596
Length (bp)1098
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peroxiredoxin (SMED30000596) t-SNE clustered cells

Violin plots show distribution of expression levels for Peroxiredoxin (SMED30000596) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peroxiredoxin (SMED30000596) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peroxiredoxin (SMED30000596) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000596

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000596SMESG000001807.1 SmedASXL_006767SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30000596SMESG000001807.1 dd_Smed_v4_7781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000596SMESG000001807.1 dd_Smed_v4_7781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30000596SMESG000001807.1 dd_Smed_v6_7781_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30000596SMESG000001807.1 SMED30000596smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peroxiredoxin vs. Ensembl Human
Match: PRDX1 (peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352])

HSP 1 Score: 278.1 bits (710), Expect = 5.048e-93
Identity = 123/187 (65.78%), Postives = 157/187 (83.96%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            GH AP F+A AV   G+  DISLSDY+GKYVV FFYP DFTFVCPTEIIAFSDRA+EF+ +NC+V+  S DS F H AW  TP+K+GG+G ++IPL++D  ++I++ YGVLK +EG++FRGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA Q+TD HGEVCPAGWKPGS TIKP ++ +++YF
Sbjct:    9 GHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYF 195          
BLAST of Peroxiredoxin vs. Ensembl Human
Match: PRDX1 (peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352])

HSP 1 Score: 278.1 bits (710), Expect = 5.048e-93
Identity = 123/187 (65.78%), Postives = 157/187 (83.96%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            GH AP F+A AV   G+  DISLSDY+GKYVV FFYP DFTFVCPTEIIAFSDRA+EF+ +NC+V+  S DS F H AW  TP+K+GG+G ++IPL++D  ++I++ YGVLK +EG++FRGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA Q+TD HGEVCPAGWKPGS TIKP ++ +++YF
Sbjct:    9 GHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYF 195          
BLAST of Peroxiredoxin vs. Ensembl Human
Match: PRDX2 (peroxiredoxin 2 [Source:HGNC Symbol;Acc:HGNC:9353])

HSP 1 Score: 276.944 bits (707), Expect = 1.373e-92
Identity = 124/186 (66.67%), Postives = 155/186 (83.33%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP F+A AV  G   ++ LSDY+GKYVVLFFYP DFTFVCPTEIIAFS+RA++FR + CEVL  S DS+F+H AW  TPRK+GG+G L+IPL+AD T+ +S+ YGVLK +EG+A+RGLFII  KG++RQIT+ND+PVGRS+DE LRLVQA QYTD HGEVCPAGWKPGS TIKP+++ +++YF
Sbjct:    9 GKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYF 194          
BLAST of Peroxiredoxin vs. Ensembl Human
Match: PRDX3 (peroxiredoxin 3 [Source:HGNC Symbol;Acc:HGNC:9354])

HSP 1 Score: 260.766 bits (665), Expect = 2.031e-85
Identity = 117/202 (57.92%), Postives = 150/202 (74.26%), Query Frame = 2
Query:  434 RKYMYKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            + +   S C  P    H AP F+  AV +GE  D+SL D++GKY+VLFFYP DFTFVCPTEI+AFSD+A EF D+NCEV+A S DS FSH AW  TPRK GG+G ++I L++D TK IS+ YGVL E  G+A RGLFII   G+I+ +++ND+PVGRS++ETLRLV+A QY + HGEVCPA W P S TIKPS   +++YF+
Sbjct:   52 KLFSTSSSCHAPAVTQH-APYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQ 252          
BLAST of Peroxiredoxin vs. Ensembl Human
Match: PRDX4 (peroxiredoxin 4 [Source:HGNC Symbol;Acc:HGNC:17169])

HSP 1 Score: 259.225 bits (661), Expect = 1.048e-84
Identity = 118/183 (64.48%), Postives = 142/183 (77.60%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            AP ++  AV  GE  ++ L+DY GKY+V FFYP DFTFVCPTEIIAF DR +EFR IN EV+ACS DS+F+H AW  TPR++GG+G + IPL++D T  ISK YGV  E+ G   RGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA QYTD HGEVCPAGWKPGS+TI P   G   YF
Sbjct:   85 APYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYF 267          
BLAST of Peroxiredoxin vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 275.018 bits (702), Expect = 2.491e-92
Identity = 129/199 (64.82%), Postives = 156/199 (78.39%), Query Frame = 2
Query:  443 MYKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            MY+   K  +  G  AP F+ +AV  GE +D+SLSDY+GKYVVLFFYP DFTFVCPTEIIAFSDRA+EF+ IN  VLA STDS FSH AW   PRK GG+G ++IP++AD    IS+ YGVLKE+EG+AFRGLFII     +RQITIND+PVGRS+DETLRLVQA Q+ + HGEVCPAGW PGS TIKP ++ +++YFK
Sbjct:    1 MYRQMSKAFI--GKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 197          
BLAST of Peroxiredoxin vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 274.248 bits (700), Expect = 5.652e-92
Identity = 126/187 (67.38%), Postives = 151/187 (80.75%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            G  AP F+ +AV  GE +D+SLSDY+GKYVVLFFYP DFTFVCPTEIIAFSDRA+EF+ IN  VLA STDS FSH AW   PRK GG+G ++IP++AD    IS+ YGVLKE+EG+AFRGLFII     +RQITIND+PVGRS+DETLRLVQA Q+ + HGEVCPAGW PGS TIKP ++ +++YFK
Sbjct:   13 GKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 199          
BLAST of Peroxiredoxin vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 273.863 bits (699), Expect = 6.529e-92
Identity = 126/187 (67.38%), Postives = 151/187 (80.75%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            G  AP F+ +AV  GE +D+SLSDY+GKYVVLFFYP DFTFVCPTEIIAFSDRA+EF+ IN  VLA STDS FSH AW   PRK GG+G ++IP++AD    IS+ YGVLKE+EG+AFRGLFII     +RQITIND+PVGRS+DETLRLVQA Q+ + HGEVCPAGW PGS TIKP ++ +++YFK
Sbjct:    7 GKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 193          
BLAST of Peroxiredoxin vs. Ensembl Celegans
Match: prdx-2 (PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7])

HSP 1 Score: 273.863 bits (699), Expect = 6.529e-92
Identity = 126/187 (67.38%), Postives = 151/187 (80.75%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            G  AP F+ +AV  GE +D+SLSDY+GKYVVLFFYP DFTFVCPTEIIAFSDRA+EF+ IN  VLA STDS FSH AW   PRK GG+G ++IP++AD    IS+ YGVLKE+EG+AFRGLFII     +RQITIND+PVGRS+DETLRLVQA Q+ + HGEVCPAGW PGS TIKP ++ +++YFK
Sbjct:    7 GKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFK 193          
BLAST of Peroxiredoxin vs. Ensembl Celegans
Match: prdx-3 (Probable peroxiredoxin prdx-3 [Source:UniProtKB/Swiss-Prot;Acc:Q21824])

HSP 1 Score: 242.662 bits (618), Expect = 3.447e-79
Identity = 108/191 (56.54%), Postives = 140/191 (73.30%), Query Frame = 2
Query:  467 PLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            PL P +  PAF+  AV  G+   IS  DY+GK++V+FFYP DFTFVCPTEIIA+ DRA EFR +  EV+ACS DS FSH AW  TPRK GG+G +DIPL+AD  K I+ S+GVL +  G+++RGLF+I   G +R  T ND+PVGRS+DETLR+++A Q++D HGEVCPA W   S TIKP +  +++YF 
Sbjct:   32 PLGPKNTVPAFKGTAVVDGDFKVISDQDYKGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKDGGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTTCNDLPVGRSVDETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYFN 222          
BLAST of Peroxiredoxin vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0339699)

HSP 1 Score: 265.388 bits (677), Expect = 1.669e-88
Identity = 120/186 (64.52%), Postives = 149/186 (80.11%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 1045
            APAF   AV +G   DI LSDY+GKY+VLFFYP DFTFVCPTEIIAFS+ A EFR INCEV+ CSTDS+F+H AW  TPRK+GG+G +DIPL+ADK+  +++ YGVL E  G+ FRGLFII +K  +RQIT+ND+PVGRS++ETLRLVQA QYTD +GEVCPA WKPG KT+      +++YF++T
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETT 193          
BLAST of Peroxiredoxin vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0345161)

HSP 1 Score: 265.388 bits (677), Expect = 1.669e-88
Identity = 120/186 (64.52%), Postives = 149/186 (80.11%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 1045
            APAF   AV +G   DI LSDY+GKY+VLFFYP DFTFVCPTEIIAFS+ A EFR INCEV+ CSTDS+F+H AW  TPRK+GG+G +DIPL+ADK+  +++ YGVL E  G+ FRGLFII +K  +RQIT+ND+PVGRS++ETLRLVQA QYTD +GEVCPA WKPG KT+      +++YF++T
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETT 193          
BLAST of Peroxiredoxin vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0339700)

HSP 1 Score: 265.388 bits (677), Expect = 1.669e-88
Identity = 120/186 (64.52%), Postives = 149/186 (80.11%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 1045
            APAF   AV +G   DI LSDY+GKY+VLFFYP DFTFVCPTEIIAFS+ A EFR INCEV+ CSTDS+F+H AW  TPRK+GG+G +DIPL+ADK+  +++ YGVL E  G+ FRGLFII +K  +RQIT+ND+PVGRS++ETLRLVQA QYTD +GEVCPA WKPG KT+      +++YF++T
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETT 193          
BLAST of Peroxiredoxin vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0073764)

HSP 1 Score: 265.388 bits (677), Expect = 1.669e-88
Identity = 120/186 (64.52%), Postives = 149/186 (80.11%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 1045
            APAF   AV +G   DI LSDY+GKY+VLFFYP DFTFVCPTEIIAFS+ A EFR INCEV+ CSTDS+F+H AW  TPRK+GG+G +DIPL+ADK+  +++ YGVL E  G+ FRGLFII +K  +RQIT+ND+PVGRS++ETLRLVQA QYTD +GEVCPA WKPG KT+      +++YF++T
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETT 193          
BLAST of Peroxiredoxin vs. Ensembl Fly
Match: Jafrac1 (gene:FBgn0040309 transcript:FBtr0073763)

HSP 1 Score: 265.388 bits (677), Expect = 1.669e-88
Identity = 120/186 (64.52%), Postives = 149/186 (80.11%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 1045
            APAF   AV +G   DI LSDY+GKY+VLFFYP DFTFVCPTEIIAFS+ A EFR INCEV+ CSTDS+F+H AW  TPRK+GG+G +DIPL+ADK+  +++ YGVL E  G+ FRGLFII +K  +RQIT+ND+PVGRS++ETLRLVQA QYTD +GEVCPA WKPG KT+      +++YF++T
Sbjct:    8 APAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETT 193          
BLAST of Peroxiredoxin vs. Ensembl Zebrafish
Match: prdx1 (peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-35])

HSP 1 Score: 281.567 bits (719), Expect = 1.050e-94
Identity = 130/187 (69.52%), Postives = 155/187 (82.89%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP F AKAV   G+  D+ LSDY+GKYVVLFFYP DFTFVCPTEIIAFSD A+EFR INCE++  S DS F H AWT TPRK+GG+G +++PL+AD  +SISK YGVLKE+EG+A+RGLFII +KG++RQITIND+PVGRSIDETLRLVQA Q+TD HGEVCPAGWKPG  TIKP +  ++D+F
Sbjct:    9 GKPAPDFTAKAVMPDGQFGDVRLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQFTDKHGEVCPAGWKPGKDTIKPDVNQSKDFF 195          
BLAST of Peroxiredoxin vs. Ensembl Zebrafish
Match: prdx1 (peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-35])

HSP 1 Score: 281.567 bits (719), Expect = 1.050e-94
Identity = 130/187 (69.52%), Postives = 155/187 (82.89%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP F AKAV   G+  D+ LSDY+GKYVVLFFYP DFTFVCPTEIIAFSD A+EFR INCE++  S DS F H AWT TPRK+GG+G +++PL+AD  +SISK YGVLKE+EG+A+RGLFII +KG++RQITIND+PVGRSIDETLRLVQA Q+TD HGEVCPAGWKPG  TIKP +  ++D+F
Sbjct:    9 GKPAPDFTAKAVMPDGQFGDVRLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQFTDKHGEVCPAGWKPGKDTIKPDVNQSKDFF 195          
BLAST of Peroxiredoxin vs. Ensembl Zebrafish
Match: prdx1 (peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-35])

HSP 1 Score: 281.567 bits (719), Expect = 1.050e-94
Identity = 130/187 (69.52%), Postives = 155/187 (82.89%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP F AKAV   G+  D+ LSDY+GKYVVLFFYP DFTFVCPTEIIAFSD A+EFR INCE++  S DS F H AWT TPRK+GG+G +++PL+AD  +SISK YGVLKE+EG+A+RGLFII +KG++RQITIND+PVGRSIDETLRLVQA Q+TD HGEVCPAGWKPG  TIKP +  ++D+F
Sbjct:    9 GKPAPDFTAKAVMPDGQFGDVRLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKINCEIIGASVDSHFCHLAWTKTPRKQGGLGPMNVPLVADTLRSISKDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSIDETLRLVQAFQFTDKHGEVCPAGWKPGKDTIKPDVNQSKDFF 195          
BLAST of Peroxiredoxin vs. Ensembl Zebrafish
Match: prdx2 (peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2])

HSP 1 Score: 280.411 bits (716), Expect = 2.915e-94
Identity = 127/186 (68.28%), Postives = 156/186 (83.87%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP F+A AV  G+  DI LSDY GKYVVLFFYP DFTFVCPTEIIAFS+RA EFR I  E++A STDS FSH AW  TPRK+GG+G ++IPL+AD T+SIS+ YGVLKE+EG+A+RGLF+I +KG++RQITIND+PVGRS+DETLRLVQA Q+TD +GEVCPAGWKPGS TI P ++ ++++F
Sbjct:    9 GQPAPQFKATAVVDGQFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSERAAEFRKIGVELIAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGIAYRGLFVIDDKGILRQITINDLPVGRSVDETLRLVQAFQHTDKYGEVCPAGWKPGSDTIVPDVQKSKEFF 194          
BLAST of Peroxiredoxin vs. Ensembl Zebrafish
Match: prdx4 (peroxiredoxin 4 [Source:NCBI gene;Acc:570477])

HSP 1 Score: 261.922 bits (668), Expect = 4.135e-86
Identity = 120/183 (65.57%), Postives = 144/183 (78.69%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            AP ++  AV +GE  ++ LSDY+GKY+V FFYP DFTFVCPTEIIAFSDR  EF+ IN EV+ACS DS+F+H AW  TPRK+GG+G + IPL++D T  ISK YGV  E++G   RGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA QYTD HGEVCPAGWKPGS TI P   G   YF
Sbjct:   74 APHWEGTAVINGEFKELKLSDYKGKYLVFFFYPLDFTFVCPTEIIAFSDRVHEFQAINAEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVFLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTIIPDPAGKLKYF 256          
BLAST of Peroxiredoxin vs. Ensembl Xenopus
Match: sox4 (SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727])

HSP 1 Score: 278.1 bits (710), Expect = 5.384e-93
Identity = 127/186 (68.28%), Postives = 156/186 (83.87%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  APAF+A AV +GE  DI LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A +F  INC+++A S DS+F+H AWT  PRK+GG+G ++IPL++D T SI+K YGVLKE +G+A+RGLFII  KG +RQITIND+PVGRS++ETLRLVQA QYTD HGEVCPAGWKPGS TIKP+++ ++++F
Sbjct:   17 GQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQLIAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGNLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFF 202          
BLAST of Peroxiredoxin vs. Ensembl Xenopus
Match: sox4 (SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727])

HSP 1 Score: 277.33 bits (708), Expect = 9.590e-92
Identity = 127/186 (68.28%), Postives = 156/186 (83.87%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  APAF+A AV +GE  DI LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A +F  INC+++A S DS+F+H AWT  PRK+GG+G ++IPL++D T SI+K YGVLKE +G+A+RGLFII  KG +RQITIND+PVGRS++ETLRLVQA QYTD HGEVCPAGWKPGS TIKP+++ ++++F
Sbjct:   80 GQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQLIAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGNLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFF 265          
BLAST of Peroxiredoxin vs. Ensembl Xenopus
Match: mfap3 (microfibril associated protein 3 [Source:Xenbase;Acc:XB-GENE-5784230])

HSP 1 Score: 266.544 bits (680), Expect = 1.533e-88
Identity = 120/187 (64.17%), Postives = 151/187 (80.75%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            GH AP F AKAV   G+  D+ +SDY+GKYVV FFYP DFTFVCPTEIIAFSDR +EF+ +NCEV+  S DS F H AW   PRK+GG+G ++IPL++D   +I+K YGV +E EG++FRGLFII  KG++RQITIND+PVGRS+DETLRLVQA Q+TD +GEVCPAGW+PGS TIKP ++ +++YF
Sbjct:    9 GHPAPDFTAKAVMPDGQFKDLKVSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRVEEFKKLNCEVIGASGDSHFCHLAWISQPRKEGGLGKMNIPLVSDVQHTIAKDYGVFEEKEGVSFRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKYGEVCPAGWQPGSDTIKPDVKKSKEYF 195          
BLAST of Peroxiredoxin vs. Ensembl Xenopus
Match: prdx1 (peroxiredoxin 1 [Source:NCBI gene;Acc:496551])

HSP 1 Score: 266.544 bits (680), Expect = 1.533e-88
Identity = 120/187 (64.17%), Postives = 151/187 (80.75%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            GH AP F AKAV   G+  D+ +SDY+GKYVV FFYP DFTFVCPTEIIAFSDR +EF+ +NCEV+  S DS F H AW   PRK+GG+G ++IPL++D   +I+K YGV +E EG++FRGLFII  KG++RQITIND+PVGRS+DETLRLVQA Q+TD +GEVCPAGW+PGS TIKP ++ +++YF
Sbjct:    9 GHPAPDFTAKAVMPDGQFKDLKVSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRVEEFKKLNCEVIGASGDSHFCHLAWISQPRKEGGLGKMNIPLVSDVQHTIAKDYGVFEEKEGVSFRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKYGEVCPAGWQPGSDTIKPDVKKSKEYF 195          
BLAST of Peroxiredoxin vs. Ensembl Xenopus
Match: sacm1l (SAC1 like phosphatidylinositide phosphatase [Source:Xenbase;Acc:XB-GENE-920710])

HSP 1 Score: 263.077 bits (671), Expect = 3.429e-86
Identity = 119/183 (65.03%), Postives = 145/183 (79.23%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            AP ++  AV +GE  ++ L+DY+GKY+V FFYP DFTFVCPTEIIAF DR +EFR IN EV+ACS DS+F+H AW  TPRK+GG+G + IPL++D T  ISK YGV  E++G   RGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA QYTD HGEVCPAGWKPGS+TI P   G   YF
Sbjct:   85 APYWEGTAVINGEFKELKLTDYKGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDTHGEVCPAGWKPGSETIIPDPAGKLKYF 267          
BLAST of Peroxiredoxin vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 280.796 bits (717), Expect = 2.322e-94
Identity = 128/188 (68.09%), Postives = 155/188 (82.45%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q G  AP F A AV  G   +I LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A++FR + CEVL  S DS+F+H AW  TPRK+GG+G L+IPL+AD TKS+S++YGVLK +EG+A+RGLFII  KG++RQIT+ND+PVGRS+DE LRLVQA QYTD HGEVCPAGWKPGS TIKP+++ +++YF
Sbjct:    7 QIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYF 194          
BLAST of Peroxiredoxin vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 280.796 bits (717), Expect = 2.322e-94
Identity = 128/188 (68.09%), Postives = 155/188 (82.45%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q G  AP F A AV  G   +I LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A++FR + CEVL  S DS+F+H AW  TPRK+GG+G L+IPL+AD TKS+S++YGVLK +EG+A+RGLFII  KG++RQIT+ND+PVGRS+DE LRLVQA QYTD HGEVCPAGWKPGS TIKP+++ +++YF
Sbjct:    7 QIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYF 194          
BLAST of Peroxiredoxin vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 280.796 bits (717), Expect = 2.322e-94
Identity = 128/188 (68.09%), Postives = 155/188 (82.45%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q G  AP F A AV  G   +I LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A++FR + CEVL  S DS+F+H AW  TPRK+GG+G L+IPL+AD TKS+S++YGVLK +EG+A+RGLFII  KG++RQIT+ND+PVGRS+DE LRLVQA QYTD HGEVCPAGWKPGS TIKP+++ +++YF
Sbjct:    7 QIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYF 194          
BLAST of Peroxiredoxin vs. Ensembl Mouse
Match: Prdx2 (peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486])

HSP 1 Score: 280.796 bits (717), Expect = 2.322e-94
Identity = 128/188 (68.09%), Postives = 155/188 (82.45%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q G  AP F A AV  G   +I LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A++FR + CEVL  S DS+F+H AW  TPRK+GG+G L+IPL+AD TKS+S++YGVLK +EG+A+RGLFII  KG++RQIT+ND+PVGRS+DE LRLVQA QYTD HGEVCPAGWKPGS TIKP+++ +++YF
Sbjct:    7 QIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYF 194          
BLAST of Peroxiredoxin vs. Ensembl Mouse
Match: Prdx1 (peroxiredoxin 1 [Source:MGI Symbol;Acc:MGI:99523])

HSP 1 Score: 269.24 bits (687), Expect = 9.396e-90
Identity = 121/187 (64.71%), Postives = 154/187 (82.35%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G+ AP F+A AV   G+  DISLS+Y+GKYVV FFYP DFTFVCPTEIIAFSDRA EF+ +NC+V+  S DS F H AW  TP+K+GG+G ++IPLI+D  ++I++ YGVLK +EG++FRGLFII +KG++RQITIND+PVGRS+DE +RLVQA Q+TD HGEVCPAGWKPGS TIKP +  +++YF
Sbjct:    9 GYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYF 195          
BLAST of Peroxiredoxin vs. UniProt/SwissProt
Match: sp|Q90384|TDX_CYNPY (Peroxiredoxin OS=Cynops pyrrhogaster OX=8330 PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 9.980e-94
Identity = 132/189 (69.84%), Postives = 155/189 (82.01%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q G  AP FQAKAV   GE  DI L+DY GKYVV FFYP DFTFVCPTEIIAFSDRA+EFR INCE++A S DS F H AWT T RK+GG+G + IPL+AD  ++IS+ YGVLKE+EG++FRGLFII +KG++RQITIND+PVGRS+DETLRLVQA Q+TD  GEVCPAGWKPGS TIKP I  +++YF
Sbjct:    7 QIGKPAPEFQAKAVMPGGEFKDIKLADYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFRKINCELIAASVDSHFCHLAWTNTSRKEGGLGSMKIPLVADTKRTISQDYGVLKEDEGISFRGLFIIDDKGILRQITINDLPVGRSVDETLRLVQAFQHTDKFGEVCPAGWKPGSDTIKPDISKSKEYF 195          
BLAST of Peroxiredoxin vs. UniProt/SwissProt
Match: sp|Q61171|PRDX2_MOUSE (Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 PE=1 SV=3)

HSP 1 Score: 280.796 bits (717), Expect = 1.625e-93
Identity = 128/188 (68.09%), Postives = 155/188 (82.45%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q G  AP F A AV  G   +I LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A++FR + CEVL  S DS+F+H AW  TPRK+GG+G L+IPL+AD TKS+S++YGVLK +EG+A+RGLFII  KG++RQIT+ND+PVGRS+DE LRLVQA QYTD HGEVCPAGWKPGS TIKP+++ +++YF
Sbjct:    7 QIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYF 194          
BLAST of Peroxiredoxin vs. UniProt/SwissProt
Match: sp|Q9BGI3|PRDX2_BOVIN (Peroxiredoxin-2 OS=Bos taurus OX=9913 GN=PRDX2 PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 3.094e-93
Identity = 126/193 (65.28%), Postives = 154/193 (79.79%), Query Frame = 2
Query:  458 CKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            C      G  AP FQA AV  G   ++ LSDY+GKYVVLFFYP DFTFVCPTEI+AFSDRA EF  +NCEVL  S DS+F+H AW  TPRK+GG+G L+IPL+AD T+ +S  YGVLKE+EG+A+RGLF+I  KG++RQ+TIND+PVGRS+DE LRLVQA QYTD HGEVCPAGW PGS TIKP+++ +++YF
Sbjct:    3 CVCKAHVGKPAPEFQATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIVAFSDRAAEFHKLNCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRKLSSDYGVLKEDEGIAYRGLFVIDGKGVLRQVTINDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWTPGSDTIKPNVDDSKEYF 195          
BLAST of Peroxiredoxin vs. UniProt/SwissProt
Match: sp|Q6B4U9|PRDX1_MYOLU (Peroxiredoxin-1 OS=Myotis lucifugus OX=59463 GN=PRDX1 PE=1 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.638e-92
Identity = 124/187 (66.31%), Postives = 157/187 (83.96%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            GH AP F+A AV   G+  DISLSDY+GKYVV FFYP DFTFVCPTEIIAFSDRA+EF+ INC+V+  S DS F H AW  TP+K+GG+G ++IPL++D  ++I++ YGVLK +EG++FRGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA Q+TD HGEVCPAGWKPGS TIKP ++ +++YF
Sbjct:    9 GHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKINCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYF 195          
BLAST of Peroxiredoxin vs. UniProt/SwissProt
Match: sp|Q06830|PRDX1_HUMAN (Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 2.424e-92
Identity = 123/187 (65.78%), Postives = 157/187 (83.96%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            GH AP F+A AV   G+  DISLSDY+GKYVV FFYP DFTFVCPTEIIAFSDRA+EF+ +NC+V+  S DS F H AW  TP+K+GG+G ++IPL++D  ++I++ YGVLK +EG++FRGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA Q+TD HGEVCPAGWKPGS TIKP ++ +++YF
Sbjct:    9 GHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYF 195          
BLAST of Peroxiredoxin vs. TrEMBL
Match: A0A0B4L994 (Peroxiredoxin OS=Macrobrachium nipponense OX=159736 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 9.821e-96
Identity = 133/185 (71.89%), Postives = 157/185 (84.86%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKS 1042
            AP F+  AV  G+  +ISL+DY+GKYVV FFYP DFTFVCPTEIIAFSDR QEFRDINCEV+ACSTDS FSH AW  TPRK+GG+G ++IPL+ADK+  ISKSYGVLKE +G+AFRGLFII +KG +RQ TIND+PVGR +DETLRLVQA Q+TD HGEVCPAGWKPGSKT+K    G+++YF+S
Sbjct:   12 APVFKGTAVVDGQFQEISLADYQGKYVVFFFYPLDFTFVCPTEIIAFSDRVQEFRDINCEVIACSTDSHFSHLAWINTPRKEGGLGTMNIPLLADKSMEISKSYGVLKEEDGIAFRGLFIIDDKGNLRQATINDLPVGRDVDETLRLVQAFQFTDEHGEVCPAGWKPGSKTMKADPTGSKEYFQS 196          
BLAST of Peroxiredoxin vs. TrEMBL
Match: A0A0K1RMV1 (Peroxiredoxin OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.292e-95
Identity = 131/184 (71.20%), Postives = 159/184 (86.41%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            AP F+  AV  G+  DISL+DY GKY+V+FFYP DFTFVCPTEIIAFSDR +EFR INCEV+ACSTDS+FSH AW  TPRK+GG+G + IPL+ADKT  ISK+YGV KE+EG+AFRGLFII  KG +RQITIND+PVGRS+DETLRLVQA Q+TD HGEVCPAGW+PG++TIKPS++G++ +F+
Sbjct:   12 APEFRGTAVVDGDFKDISLADYRGKYLVIFFYPMDFTFVCPTEIIAFSDRVEEFRAINCEVVACSTDSQFSHLAWINTPRKQGGLGNMKIPLLADKTMEISKAYGVYKEDEGIAFRGLFIIDGKGNLRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWRPGAETIKPSVKGSQSFFQ 195          
BLAST of Peroxiredoxin vs. TrEMBL
Match: W5MMI9 (Peroxiredoxin 2 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.130e-95
Identity = 132/186 (70.97%), Postives = 158/186 (84.95%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP FQA AV  G+  +I LSDY GKYVV FFYP DFTFVCPTEI+AFSDRA+EFR INCEV+A STDS+FSH AWT TPRK GG+G + IPL+AD T+SIS+ YGVLKE+EG+A+RGLF+I +KG++RQITIND+PVGRS+DETLRLVQA Q+TD HGEVCPAGWKPGS TI P ++ +++YF
Sbjct:    9 GKPAPHFQATAVVDGQFKEIKLSDYRGKYVVFFFYPLDFTFVCPTEIVAFSDRAEEFRKINCEVIAASTDSQFSHLAWTNTPRKVGGLGAMKIPLVADLTQSISQDYGVLKEDEGIAYRGLFVIDDKGILRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIVPDVQKSKEYF 194          
BLAST of Peroxiredoxin vs. TrEMBL
Match: D3K380 (Peroxiredoxin OS=Pinctada fucata OX=50426 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 5.102e-95
Identity = 130/184 (70.65%), Postives = 158/184 (85.87%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
             P F+  AV  G+  DISL+DY GKY+V+FFYP DFTFVCPTEIIAFSDR +EFR INCEV+ACSTDS+FSH AW  TPRK+GG+G + IPL+ADKT  ISK+YGV KE+EG+AFRGLFII  KG +RQITIND+PVGRS+DETLRLVQA Q+TD HGEVCPAGW+PG++TIKPS++G++ +F+
Sbjct:   12 TPEFRGTAVVDGDFKDISLADYRGKYLVIFFYPMDFTFVCPTEIIAFSDRVEEFRAINCEVVACSTDSQFSHLAWINTPRKQGGLGNMKIPLLADKTMEISKAYGVYKEDEGIAFRGLFIIDGKGNLRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWRPGAETIKPSVKGSQSFFQ 195          
BLAST of Peroxiredoxin vs. TrEMBL
Match: A0A401SFW5 (Thioredoxin domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0007727 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 6.703e-95
Identity = 134/188 (71.28%), Postives = 159/188 (84.57%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            G  AP F AKAV  SGE  D++LS Y+GKYVVLFFYP DFTFVCPTEIIAFSDRA EFR INCEV+  STDS FSH AWT TPRK+GG+G +DIPL+AD T+SI+K YG+LKE+EG+A+RGLFII  KG++RQITIND+PVGRS+DETLRLVQA Q+TD HGEVCPAGWKPG  TIKP++  ++ +F+
Sbjct:   37 GQTAPDFTAKAVMPSGEFEDLTLSKYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAAEFRKINCEVIGASTDSHFSHLAWTKTPRKQGGIGHMDIPLVADLTQSIAKDYGILKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGQDTIKPNVNESKKFFE 224          
BLAST of Peroxiredoxin vs. Ensembl Cavefish
Match: prdx1 (peroxiredoxin-1 [Source:NCBI gene;Acc:103023705])

HSP 1 Score: 285.419 bits (729), Expect = 3.576e-96
Identity = 130/187 (69.52%), Postives = 155/187 (82.89%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            GH+AP F AKAV   G+  D+ LSDY GKYVVLFFYP DFTFVCPTEIIAFSD A+EFR I+CEV+  S DS F H AW  TPRK+GG+G +++PL+AD  ++IS+ YGVLKE+EG+AFRGLFII +KG +RQITIND+PVGRSIDETLRLVQA QYTD HGEVCPAGWKPG  TIKP ++ ++D+F
Sbjct:    9 GHLAPDFTAKAVMPDGQFKDLKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDAAEEFRKIDCEVIGASVDSHFCHLAWINTPRKQGGLGHMNVPLVADTLRTISRDYGVLKEDEGIAFRGLFIIDDKGTLRQITINDLPVGRSIDETLRLVQAFQYTDKHGEVCPAGWKPGKDTIKPDVQKSKDFF 195          
BLAST of Peroxiredoxin vs. Ensembl Cavefish
Match: ENSAMXT00000019565.2 (peroxiredoxin-1 [Source:NCBI gene;Acc:103031813])

HSP 1 Score: 279.256 bits (713), Expect = 9.699e-94
Identity = 128/192 (66.67%), Postives = 157/192 (81.77%), Query Frame = 2
Query:  461 KMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            ++ L  G  AP F+A AV +GE  DI LSDY GKYVVLFFYP DFTFVCPTEIIAFS+ A +F DI C+V+A STDS FSH AW  TPRK+GG+G ++IPL+AD T+SIS+ YGVLKE+EG+AFRGLF+I +KG++RQITIND+PVGRS+DETLRLV+A QYTD HGEVCPA W+PG  TI P ++ ++ YF
Sbjct:    7 RLRLSIGQPAPQFKATAVVNGEFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSESADKFSDIKCQVIAASTDSHFSHLAWINTPRKQGGLGPMNIPLVADLTQSISRDYGVLKEDEGIAFRGLFLIDDKGILRQITINDLPVGRSVDETLRLVKAFQYTDKHGEVCPANWEPGKDTIIPGVQESKKYF 198          
BLAST of Peroxiredoxin vs. Ensembl Cavefish
Match: ENSAMXT00000019562.2 (peroxiredoxin-1 [Source:NCBI gene;Acc:103031813])

HSP 1 Score: 278.87 bits (712), Expect = 1.135e-93
Identity = 127/186 (68.28%), Postives = 154/186 (82.80%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP F+A AV +GE  DI LSDY GKYVVLFFYP DFTFVCPTEIIAFS+ A +F DI C+V+A STDS FSH AW  TPRK+GG+G ++IPL+AD T+SIS+ YGVLKE+EG+AFRGLF+I +KG++RQITIND+PVGRS+DETLRLV+A QYTD HGEVCPA W+PG  TI P ++ ++ YF
Sbjct:    9 GQPAPQFKATAVVNGEFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSESADKFSDIKCQVIAASTDSHFSHLAWINTPRKQGGLGPMNIPLVADLTQSISRDYGVLKEDEGIAFRGLFLIDDKGILRQITINDLPVGRSVDETLRLVKAFQYTDKHGEVCPANWEPGKDTIIPGVQESKKYF 194          
BLAST of Peroxiredoxin vs. Ensembl Cavefish
Match: prdx4 (peroxiredoxin 4 [Source:NCBI gene;Acc:103026884])

HSP 1 Score: 259.225 bits (661), Expect = 5.013e-85
Identity = 119/183 (65.03%), Postives = 142/183 (77.60%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            AP ++  AV +GE  ++ LSDY+GKY+V FFYP DFTFVCPTEIIAFSDR  EF  IN +V+ACS DS+F+H AW  TPRK+GG+G + IPL++D T  ISK YGV  E++G   RGLFII +KG +RQIT+ND+PVGRS+DETLRLVQA QYTD HGEVCPAGWKPGS TI P   G   YF
Sbjct:   77 APKWEGTAVINGEFKELKLSDYKGKYLVFFFYPLDFTFVCPTEIIAFSDRVHEFHAINADVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDDKGTLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTIIPDPSGKLKYF 259          
BLAST of Peroxiredoxin vs. Ensembl Cavefish
Match: prdx3 (peroxiredoxin 3 [Source:NCBI gene;Acc:103033576])

HSP 1 Score: 257.299 bits (656), Expect = 1.724e-84
Identity = 113/184 (61.41%), Postives = 144/184 (78.26%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            AP F+  AV  GE  DISL DY+GKY+VLFFYP DFTFVCPTEII+FSD+A EF DINC V+  S DS F+H AWT TPRK GG+G ++IPL+AD  K +S+ YGVL E  G+A RGLFII   G+I+ +++ND+PVGRS++ETLRLV+A Q+ + HGEVCPA W P S TIKP+ +G+++YF+
Sbjct:   64 APHFKGTAVHKGEFKDISLDDYKGKYLVLFFYPLDFTFVCPTEIISFSDKASEFHDINCAVVGVSVDSHFTHLAWTNTPRKSGGLGKINIPLLADLNKQVSRDYGVLLEGPGIALRGLFIIDPNGVIKHMSVNDLPVGRSVEETLRLVKAFQFVESHGEVCPASWTPKSPTIKPTPQGSKEYFE 247          
BLAST of Peroxiredoxin vs. Ensembl Sea Lamprey
Match: prdx2 (peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2])

HSP 1 Score: 267.7 bits (683), Expect = 5.572e-90
Identity = 120/186 (64.52%), Postives = 153/186 (82.26%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G  AP F   AV +G   DI LS+Y+GKYVVLFFYP DFTFVCPTEIIAF+DR  EF  ++C V+A STDS+FSH AW  TPRK+GG+G ++IPL+AD+T +++K+YGVLKE+EG+A+RGLFII  KG++RQITIND+PVGR +DE LRLVQA ++TD HGEVCPAGWKPG  TIKP ++ ++++F
Sbjct:    9 GKPAPDFSGVAVVNGAFKDIKLSNYKGKYVVLFFYPLDFTFVCPTEIIAFNDRLPEFTKLDCAVIAASTDSQFSHLAWVNTPRKQGGLGHMEIPLLADRTCNVAKNYGVLKEDEGIAYRGLFIIDGKGILRQITINDLPVGRDVDEILRLVQAFKFTDDHGEVCPAGWKPGKDTIKPDVQKSKEFF 194          
BLAST of Peroxiredoxin vs. Ensembl Sea Lamprey
Match: prdx3 (peroxiredoxin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-18])

HSP 1 Score: 243.047 bits (619), Expect = 4.487e-80
Identity = 106/184 (57.61%), Postives = 143/184 (77.72%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            AP F+A AV  G+  ++SL D++G+Y+VLFFYP DFTFVCPTEIIAFS++A EF  INC+V+  S DS FSH AW  TPRK GG+G ++IPL++D +K+ISK YGVL E  G+A RGLF+I   G++R  ++ND+PVGRS++ETLRLV+A Q+ + HGEVCPA W P + TIKP+ + + +YF+
Sbjct:   24 APHFKATAVDDGKFRELSLDDFKGQYLVLFFYPLDFTFVCPTEIIAFSEKANEFHQINCQVVGVSVDSHFSHLAWINTPRKAGGLGHMNIPLLSDFSKNISKDYGVLLEEAGVALRGLFLIDPNGVVRHASVNDLPVGRSVEETLRLVKAFQFVEEHGEVCPANWTPEAPTIKPNPQDSLEYFE 207          
BLAST of Peroxiredoxin vs. Ensembl Yeast
Match: TSA1 (Thioredoxin peroxidase; acts as both ribosome-associated and free cytoplasmic antioxidant; self-associates to form high-molecular weight chaperone complex under oxidative stress; chaperone activity essential for growth in zinc deficiency; required for telomere length maintenance; binds and modulates Cdc19p activity; protein abundance increases, forms cytoplasmic foci during DNA replication stress; TSA1 has a paralog, TSA2, that arose from the whole genome duplication [Source:SGD;Acc:S000004490])

HSP 1 Score: 228.409 bits (581), Expect = 8.797e-75
Identity = 106/185 (57.30%), Postives = 139/185 (75.14%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKS 1042
            AP F+  AV  G   ++SL  Y+GKYVVL F P  FTFVCPTEIIAFS+ A++F +   +VL  STDSE+S  AWT  PRK+GG+G ++IPL+AD   S+S+ YGVL E EG+A RGLFII  KG+IR ITIND+PVGR++DE LRLV+A Q+TD +G V P  W PG+ TIKP++E +++YF++
Sbjct:    9 APTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEA 193          
BLAST of Peroxiredoxin vs. Ensembl Yeast
Match: TSA2 (Stress inducible cytoplasmic thioredoxin peroxidase; cooperates with Tsa1p in the removal of reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; deletion enhances the mutator phenotype of tsa1 mutants; protein abundance increases in response to DNA replication stress; TSA2 has a paralog, TSA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002861])

HSP 1 Score: 222.246 bits (565), Expect = 2.521e-72
Identity = 104/185 (56.22%), Postives = 135/185 (72.97%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKS 1042
            AP F+  AV  G   +ISL  Y+GKYVVL F P  F+FVCPTEI+AFSD A++F D   +VL  STDSE+S  AWT  PRK GG+G + +PL+ADK  S+S+ YGVL E EG+A RGLFII  KG+IR ITIND+ VGR+++E LRLV+  Q+TD +G V P  W PG+ TIKP ++ +++YFK+
Sbjct:    9 APPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATIKPDVKDSKEYFKN 193          
BLAST of Peroxiredoxin vs. Ensembl Yeast
Match: PRX1 (Mitochondrial peroxiredoxin with thioredoxin peroxidase activity; has a role in reduction of hydroperoxides; reactivation requires Trr2p and glutathione; induced during respiratory growth and oxidative stress; phosphorylated; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000160])

HSP 1 Score: 90.8929 bits (224), Expect = 1.778e-21
Identity = 65/204 (31.86%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  446 YKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEG-KYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKE------NEG--MAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKT-IKPSIEGAE 1027
            +K   +  L+    AP F A       +  I+  DY G  + VLF +PADFT VC TE+ AF+    EF   N +++  S +   SH  W    ++   V  +  P+I D  ++++  Y ++        N+G     R +F+I  K  IR I      VGR+  E LR++ ALQ TD  G V P  W+P     I PS+   E
Sbjct:   41 FKQSDQPRLRINSDAPNFDADTT----VGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDE 240          
BLAST of Peroxiredoxin vs. Ensembl Nematostella
Match: EDO48197 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK73])

HSP 1 Score: 279.256 bits (713), Expect = 2.349e-94
Identity = 127/184 (69.02%), Postives = 153/184 (83.15%), Query Frame = 2
Query:  488 APAFQAKAV-QSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            APAF   AV + GE ID+ LSDY+GKYVVLFFYP DFTFVCPTEIIAFSDR  EF+ INCEV+ACS DSE+SH AWT  PRKKGG+G ++IP+++D TK ISK YGVL E++G+A RGLFII +KG++RQITIND+PVGRS+DETLRL+QA Q+TD HGEVCPAGW+PG+ TI P  + +  YF
Sbjct:   10 APAFSGTAVNKHGEFIDLKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRVDEFKAINCEVIACSVDSEYSHLAWTNVPRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIIDDKGILRQITINDLPVGRSVDETLRLIQAFQFTDKHGEVCPAGWRPGADTIIPEPQKSSSYF 193          
BLAST of Peroxiredoxin vs. Ensembl Nematostella
Match: EDO38694 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC77])

HSP 1 Score: 257.299 bits (656), Expect = 6.228e-85
Identity = 118/184 (64.13%), Postives = 142/184 (77.17%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            AP ++  AV +GE  ++ LSD+EGKY+V FFYP DFTFVCPTEIIAFSDR +EFR IN EV+ CS DS F+H AW  +PRK+GG+G L  PL++D    +SK YGVL ENEG   RGLFII +KG++RQIT+ND+PVGRS+DETLRLVQA QYTD HGEVCPAGWKPG  TI P     + YF+
Sbjct:   60 APFWEGTAVVNGEFKELKLSDFEGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVGCSVDSVFTHLAWINSPRKEGGLGNLKYPLLSDINHQVSKDYGVLLENEGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGKDTIIPDPTQKKKYFE 243          
BLAST of Peroxiredoxin vs. Ensembl Nematostella
Match: EDO28895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T568])

HSP 1 Score: 106.686 bits (265), Expect = 1.178e-27
Identity = 55/108 (50.93%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  716 GTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
             +PRK+GG+G L  PL++D    +SK YGVL ENEG               ++ T+    VGRS+DETLRLVQA QYTD HGEVCPAGWKPG  TI P     + YF+
Sbjct:   76 NSPRKEGGLGNLKYPLLSDINHQVSKDYGVLLENEGHTLS----------YQECTLK--LVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGKDTIIPDPTQKKKYFE 171          
BLAST of Peroxiredoxin vs. Ensembl Nematostella
Match: EDO47205 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT9])

HSP 1 Score: 69.3218 bits (168), Expect = 9.594e-14
Identity = 54/199 (27.14%), Postives = 88/199 (44.22%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQSGEIIDISLSDY-EGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRK-----KGGVGILDIPLIADKTKSISKSYGVL----KENEGMAF--RGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSK-----TIKPSIEGA 1024
            G   P F A +     I  I+  D+ +  + +LF +PAD+T VC TE+   +    EF+    ++   S D   SH  W     K            + P+IAD+ + ++   G++    K+++G+    R +FII     ++   +     GR+ DE LR++ +LQ T       P  WK G       +IKP  EG 
Sbjct:    5 GDEFPNFTADST----IGTINFHDFIKDSWAILFSHPADYTPVCTTELGRVAQLEPEFKKRGVKMAGLSCDDAESHRGWVKDITKYNLEQNKSSAKFNYPIIADERRELAVKLGMVDPDEKDSKGLPLTCRAVFIIGPDKKLKLSILYPATTGRNFDEILRVIDSLQLTATKKVATPVDWKLGGDCMVIPSIKPEEEGT 199          
BLAST of Peroxiredoxin vs. Ensembl Medaka
Match: prdx1 (peroxiredoxin-1 [Source:NCBI gene;Acc:101175597])

HSP 1 Score: 280.796 bits (717), Expect = 2.021e-94
Identity = 128/187 (68.45%), Postives = 155/187 (82.89%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G +AP F AKAV   G+  D+ LSDY GKYVV FFYP DFTFVCPTEIIAFSD A +FR I CEV+A S DS FSHFAWT TPRK+GG+G + IPL++D  ++IS  YGVLKE+EG+A+RGLFII +KG++RQITIND+PVGRS++ETLRLVQA Q+TD HGEVCPAGWKPGS TIKP ++ ++D+F
Sbjct:    9 GSLAPDFTAKAVMPDGQFKDLKLSDYRGKYVVFFFYPLDFTFVCPTEIIAFSDAADDFRKIGCEVIAASVDSHFSHFAWTNTPRKQGGLGSMKIPLVSDTRRTISTDYGVLKEDEGIAYRGLFIIDDKGVLRQITINDLPVGRSVEETLRLVQAFQFTDEHGEVCPAGWKPGSDTIKPDVQKSKDFF 195          
BLAST of Peroxiredoxin vs. Ensembl Medaka
Match: prdx1 (peroxiredoxin-1 [Source:NCBI gene;Acc:101175597])

HSP 1 Score: 280.796 bits (717), Expect = 2.021e-94
Identity = 128/187 (68.45%), Postives = 155/187 (82.89%), Query Frame = 2
Query:  479 GHIAPAFQAKAVQ-SGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            G +AP F AKAV   G+  D+ LSDY GKYVV FFYP DFTFVCPTEIIAFSD A +FR I CEV+A S DS FSHFAWT TPRK+GG+G + IPL++D  ++IS  YGVLKE+EG+A+RGLFII +KG++RQITIND+PVGRS++ETLRLVQA Q+TD HGEVCPAGWKPGS TIKP ++ ++D+F
Sbjct:    9 GSLAPDFTAKAVMPDGQFKDLKLSDYRGKYVVFFFYPLDFTFVCPTEIIAFSDAADDFRKIGCEVIAASVDSHFSHFAWTNTPRKQGGLGSMKIPLVSDTRRTISTDYGVLKEDEGIAYRGLFIIDDKGVLRQITINDLPVGRSVEETLRLVQAFQFTDEHGEVCPAGWKPGSDTIKPDVQKSKDFF 195          
BLAST of Peroxiredoxin vs. Ensembl Medaka
Match: prdx2 (peroxiredoxin 2 [Source:NCBI gene;Acc:101170008])

HSP 1 Score: 280.411 bits (716), Expect = 2.798e-94
Identity = 127/188 (67.55%), Postives = 154/188 (81.91%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q G  AP F+A AV  G+  D+ LSDY+GKYVV FFYP DFTFVCPTEIIAFSDRA+EFR I CEV+ CS DS FSH AW  TPRK+GG+G + IPL+AD TKSIS+ YGVLKE++G+A+RGLF+I   G++RQITIND+PVGRS+DETLRL+QA Q+TD +GEVCPAGWKPGS TI P +E ++ +F
Sbjct:    7 QIGQPAPDFKATAVVDGQFKDLKLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFRKIGCEVIGCSVDSHFSHLAWINTPRKQGGLGSMKIPLVADLTKSISRDYGVLKEDDGIAYRGLFVIDGNGVLRQITINDLPVGRSVDETLRLIQAFQHTDKYGEVCPAGWKPGSDTIVPDVEKSKAFF 194          
BLAST of Peroxiredoxin vs. Ensembl Medaka
Match: prdx4 (peroxiredoxin-4 [Source:NCBI gene;Acc:101166157])

HSP 1 Score: 266.159 bits (679), Expect = 7.941e-88
Identity = 122/183 (66.67%), Postives = 144/183 (78.69%), Query Frame = 2
Query:  488 APAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            AP ++  AV +GE  ++ LSDY+GKY+V FFYP DFTFVCPTEIIAFSDR  EFR IN EV+ACS DS+F+H AW  TPRK+GG+G + IPL++D T  ISK YGV  E++G   RGLFII NKG++RQIT+ND+PVGRS+DETLRLVQA QYTD HGEVCPAGWKPGS TI P   G   YF
Sbjct:   71 APHWEGTAVINGEFKELKLSDYKGKYLVFFFYPLDFTFVCPTEIIAFSDRVHEFRAINTEVVACSVDSQFTHLAWINTPRKQGGLGEMKIPLLSDLTHQISKDYGVYLEDQGHTLRGLFIIDNKGILRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTIIPDPSGKLKYF 253          
BLAST of Peroxiredoxin vs. Ensembl Medaka
Match: prdx3 (peroxiredoxin 3 [Source:NCBI gene;Acc:101157243])

HSP 1 Score: 258.455 bits (659), Expect = 5.596e-85
Identity = 117/206 (56.80%), Postives = 150/206 (72.82%), Query Frame = 2
Query:  422 AKLNRKYMYKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            A L R     S  +        APAF+A AV +GE  D+SL+D++GKY+VLFFYP DFTFVCPTEII+FSD+A EF DINCEV+  S DS F+H AW  TPRK GG+G + IPL++D  K IS+ YGVL E  G+A RGLFII   G++R +++ND+PVGR +DETLRLV+A Q+ + HGEVCPA W P S TIKP+  G+++YF+
Sbjct:   41 AALQRSSFSTSASRWAPAVTQPAPAFKATAVHNGEFKDLSLADFKGKYLVLFFYPLDFTFVCPTEIISFSDKASEFHDINCEVVGVSVDSHFTHLAWINTPRKAGGLGNIHIPLLSDLNKQISRDYGVLLEAPGIALRGLFIIDPNGVVRHMSVNDLPVGRCVDETLRLVRAFQFVETHGEVCPASWTPDSPTIKPTPHGSKEYFE 246          
BLAST of Peroxiredoxin vs. Planmine SMEST
Match: SMESG000001807.1 (SMESG000001807.1)

HSP 1 Score: 417.927 bits (1073), Expect = 1.420e-148
Identity = 200/201 (99.50%), Postives = 201/201 (100.00%), Query Frame = 2
Query:  443 MYKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 1045
            MYKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAF+DRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST
Sbjct:    1 MYKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFNDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 201          
BLAST of Peroxiredoxin vs. Planmine SMEST
Match: SMESG000001807.1 (SMESG000001807.1)

HSP 1 Score: 401.749 bits (1031), Expect = 3.121e-142
Identity = 193/194 (99.48%), Postives = 194/194 (100.00%), Query Frame = 2
Query:  464 MPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 1045
            MPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAF+DRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST
Sbjct:    1 MPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFNDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKST 194          
BLAST of Peroxiredoxin vs. Planmine SMEST
Match: SMESG000024235.1 (SMESG000024235.1)

HSP 1 Score: 263.848 bits (673), Expect = 5.958e-88
Identity = 116/190 (61.05%), Postives = 152/190 (80.00%), Query Frame = 2
Query:  470 LQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            L P   AP F++ AV +GE ++ SLS ++GK++VLFFYP DFTFVCPTEI+AFSDR +EF+  NCEV+ CSTDSE+SH AWT   R  GG+G ++ PL++DK+ SIS++YGV+K N G+AFRGLFI+ N  +IRQITINDMP+GRS+DE LRLV A+Q+ D  GEVCPA W+ G KTIKP+++ ++DYFK
Sbjct:    6 LLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 195          
BLAST of Peroxiredoxin vs. Planmine SMEST
Match: SMESG000024235.1 (SMESG000024235.1)

HSP 1 Score: 263.462 bits (672), Expect = 1.047e-87
Identity = 116/190 (61.05%), Postives = 152/190 (80.00%), Query Frame = 2
Query:  470 LQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFK 1039
            L P   AP F++ AV +GE ++ SLS ++GK++VLFFYP DFTFVCPTEI+AFSDR +EF+  NCEV+ CSTDSE+SH AWT   R  GG+G ++ PL++DK+ SIS++YGV+K N G+AFRGLFI+ N  +IRQITINDMP+GRS+DE LRLV A+Q+ D  GEVCPA W+ G KTIKP+++ ++DYFK
Sbjct:   14 LLPSEKAPDFKSTAVMNGEFVECSLSQFKGKFLVLFFYPLDFTFVCPTEIVAFSDRIEEFKSRNCEVVGCSTDSEYSHLAWTKLSRNDGGLGAINFPLLSDKSHSISEAYGVIKGNTGVAFRGLFILDNNSVIRQITINDMPIGRSVDEVLRLVDAIQFYDNVGEVCPANWRKGDKTIKPNVKDSKDYFK 203          
BLAST of Peroxiredoxin vs. Planmine SMEST
Match: SMESG000066780.1 (SMESG000066780.1)

HSP 1 Score: 251.521 bits (641), Expect = 2.529e-82
Identity = 116/188 (61.70%), Postives = 139/188 (73.94%), Query Frame = 2
Query:  473 QPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPADFTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGVGILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDMPVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYF 1036
            Q   +AP F+  AV +G   DI L D+ GKY+V FFYP DFTFVCPTEIIAFSDR +EF DIN  V+ CS DS+F+H AW  TPR +GG+G +  PL++D +  ISK YGV  E  G A RGLFII  KG++RQIT+ND+PVGRS+DETLRLVQA QYTD HGEVCPAGWKPG+ TI P     ++YF
Sbjct:   53 QISKLAPHFEGTAVVNGSFQDIKLKDFLGKYLVFFFYPLDFTFVCPTEIIAFSDRIKEFHDINTNVVGCSVDSQFTHLAWLNTPRNQGGLGQILYPLLSDLSHQISKDYGVYLEEAGHALRGLFIIDTKGILRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGADTIIPDPIKKKEYF 240          
The following BLAST results are available for this feature:
BLAST of Peroxiredoxin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRDX15.048e-9365.78peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352][more]
PRDX15.048e-9365.78peroxiredoxin 1 [Source:HGNC Symbol;Acc:HGNC:9352][more]
PRDX21.373e-9266.67peroxiredoxin 2 [Source:HGNC Symbol;Acc:HGNC:9353][more]
PRDX32.031e-8557.92peroxiredoxin 3 [Source:HGNC Symbol;Acc:HGNC:9354][more]
PRDX41.048e-8464.48peroxiredoxin 4 [Source:HGNC Symbol;Acc:HGNC:17169... [more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx-22.491e-9264.82PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-25.652e-9267.38PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-26.529e-9267.38PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-26.529e-9267.38PeRoxireDoXin [Source:UniProtKB/TrEMBL;Acc:H2KZL7... [more]
prdx-33.447e-7956.54Probable peroxiredoxin prdx-3 [Source:UniProtKB/S... [more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jafrac11.669e-8864.52gene:FBgn0040309 transcript:FBtr0339699[more]
Jafrac11.669e-8864.52gene:FBgn0040309 transcript:FBtr0345161[more]
Jafrac11.669e-8864.52gene:FBgn0040309 transcript:FBtr0339700[more]
Jafrac11.669e-8864.52gene:FBgn0040309 transcript:FBtr0073764[more]
Jafrac11.669e-8864.52gene:FBgn0040309 transcript:FBtr0073763[more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx11.050e-9469.52peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-3... [more]
prdx11.050e-9469.52peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-3... [more]
prdx11.050e-9469.52peroxiredoxin 1 [Source:ZFIN;Acc:ZDB-GENE-050320-3... [more]
prdx22.915e-9468.28peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2... [more]
prdx44.135e-8665.57peroxiredoxin 4 [Source:NCBI gene;Acc:570477][more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox45.384e-9368.28SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727][more]
sox49.590e-9268.28SRY-box 4 [Source:Xenbase;Acc:XB-GENE-480727][more]
mfap31.533e-8864.17microfibril associated protein 3 [Source:Xenbase;A... [more]
prdx11.533e-8864.17peroxiredoxin 1 [Source:NCBI gene;Acc:496551][more]
sacm1l3.429e-8665.03SAC1 like phosphatidylinositide phosphatase [Sourc... [more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prdx22.322e-9468.09peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx22.322e-9468.09peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx22.322e-9468.09peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx22.322e-9468.09peroxiredoxin 2 [Source:MGI Symbol;Acc:MGI:109486][more]
Prdx19.396e-9064.71peroxiredoxin 1 [Source:MGI Symbol;Acc:MGI:99523][more]
back to top
BLAST of Peroxiredoxin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90384|TDX_CYNPY9.980e-9469.84Peroxiredoxin OS=Cynops pyrrhogaster OX=8330 PE=2 ... [more]
sp|Q61171|PRDX2_MOUSE1.625e-9368.09Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 ... [more]
sp|Q9BGI3|PRDX2_BOVIN3.094e-9365.28Peroxiredoxin-2 OS=Bos taurus OX=9913 GN=PRDX2 PE=... [more]
sp|Q6B4U9|PRDX1_MYOLU1.638e-9266.31Peroxiredoxin-1 OS=Myotis lucifugus OX=59463 GN=PR... [more]
sp|Q06830|PRDX1_HUMAN2.424e-9265.78Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 P... [more]
back to top
BLAST of Peroxiredoxin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B4L9949.821e-9671.89Peroxiredoxin OS=Macrobrachium nipponense OX=15973... [more]
A0A0K1RMV11.292e-9571.20Peroxiredoxin OS=Pinctada fucata OX=50426 PE=4 SV=... [more]
W5MMI92.130e-9570.97Peroxiredoxin 2 OS=Lepisosteus oculatus OX=7918 PE... [more]
D3K3805.102e-9570.65Peroxiredoxin OS=Pinctada fucata OX=50426 PE=2 SV=... [more]
A0A401SFW56.703e-9571.28Thioredoxin domain-containing protein OS=Chiloscyl... [more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx13.576e-9669.52peroxiredoxin-1 [Source:NCBI gene;Acc:103023705][more]
ENSAMXT00000019565.29.699e-9466.67peroxiredoxin-1 [Source:NCBI gene;Acc:103031813][more]
ENSAMXT00000019562.21.135e-9368.28peroxiredoxin-1 [Source:NCBI gene;Acc:103031813][more]
prdx45.013e-8565.03peroxiredoxin 4 [Source:NCBI gene;Acc:103026884][more]
prdx31.724e-8461.41peroxiredoxin 3 [Source:NCBI gene;Acc:103033576][more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prdx25.572e-9064.52peroxiredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-030326-2... [more]
prdx34.487e-8057.61peroxiredoxin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-1... [more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TSA18.797e-7557.30Thioredoxin peroxidase; acts as both ribosome-asso... [more]
TSA22.521e-7256.22Stress inducible cytoplasmic thioredoxin peroxidas... [more]
PRX11.778e-2131.86Mitochondrial peroxiredoxin with thioredoxin perox... [more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO481972.349e-9469.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386946.228e-8564.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288951.178e-2750.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472059.594e-1427.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peroxiredoxin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdx12.021e-9468.45peroxiredoxin-1 [Source:NCBI gene;Acc:101175597][more]
prdx12.021e-9468.45peroxiredoxin-1 [Source:NCBI gene;Acc:101175597][more]
prdx22.798e-9467.55peroxiredoxin 2 [Source:NCBI gene;Acc:101170008][more]
prdx47.941e-8866.67peroxiredoxin-4 [Source:NCBI gene;Acc:101166157][more]
prdx35.596e-8556.80peroxiredoxin 3 [Source:NCBI gene;Acc:101157243][more]
back to top
BLAST of Peroxiredoxin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001807.11.420e-14899.50SMESG000001807.1[more]
SMESG000001807.13.121e-14299.48SMESG000001807.1[more]
SMESG000024235.15.958e-8861.05SMESG000024235.1[more]
SMESG000024235.11.047e-8761.05SMESG000024235.1[more]
SMESG000066780.12.529e-8261.70SMESG000066780.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000596 ID=SMED30000596|Name=Peroxiredoxin|organism=Schmidtea mediterranea sexual|type=transcript|length=1098bp
CGGGTGTACATTGGTGTAGAACAAATTTCAAATTCAGAAATTATTACAAC
TATCGAGGAATACACAAAATGAAATTACAATCTACTTGAATTGTGAATTT
CATTTGAACAGTCTCAATTGTAAAATAACCAAAAATAATAATTTATTGGA
AACAATCATATCTACAACAATGTATACCCAAATTGTAGAAACAAACTTAG
GTTTATTTCAAGGTAACAAAAAGCAGGAAGCAGAAATTTGAACCAGAAGA
TAAATTATTTTAGTTTTACTAAACTTATATTTTGAAAAATTATATCAATG
CGAACAAATGTTAATAGAAAAATCAAAAGTTATAACAATTTGAAATGTTT
TAACAGATTAATTGTACCATTAAAATAACAGCGCGATTTCAAATAATATT
TATATTATCAAAACCAAGATTGCCAAGTTAAATAGAAAATATATGTACAA
AAGTCATTGTAAAATGCCATTACAACCGGGTCATATAGCCCCTGCATTCC
AGGCCAAGGCGGTACAAAGTGGTGAAATCATAGACATATCATTATCGGAC
TATGAGGGGAAATATGTCGTTCTCTTCTTTTATCCAGCCGATTTCACATT
TGTCTGCCCAACGGAGATAATCGCATTCAGTGATCGAGCGCAAGAATTTC
GAGACATAAATTGTGAAGTACTTGCGTGCTCCACTGATTCAGAATTTAGT
CATTTCGCATGGACTGGAACACCAAGGAAGAAGGGTGGTGTTGGCATATT
AGACATTCCTTTAATTGCTGACAAGACAAAATCTATAAGCAAAAGCTACG
GAGTATTGAAAGAAAATGAGGGAATGGCATTCAGAGGATTGTTCATTATC
AGCAACAAAGGCTTGATCAGGCAAATAACAATAAATGACATGCCAGTTGG
GAGGTCTATCGATGAAACGCTGCGATTAGTACAAGCACTGCAATACACTG
ATGTTCATGGCGAGGTTTGCCCTGCCGGATGGAAACCAGGATCTAAAACA
ATTAAACCATCAATAGAAGGAGCTGAAGACTATTTCAAATCAACATAAAC
TGACAGAATAAAATTAGTTGTAGAATTAGAAATTAAAATAAAGTATCC
back to top

protein sequence of SMED30000596-orf-1

>SMED30000596-orf-1 ID=SMED30000596-orf-1|Name=SMED30000596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MYKSHCKMPLQPGHIAPAFQAKAVQSGEIIDISLSDYEGKYVVLFFYPAD
FTFVCPTEIIAFSDRAQEFRDINCEVLACSTDSEFSHFAWTGTPRKKGGV
GILDIPLIADKTKSISKSYGVLKENEGMAFRGLFIISNKGLIRQITINDM
PVGRSIDETLRLVQALQYTDVHGEVCPAGWKPGSKTIKPSIEGAEDYFKS
T*
back to top
Aliases
The feature 'Peroxiredoxin' has the following synonyms
Synonym
Smed_05789
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: biological process
TermDefinition
GO:0098869cellular oxidant detoxification
GO:0007155cell adhesion
GO:0055114oxidation-reduction process
GO:0045454cell redox homeostasis
GO:0006979response to oxidative stress
GO:0019430removal of superoxide radicals
GO:0034599cellular response to oxidative stress
GO:0042981regulation of apoptotic process
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR000259Adhesion_dom_fimbrial
IPR012336Thioredoxin-like_fold
IPR019479Peroxiredoxin_C
IPR000866AhpC/TSA
IPR024706Peroxiredoxin_AhpC-typ
IPR013766Thioredoxin_domain
Vocabulary: cellular component
TermDefinition
GO:0009289pilus
GO:0005737cytoplasm
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0051920peroxiredoxin activity
GO:0016209antioxidant activity
GO:0016491oxidoreductase activity
GO:0004601peroxidase activity
GO:0008379thioredoxin peroxidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019479Peroxiredoxin, C-terminalPFAMPF104171-cysPrx_Ccoord: 165..199
e-value: 2.7E-13
score: 49.5
IPR000866Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidantPFAMPF00578AhpC-TSAcoord: 13..144
e-value: 1.2E-35
score: 122.1
IPR024706Peroxiredoxin, AhpC-typePIRSFPIRSF000239AHPCcoord: 6..201
e-value: 9.0E-64
score: 211.9
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 6..201
e-value: 6.5E-85
score: 285.3
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 9..199
NoneNo IPR availablePANTHERPTHR10681:SF154coord: 10..199
NoneNo IPR availablePANTHERPTHR10681THIOREDOXIN PEROXIDASEcoord: 10..199
NoneNo IPR availableCDDcd03015PRX_Typ2cyscoord: 13..183
e-value: 3.08534E-111
score: 313.287
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 10..168
score: 16.91