SMED30000593

Overview
NameSMED30000593
Smed IDSMED30000593
Length (bp)3566
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000593 (SMED30000593) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000593 (SMED30000593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000593 (SMED30000593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000593 (SMED30000593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000593 SmedASXL_073628SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30000593 SmedASXL_065412SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000593 SmedASXL_065412SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30000593SMESG000066562.1 SMESG000036854.1 SMESG000014563.1 SMESG000014544.1 SMESG000014542.1 SMESG000014539.1 Contig29967newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000593SMESG000066562.1 SMESG000036854.1 SMESG000014563.1 SMESG000014544.1 SMESG000014542.1 SMESG000014539.1 Contig29967uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30000593 vs. Planmine SMEST
Match: SMESG000003594.1 (SMESG000003594.1)

HSP 1 Score: 219.164 bits (557), Expect = 1.249e-104
Identity = 134/153 (87.58%), Postives = 138/153 (90.20%), Query Frame = 2
Query:  944 VLVASFNEDELTKRLAGRDLAIKLNLIPANHIXXXXXXXXXXXXXXXXXHNPSKNXXXXXXXXAEGVSLLKNAAQTLEEAAMLVAEQQSQLAKSAEKPLEMKKVE*YTTEICAGETDELRIQMKISSKSTNTSETDSNRKSSTSIGYWTDDFG 1402
            VL ASFNE EL KRLAGRDLAIKLN+IPA H+    TTGPPQ PKTSKKHNPSKNRRRRERRRAEGVS LKNAAQTLEEAAMLVAEQQSQLAK+AEKPLEM+KVE  TTEICAGETDELRIQMKIS KSTNT ETDSNRKSSTSIGYWTDD G
Sbjct:   91 VLTASFNETELKKRLAGRDLAIKLNIIPAEHVPETATTGPPQMPKTSKKHNPSKNRRRRERRRAEGVSQLKNAAQTLEEAAMLVAEQQSQLAKAAEKPLEMEKVEDCTTEICAGETDELRIQMKISPKSTNTPETDSNRKSSTSIGYWTDDVG 243          

HSP 2 Score: 142.895 bits (359), Expect = 1.249e-104
Identity = 68/89 (76.40%), Postives = 74/89 (83.15%), Query Frame = 3
Query:  690 MQAGYKIPKLTSQESGKPN-----NNDNAHQECQRKYAQLVAEHERTLGTWFAPEAVKALHNQIHRLTRCREDLIAESRAQHIIINNQA 941
            MQ GYKIPKLTSQ S K N     N+D +HQEC+RKY QLV EHERTL TWFAPEAVKALH QIHRLTRCREDLIAE+RAQ I+INNQ+
Sbjct:    1 MQPGYKIPKLTSQRSEKSNLSILNNDDKSHQECRRKYDQLVVEHERTLSTWFAPEAVKALHKQIHRLTRCREDLIAENRAQRIVINNQS 89          

HSP 3 Score: 61.2326 bits (147), Expect = 1.249e-104
Identity = 28/29 (96.55%), Postives = 28/29 (96.55%), Query Frame = 1
Query: 1402 DELCHSVPQVGSNELKISRKRIFPVDIDE 1488
            DELCHSVPQVGSNELKISRKRIF VDIDE
Sbjct:  244 DELCHSVPQVGSNELKISRKRIFSVDIDE 272          
BLAST of SMED30000593 vs. Planmine SMEST
Match: SMESG000028417.1 (SMESG000028417.1)

HSP 1 Score: 154.451 bits (389), Expect = 1.339e-75
Identity = 102/152 (67.11%), Postives = 110/152 (72.37%), Query Frame = 2
Query:  947 LVASFNEDELTKRLAGRDLAIKLNLIPANHIXXXXXXXXXXXXXXXXXHNPSKNXXXXXXXXAEGVSLLKNAAQTLEEAAMLVAEQQSQLAKSAEKPLEMKKVE*YTTEICAGETDELRIQMKISSKSTNTSETDSNRKSSTSIGYWTDDFG 1402
            LVASF E ELTKRLAGRDL +KLNLIP NH+  +   GP QTP+TSKKH+PSKN RRRERRRAEG++LL NAAQ LEEAAMLVAEQ  Q  KS E P    K E   T I A ETDELRIQ+     S  TS  D N KSSTSI YWTDDFG
Sbjct:   85 LVASFTEVELTKRLAGRDLVVKLNLIPVNHLPEETQAGPAQTPRTSKKHHPSKNCRRRERRRAEGLTLLSNAAQVLEEAAMLVAEQHPQFVKSDENPQTTAKSEENATLISADETDELRIQINTPLISIPTSGADENLKSSTSISYWTDDFG 236          

HSP 2 Score: 120.168 bits (300), Expect = 1.339e-75
Identity = 57/84 (67.86%), Postives = 67/84 (79.76%), Query Frame = 3
Query:  690 MQAGYKIPKLTSQESGKPNNNDNAHQECQRKYAQLVAEHERTLGTWFAPEAVKALHNQIHRLTRCREDLIAESRAQHIIINNQA 941
            MQ GYKIPKL+S+ S    N    H  CQ+KY +L AEHERTLGTWFAPEAVK L ++IHRL+RCREDLIAE+RAQ IIIN+Q+
Sbjct:    1 MQPGYKIPKLSSKPSAI--NTQMDHSSCQQKYNKLFAEHERTLGTWFAPEAVKILQDKIHRLSRCREDLIAENRAQRIIINDQS 82          

HSP 3 Score: 51.2174 bits (121), Expect = 1.339e-75
Identity = 24/31 (77.42%), Postives = 25/31 (80.65%), Query Frame = 1
Query: 1396 FWDELCHSVPQVGSNELKISRKRIFPVDIDE 1488
            F DELCHSV QVGS+EL   RKR FPVDIDE
Sbjct:  235 FGDELCHSVLQVGSSELNFCRKRRFPVDIDE 265          
BLAST of SMED30000593 vs. Planmine SMEST
Match: SMESG000036778.1 (SMESG000036778.1)

HSP 1 Score: 136.732 bits (343), Expect = 2.283e-62
Identity = 100/153 (65.36%), Postives = 108/153 (70.59%), Query Frame = 2
Query:  944 VLVASFNEDELTKRLAGRDLAIKLNLIPANHIXXXXXXXXXXXXXXXXXHNPSKNXXXXXXXXAEGVSLLKNAAQTLEEAAMLVAEQQSQLAKSAEKPLEMKKVE*YTTEICAGETDELRIQMKISSKSTNTSETDSNRKSSTSIGYWTDDFG 1402
            VL ASFNE EL KRLAGRDLAIKLN+IPA H+    TTGPPQ PK SKKHNPSKNRRRRERRRAEGV+LLKNAAQTLEEAAMLVAEQQ+QLAK  E   E              E+ E+ IQ+          ETD NRK ST I YWTD+FG
Sbjct:  654 VLTASFNETELKKRLAGRDLAIKLNIIPAEHVPETATTGPPQMPKISKKHNPSKNRRRRERRRAEGVTLLKNAAQTLEEAAMLVAEQQAQLAKDTENLPE------------TIESGEVAIQI-------GAGETDENRKPSTLISYWTDEFG 787          

HSP 2 Score: 123.635 bits (309), Expect = 2.283e-62
Identity = 58/78 (74.36%), Postives = 65/78 (83.33%), Query Frame = 3
Query:  717 LTSQESGKP---NNNDNAHQECQRKYAQLVAEHERTLGTWFAPEAVKALHNQIHRLTRCREDLIAESRAQHIIINNQA 941
            +   E  KP   NN+D +HQEC+RKY QLV EHERTLGTWFAPEAVKALH QIHRLTRCREDLIAE+RAQ I+INNQ+
Sbjct:  575 IKESEKSKPSILNNDDKSHQECRRKYEQLVVEHERTLGTWFAPEAVKALHKQIHRLTRCREDLIAENRAQRIVINNQS 652          

HSP 3 Score: 58.151 bits (139), Expect = 3.496e-8
Identity = 29/48 (60.42%), Postives = 35/48 (72.92%), Query Frame = 1
Query: 1345 NRLKSQVLHFYRLLDGRFWDELCHSVPQVGSNELKISRKRIFPVDIDE 1488
            NR  S ++ ++      F DELCHSVPQVGSN+L+I RKR FPVDIDE
Sbjct:  772 NRKPSTLISYW---TDEFGDELCHSVPQVGSNKLRIDRKRRFPVDIDE 816          
BLAST of SMED30000593 vs. Planmine SMEST
Match: SMESG000066562.1 (SMESG000066562.1)

HSP 1 Score: 180.259 bits (456), Expect = 2.210e-57
Identity = 117/128 (91.41%), Postives = 118/128 (92.19%), Query Frame = 2
Query: 1019 LIPANHIXXXXXXXXXXXXXXXXXHNPSKNXXXXXXXXAEGVSLLKNAAQTLEEAAMLVAEQQSQLAKSAEKPLEMKKVE*YTTEICAGETDELRIQMKISSKSTNTSETDSNRKSSTSIGYWTDDFG 1402
                NHITGK T GPPQTPKTSKKHN SKNRRRRERR AEGVSLLKNAAQTLEEAAMLVAEQQSQLAKSAEKPLEMKKVE YTTEICAGETDELRIQMKISS STNTS+TDSNRKSSTSIGYWTDDFG
Sbjct:  160 FFATNHITGKDTAGPPQTPKTSKKHNRSKNRRRRERRWAEGVSLLKNAAQTLEEAAMLVAEQQSQLAKSAEKPLEMKKVEEYTTEICAGETDELRIQMKISSNSTNTSKTDSNRKSSTSIGYWTDDFG 287          

HSP 2 Score: 63.5438 bits (153), Expect = 2.210e-57
Identity = 29/31 (93.55%), Postives = 29/31 (93.55%), Query Frame = 1
Query: 1396 FWDELCHSVPQVGSNELKISRKRIFPVDIDE 1488
            F DELCHSVPQVGSNELKISRKRIFPVD DE
Sbjct:  286 FGDELCHSVPQVGSNELKISRKRIFPVDNDE 316          
BLAST of SMED30000593 vs. Planmine SMEST
Match: SMESG000059904.1 (SMESG000059904.1)

HSP 1 Score: 121.324 bits (303), Expect = 5.647e-56
Identity = 85/153 (55.56%), Postives = 104/153 (67.97%), Query Frame = 2
Query:  944 VLVASFNEDELTKRLAGRDLAIKLNLIPANHIXXXXXXXXXXXXXXXXXHNPSKNXXXXXXXXAEGVSLLKNAAQTLEEAAMLVAEQQSQLAKSAEKPLEMKKVE*YTTEICAGETDELRIQMKISSKSTNTSETDSNRKSSTSIGYWTDDFG 1402
            VLVASF E EL KRLAGRDLA+KLNLIPANH+      GP QTP+TSKKH+PSKNRRRRERRRAEG+++L NAAQ LEEAA LVAEQ  +  K  +  L +K+ + +   I   ETDE++I + IS        T +  +S T    W D+FG
Sbjct:  165 VLVASFTEAELVKRLAGRDLALKLNLIPANHLPETTQAGPAQTPRTSKKHHPSKNRRRRERRRAEGLTILNNAAQVLEEAAALVAEQHPEFVKKDDTTLTLKRSKEHMLPIHVKETDEMQICLDIS--PIENPSTTTKERSPTLASCWMDEFG 315          

HSP 2 Score: 98.2117 bits (243), Expect = 5.647e-56
Identity = 44/60 (73.33%), Postives = 52/60 (86.67%), Query Frame = 3
Query:  762 HQECQRKYAQLVAEHERTLGTWFAPEAVKALHNQIHRLTRCREDLIAESRAQHIIINNQA 941
            H  CQ+KY +L AEHERTLGTWFAPEAVK L ++IH L+RCREDLIAE+RAQ IIIN+Q+
Sbjct:  104 HDFCQQKYNKLFAEHERTLGTWFAPEAVKILQDKIHELSRCREDLIAENRAQRIIINDQS 163          

HSP 3 Score: 40.817 bits (94), Expect = 5.647e-56
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 1
Query: 1396 FWDELCHSVPQVGSNELK-ISRKRIFPVDIDE 1488
            F +ELCH+VPQVG+   + +  KR FPVDIDE
Sbjct:  314 FGEELCHTVPQVGTIPFQPLRNKRKFPVDIDE 345          

HSP 4 Score: 56.9954 bits (136), Expect = 5.700e-18
Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 3
Query:  837 EAVKALHNQIHRLTRCREDLIAESRAQHIIINNQAP 944
            E VKALH QIHRLTR R+DLI+E+RAQ IIIN+Q P
Sbjct:   12 EFVKALHQQIHRLTRYRDDLISENRAQRIIINDQIP 47          

HSP 5 Score: 54.6842 bits (130), Expect = 5.700e-18
Identity = 24/32 (75.00%), Postives = 28/32 (87.50%), Query Frame = 2
Query:  944 VLVASFNEDELTKRLAGRDLAIKLNLIPANHI 1039
            VL+ASF + ELTKR+AGRDLA+KLNLIP  HI
Sbjct:   48 VLIASFTKAELTKRIAGRDLAVKLNLIPPTHI 79          
The following BLAST results are available for this feature:
BLAST of SMED30000593 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000593 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003594.11.249e-10487.58SMESG000003594.1[more]
SMESG000028417.11.339e-7567.11SMESG000028417.1[more]
SMESG000036778.12.283e-6265.36SMESG000036778.1[more]
SMESG000066562.12.210e-5791.41SMESG000066562.1[more]
SMESG000059904.15.647e-5655.56SMESG000059904.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000593 ID=SMED30000593|Name=SMED30000593|organism=Schmidtea mediterranea sexual|type=transcript|length=3566bp
AAATTCAATTGTATATATCTATAATGCTAATCGTGGAGAATGGCAAAGTA
AACATTCAATTCCGGCCGTTAATTTGGCAGGACGTTGATGTGTTGCTTAG
TCACAATCCACCCTTCGGTGGCTGCCTAGTCTGGTCAGGCCTCGTTTGCA
CTGATCACGGGGTAGGACACCGTCGTAATTTACCGTGGCGGCCATTTTCA
ATGTTGGCCGGAGCGGTATGAGTAAAATGCGGGTAGATCGCCATACCTAA
GGGGTTGACAATTGTAAGATGTCTAAGTAGGGATGTAATATTTGTTTTTT
AAATGCCTGTCGAGAAATCGATTATAACAAAGGGGACGACTAGGGTTAAG
TATAGGAATAAATGCCTAACACGATAAACCGAAACGAATTCAACAAAACG
AAAAGATTAAAAAATATTTTAACGTGAATCGCAATGACCGGAGCATCAAT
ATTTTTCATTTTCTTTTGTACCGAATTATTGTCAGCAGATCAACAATAGA
TATTTATACGAAAACCGGCATCGTAGAAATTAATATTAAATATGAGTTTG
GTGCAGGATTGTGTGATGTGACGTTCTAATTAATTATTTCTTTTATTATC
TTTATTATTAAATTGATAAAATCTTTTTTTACTAAATTATTCCCCTTCAG
TTTCTTTTATTTTTGTTTTTTAATAAAATCTTTGACAACATGCAGGCCGG
ATATAAAATCCCAAAACTAACATCACAGGAATCTGGAAAACCCAACAATA
ATGATAACGCCCACCAGGAATGTCAGAGAAAATATGCCCAGTTGGTCGCA
GAACACGAACGCACGCTTGGTACGTGGTTCGCCCCCGAGGCTGTGAAAGC
TCTCCACAACCAAATCCACCGACTTACCAGATGTCGAGAAGACTTGATCG
CGGAAAGTCGAGCGCAGCATATCATCATCAACAATCAAGCGCCGTCTTGG
TAGCTTCTTTTAATGAAGACGAACTGACAAAACGATTAGCCGGCCGGGAT
TTGGCAATAAAGCTGAACCTAATTCCAGCAAATCATATAACCGGAAAAGG
CACAACTGGTCCTCCCCAAACACCGAAGACCAGCAAGAAGCATAACCCCA
GCAAAAATCGGCGTCGTCGTGAACGACGTCGGGCTGAGGGGGTTTCTCTA
TTAAAAAACGCAGCTCAAACTCTGGAAGAAGCGGCCATGCTAGTTGCCGA
ACAACAATCGCAATTGGCTAAATCTGCCGAAAAACCGCTAGAAATGAAAA
AAGTTGAATAATATACAACCGAAATCTGCGCCGGTGAAACGGACGAGTTG
CGAATTCAGATGAAGATTTCCTCCAAGTCAACTAACACTTCGGAAACCGA
CTCAAATCGCAAGTCCTCCACTTCTATCGGTTATTGGACGGACGATTTTG
GGATGAGCTCTGCCACTCAGTTCCCCAGGTCGGATCTAACGAACTGAAGA
TTAGCCGAAAGCGAATCTTCCCCGTCGATATTGACGAATGAAACTGGATC
CTGTAGAAAAGGGAATTGCATCTTGCCATAACAATTTAAATCCTTTTGTA
AATATCATCATCGTGAAATAGAATTTTCTTTTGTTATTATTCGTTAAATT
TCTTAATTAATTTCGATATGTCTGAGAATATATGAGAAAAGGATGTATGG
AGGCTTGCCTGAGTATAATGTAAGATTGATGGAGTTCGATGCATGTGAAT
AGTATGACTGAAAAGCGGTATTTAACTTGAAATACTGAAAATGGAAATAA
TTATAATTATCGTAAAAATGATTTTTAAGTTTTTAAAAAGAGTATGTTGG
GAAATGAAAGAATAAAAATGAATAAAAAGAAAATTGTAAGGATCAAGAGG
ACTTTATTTTCTTTTAAAAGTGCTCAGGAAATTTGCTTAAATTTAAAACA
GCTGATTTAACAGCGATTACAACTAATTATATAATAATTTAAATTTTCGC
CAATTACTTAAGGAAAATATTTTCCAAATTAAAACAAAATTCGAGGTTAC
CAATATTGTTTCGAACTTTTAATAATTAATTCAGAGGTAAATCGAAAATT
TTAGATAATTTAAGGATCAGAATTTTCCAACAGTTATAAATCCAATTTTT
CTTTGGAAAATGTCCTATATTTTAGAAGTTAAAATTAATTTATTAATTAT
TTATTAATAATAATGCTAATCAAATTTAACGGACCAAAGATAGATAAGCG
GCCAGGTCGCAAAGGAGTACAATTCCGGCAGTAAGGTGTGCTAAGACTAG
TCAATAAATTAAATGAGACTTTAAAAGGATTCTGATTCGGACGTATACAT
ATAATCGATGATAACAGATGGGAAAGTGTGTGCTAATATCGAGGGAAATA
GATAAATGAAATAGACGTAAGTCCTTCTATCGGCCGTCAGGAACCCGAAA
GCGAGATTATCACAAGGAGTAGTCTTGGAAACGGGGCTCACCTGCTTGTG
GACTCTCGGCTGCTGTATACAGTACCAACATGGGCTTGCCCATGGGTATA
CAGTGGTTAGATTAAAATTGGGGGGCGTCGGGGTGAGAAAGGAAATACCC
TAGGGAATGCAAGAGTAGTCGAGGAGTAGTTTGGATGAATAAGCTTAGAT
TAAAATAAATTTAATTCTACCCTGTACGCCAACAACTCGTTAAACTTGTA
GATGCAGCCAAGTAAGATAAAATCATTGTCACGTTCTTTGGAATCATCGT
AACTGTCTACATGTTCTTTTCTGGTGCTACACAGCGCTGGGGAAAACTCA
AAAACAGTGATTGGTTGTGAAGTCGGAGTCCGATACCAGGTAAAGTGTAA
TGAGAGAATCAGTGAATCTCATCAACGTGTATCTCGAAAAGATATTTCAA
GTTCTGCAGACAAGACTGAAACACGAAAAAATAATTAATTTAAATTTGAT
AAACCGTATTTATTTGCATTCATAATTAAATAAATTTATCTATCTCTCCT
TAAGGTGGATATATTGTTCTTTAATTTTAAATTACAAAATTTACATAAAG
GCTATGTTGGTGTATGGGTGGAATTTAATTGATTTGATTTAGTTTAATTA
AAGTTATCTTAATTCAGTTCACTCTTACTCTTTCCTAGGGTTCTGATCTT
TCTCACCCATACGCTCCACAATTTTGCATCACCACTATGCGCCCATGGAA
AACCCATGTCGGTACTGCTCATAGTGGCCGAATGCTCCACAAGTAGATAA
CCGCCTCCTGAAGCATTACTACTTGCAGAATCTTCGCTTTCGGATCTTTG
AATGCCTCCATTACATCGTAGGTCCTTGCTCCATCATTACAATTGACTTG
AAGAGTTTATGGGGTTTTAATTATTTAGGTCAGCGATTTGATTTGAAAAC
TCTAACATCCGAAGTTCCTAATTAATTATATTAACATTAATGTTATTGAT
ACGAGATTAGGATGTTACTAAATTATCTAGGGAATTCCTTACTAAAATTT
AAATAATAATTTTTATAAAAATTGTTATTATTAAATACTAAAGTAATTTT
CATTTTGTAAAGAATATACTGAATTTACAGAATAATTTATACAGATAATT
TATACAGAATTTTGTA
back to top

protein sequence of SMED30000593-orf-1

>SMED30000593-orf-1 ID=SMED30000593-orf-1|Name=SMED30000593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MSEKICPVGRRTRTHAWYVVRPRGCESSPQPNPPTYQMSRRLDRGKSSAA
YHHQQSSAVLVASFNEDELTKRLAGRDLAIKLNLIPANHITGKGTTGPPQ
TPKTSKKHNPSKNRRRRERRRAEGVSLLKNAAQTLEEAAMLVAEQQSQLA
KSAEKPLEMKKVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 128..148
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 89..106
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 86..125