Protein RFT1 homolog

Overview
NameProtein RFT1 homolog
Smed IDSMED30000585
Length (bp)2276
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein RFT1 homolog (SMED30000585) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein RFT1 homolog (SMED30000585) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein RFT1 homolog (SMED30000585) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein RFT1 homolog (SMED30000585) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000585

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000585h1SMcG0001790 SmedASXL_015162SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000585h1SMcG0001790 SmedASXL_015162SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30000585h1SMcG0001790 SmedASXL_015162SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000585h1SMcG0001790 SmedASXL_015162SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein RFT1 homolog vs. Ensembl Human
Match: RFT1 (RFT1 homolog [Source:HGNC Symbol;Acc:HGNC:30220])

HSP 1 Score: 258.84 bits (660), Expect = 9.605e-77
Identity = 180/487 (36.96%), Postives = 285/487 (58.52%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIG 2135
            Q +FR++TF++N  ++RFL K+I+G+VNVRL LL+ST +F+ RE FR+ CLS     +  + +NL+WL VP  +F S+   +IW + +  P       Y   V+++GLS+++ELL EP W+++Q ++ V+ + I E+L++  + +L+  L       GLY F +AQL Y+ V+   Y IYF  +L    +  L  +  + R  D+ P+I      I   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  RLIF  IE+S ++ F+++ ++G  A  Q Q+ +  +  +L + LK+ +L GLTI +F  AYS   L +Y G    + +G  LLR +  YVL+L++NGV+ECF ++A++K E+ R+ + M+A S  F   S +L    G+VG I ANC NM +RI  S  FI  +Y  S +   + +H S P      A    + A+    +CC+     +L HI++G
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGVVNVRLTLLYSTTLFLAREAFRRACLSGGTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGVVLFGLSAVVELLGEPFWVLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLYIFSLAQLFYTTVLVLCYVIYFTKLLGSPESTKL-QTLPVSRITDLLPNITRNGAFINWKEAKLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPIEESFYIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLALLAGLTITVFGFAYSQLALDIYGGTMLSSGSGPVLLRSYCLYVLLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSYLLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLS-PVLLGTFALSGGVTAVSEVFLCCEQGWPARLAHIAVG 505          
BLAST of Protein RFT1 homolog vs. Ensembl Human
Match: RFT1 (RFT1 homolog [Source:HGNC Symbol;Acc:HGNC:30220])

HSP 1 Score: 204.527 bits (519), Expect = 3.691e-57
Identity = 163/487 (33.47%), Postives = 260/487 (53.39%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIG 2135
            Q +FR++TF++N  ++RFL K+I+G+VNVR                                       VP  +F S+   +IW + +  P       Y   V+++GLS+++ELL EP W+++Q ++ V+ + I E+L++  + +L+  L       GLY F +AQL Y+ V+   Y IYF  +L    +  L  +  + R  D+ P+I      I   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  RLIF  IE+S ++ F+++ ++G  A  Q Q+ +  +  +L + LK+ +L GLTI +F  AYS   L +Y G    + +G  LLR +  YVL+L++NGV+ECF ++A++K E+ R+ + M+A S  F   S +L    G+VG I ANC NM +RI  S  FI  +Y  S +   + +H S P      A    + A+    +CC+     +L HI++G
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGVVNVR---------------------------------------VPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGVVLFGLSAVVELLGEPFWVLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLYIFSLAQLFYTTVLVLCYVIYFTKLLGSPESTKL-QTLPVSRITDLLPNITRNGAFINWKEAKLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPIEESFYIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLALLAGLTITVFGFAYSQLALDIYGGTMLSSGSGPVLLRSYCLYVLLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSYLLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLS-PVLLGTFALSGGVTAVSEVFLCCEQGWPARLAHIAVG 466          
BLAST of Protein RFT1 homolog vs. Ensembl Human
Match: RFT1 (RFT1 homolog [Source:HGNC Symbol;Acc:HGNC:30220])

HSP 1 Score: 155.221 bits (391), Expect = 1.233e-41
Identity = 107/316 (33.86%), Postives = 175/316 (55.38%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVI 1631
            Q +FR++TF++N  ++RFL K+I+G+VNVRL LL+ST +F+ RE FR+ CLS     +  + +NL+WL VP  +F S+   +IW + +  P       Y   V+++GLS+++ELL EP W+++Q ++ V+ + I E+L++  + +L+  L       GLY F +AQ           FI +K            +  T   ++  F                        LKQILTEGERY+MT  N ++   QG +DI++NLGSL  RLIF  IE+S ++ F+++ ++G  A  Q Q+ +  +  +L + LK+ +
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGVVNVRLTLLYSTTLFLAREAFRRACLSGGTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGVVLFGLSAVVELLGEPFWVLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLYIFSLAQ----------AFINWK-----------EAKLTWSFFKQSF------------------------LKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPIEESFYIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLAL 291          
BLAST of Protein RFT1 homolog vs. Ensembl Human
Match: AC096887.1 (novel transcript)

HSP 1 Score: 61.2326 bits (147), Expect = 1.020e-10
Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 3
Query: 1755 LVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQS 2021
            L+L++NGV+ECF ++A++K E+ R+ + M+A S  F   S +L    G+VG I ANC NM +RI  S  FI  +Y  S +   + +H S
Sbjct:    2 LLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSYLLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLS 90          
BLAST of Protein RFT1 homolog vs. Ensembl Celegans
Match: rfth-1 (pep chromosome:WBcel235:IV:4508530:4511320:-1 gene:WBGene00022677.1 transcript:ZK180.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rfth-1)

HSP 1 Score: 159.073 bits (401), Expect = 2.325e-41
Identity = 133/453 (29.36%), Postives = 225/453 (49.67%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGL----GLYA---FGIAQ----LAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVI 2012
            Q I RI++F IN+ L+R +  D+LGLVNVRL LL+S+I+F+TREP RK  +      +  K INL+WL       IS+   ++W  F S      E    V++    S I       + +  + L  +  ++ +  A+   +++     F  +GL    G+Y    F  AQ    +AY L    +++IY +       NKS+   +    + D+FP  ++  I+ +    +     + ILKQ+LT+G  Y+MT +  +SL+ Q  +D +  +GS+  R I S I+++C+  FS   ++      ++ D   D    L+  L +V ++G     F   YS  ++ LY G   +  G   LL ++S Y+LV ++NG++E F  ++++  ++  H   +   S +    + VL     + G I AN INM +RII + R IRE+  D   S   V+
Sbjct:   14 QLIARIISFAINMYLLRRINNDVLGLVNVRLTLLYSSILFLTREPLRKAEI---IRGSLPKFINLLWLSPIISTVISVVCVYLWYAFSS---TSDEVSWSVLLSFPISAIIESIAEPFSVISLRLESKCGSLAQHFAIGQGMLICVKRIFVLAGLFMFPGMYHLELFAYAQYIGAIAYLLFNFVAFYIYIR-------NKSIPELEQFSTFSDLFPK-FSEGIDRDSIHAVFTMFSHSILKQLLTDGSAYVMTFTELLSLKDQAVYDAVERVGSIIVRTILSPIDENCNAYFSNTIRKESSVFNKNTDNHDDLVDTLSKVLHVVGVIGFVACTFGIPYSPVVISLYGGKLLSENGGALLLSLYSGYILVTAINGITEGFAMASMDNRQIFTHGKFLFVTSIIHLIINYVLCVYMNSAGFIVANIINMSVRIIYNWRTIREYLGDKCPSFTEVL 452          
BLAST of Protein RFT1 homolog vs. Ensembl Celegans
Match: rfth-1 (pep chromosome:WBcel235:IV:4508530:4510864:-1 gene:WBGene00022677.1 transcript:ZK180.3b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rfth-1)

HSP 1 Score: 108.997 bits (271), Expect = 2.321e-25
Identity = 82/285 (28.77%), Postives = 143/285 (50.18%), Query Frame = 3
Query: 1161 YAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVI 2012
            YA  I  +AY L    +++IY +       NKS+   +    + D+FP  ++  I+ +    +     + ILKQ+LT+G  Y+MT +  +SL+ Q  +D +  +GS+  R I S I+++C+  FS   ++      ++ D   D    L+  L +V ++G     F   YS  ++ LY G   +  G   LL ++S Y+LV ++NG++E F  ++++  ++  H   +   S +    + VL     + G I AN INM +RII + R IRE+  D   S   V+
Sbjct:   28 YAQYIGAIAYLLFNFVAFYIYIR-------NKSIPELEQFSTFSDLFPK-FSEGIDRDSIHAVFTMFSHSILKQLLTDGSAYVMTFTELLSLKDQAVYDAVERVGSIIVRTILSPIDENCNAYFSNTIRKESSVFNKNTDNHDDLVDTLSKVLHVVGVIGFVACTFGIPYSPVVISLYGGKLLSENGGALLLSLYSGYILVTAINGITEGFAMASMDNRQIFTHGKFLFVTSIIHLIINYVLCVYMNSAGFIVANIINMSVRIIYNWRTIREYLGDKCPSFTEVL 304          
BLAST of Protein RFT1 homolog vs. Ensembl Celegans
Match: rfth-1 (pep chromosome:WBcel235:IV:4508499:4511320:-1 gene:WBGene00022677.1 transcript:ZK180.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rfth-1)

HSP 1 Score: 108.997 bits (271), Expect = 2.321e-25
Identity = 82/285 (28.77%), Postives = 143/285 (50.18%), Query Frame = 3
Query: 1161 YAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVI 2012
            YA  I  +AY L    +++IY +       NKS+   +    + D+FP  ++  I+ +    +     + ILKQ+LT+G  Y+MT +  +SL+ Q  +D +  +GS+  R I S I+++C+  FS   ++      ++ D   D    L+  L +V ++G     F   YS  ++ LY G   +  G   LL ++S Y+LV ++NG++E F  ++++  ++  H   +   S +    + VL     + G I AN INM +RII + R IRE+  D   S   V+
Sbjct:   28 YAQYIGAIAYLLFNFVAFYIYIR-------NKSIPELEQFSTFSDLFPK-FSEGIDRDSIHAVFTMFSHSILKQLLTDGSAYVMTFTELLSLKDQAVYDAVERVGSIIVRTILSPIDENCNAYFSNTIRKESSVFNKNTDNHDDLVDTLSKVLHVVGVIGFVACTFGIPYSPVVISLYGGKLLSENGGALLLSLYSGYILVTAINGITEGFAMASMDNRQIFTHGKFLFVTSIIHLIINYVLCVYMNSAGFIVANIINMSVRIIYNWRTIREYLGDKCPSFTEVL 304          
BLAST of Protein RFT1 homolog vs. Ensembl Fly
Match: CG3149 (gene:FBgn0027564 transcript:FBtr0070846)

HSP 1 Score: 195.667 bits (496), Expect = 1.083e-53
Identity = 165/492 (33.54%), Postives = 264/492 (53.66%), Query Frame = 3
Query:  633 KSTMESSIMIRKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSR----KLINLMWLIVPFILFISMSFTFIWCEFISY--PIKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSG---LGLYAFGIAQLAYSLVIS-GSY-FIYFKIILHLKTNKSLASSQTIKR-------------YRDIFP----------DIYNFEIEH-NQFL--MIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATG--TDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSS 1991
            ++ +ESS++    F++  FQ + RILTF IN  +VR + +++LG++NVRL+LL ST++F++RE   +  LS N     R    +LIN MWL VP    +     +IW  ++S    I   +Y+        S ++EL++E    ++Q+   V+ + ++  L +  R   S I  +  +G     + AF IAQL+ ++ I  G Y F YF    +LK  K   + Q  K+             + D FP           ++N   +H N+ L  +   FV   +LKQILTEGE+Y+M++S  +S   Q  +D+++NLGS+A R IF  IEDS +  F++   + +    Q Q+++R +  +L N L  V  +GL    F Q+YS+P+L+LY G D  A G    LL+     + +L+VNG+SE + ++     ++ ++ Y M  FS  F   S +L  I+G VG I+ANCINM+ RI+ ST +IR  Y   S
Sbjct:    3 RNVLESSLL-GAGFSII-FQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAINRAALSANAQQGDRCSWAQLINQMWLTVPICAVLCAPCLYIWLNWLSAVDAIYASQYEFACYAVAFSCVLELMAESAVFVAQVFCFVKLKILLNTLHILVR---SAIFLWIVTGDRSAAINAFAIAQLSSAVTIVLGQYGFFYF----YLKGFKDFVTQQAKKKPVAPKAWQVSLYEHMDDFPFKQLSDFLPGVMFNPNGKHFNRELQTLTLSFVKQGVLKQILTEGEKYVMSVSPVLSFGEQATYDVVNNLGSMAARFIFRPIEDSSYFYFTQTLSRDIKLAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVLLLYGGPDFVAGGLPQSLLQWHCLAIYLLAVNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTGIFGPVGFIFANCINMLSRILYSTYYIRHQYRPLS 485          
BLAST of Protein RFT1 homolog vs. Ensembl Zebrafish
Match: rft1 (RFT1 homolog [Source:ZFIN;Acc:ZDB-GENE-110411-126])

HSP 1 Score: 238.039 bits (606), Expect = 4.069e-69
Identity = 186/555 (33.51%), Postives = 307/555 (55.32%), Query Frame = 3
Query:  642 MESSIMIRKSFTLAGF----QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLS-LNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIK------GFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSS----YSLRSVIHQSVPHKXXXXXXXXXXXXXX--XXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSKAT 2246
            M S  +++ + TLA +    Q +FR+LTFL+N   +RF+ K+++G+VNVRL+LL+ST++F++RE FR+ CLS      N R++INL+WL  P      +    +W   +  P       Y   V ++ ++++ ELL+EPLW+++  ++ V  + I E+LA+  + +++ +L  +    GL+ F  AQ  Y+  +   Y +YF  I  L + ++   S  + R  D+ P     +++H   L  K       F     LKQILTEGERY+MT  N ++   QG +DII+NLGS+  R +F  IE+S ++ F+++ ++G   + Q Q+++  + ++L   LK+V+L+GL I +F  AYS   L +Y G       G  LLR +S YVL+L++NGV+ECF ++A++K E+ R+   M+  S  F   S  L  ++G VG I ANC NM LRI  S  +IR+++  S     + LR       PH +V++A  +S +      S+ CC      +L H+++G   ++     +   E    QF+  K Q L +   K T
Sbjct:    1 MGSEDVLKSASTLASYNVLLQVMFRVLTFLLNAFTLRFVSKELIGVVNVRLMLLYSTLVFLSREAFRRACLSGEGAGRNWRQVINLLWLTFPLGCVWGVLLVCVWWWVLQAPDPDSIPHYVPAVGLFCVAALTELLAEPLWVLAHAHMFVRLKVIAESLAMIAKCLVTVVLVVSAPQWGLFIFSAAQCVYTGFLLTCYVVYF--IHFLGSEEAEKKSFPVYRMTDLLPS----KVDHEPLLNWKLTTLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIINNLGSMVARFLFLPIEESFYVFFAKVLERGRDVQHQKQEEVSMAAEVLECLLKLVLLIGLIITVFGYAYSHLALDIYGGELLSNGAGPALLRCYSCYVLLLAINGVTECFVFAAMSKEEVDRYNLVMLGLSASFLLLSYWLTWMFGGVGFILANCCNMALRITHSIVYIRQYFLQSEHRPLWGLR-------PHSAVLVALGVSAVITAFSESVFCCDGGWLLRLFHVAVGAVCLLTVVITVFLTETRLVQFV--KTQLLPKYNKKLT 540          
BLAST of Protein RFT1 homolog vs. Ensembl Zebrafish
Match: rft1 (RFT1 homolog [Source:ZFIN;Acc:ZDB-GENE-110411-126])

HSP 1 Score: 157.532 bits (397), Expect = 1.195e-41
Identity = 128/395 (32.41%), Postives = 208/395 (52.66%), Query Frame = 3
Query: 1101 LFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIK------GFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSS----YSLRSVIHQSVPHKXXXXXXXXXXXXXX--XXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSKAT 2246
            +  + +++ +L  +    GL+ F  AQ  Y+  +   Y +YF  I  L + ++   S  + R  D+ P     +++H   L  K       F     LKQILTEGERY+MT  N ++   QG +DII+NLGS+  R +F  IE+S ++ F+++ ++G   + Q Q+++  + ++L   LK+V+L+GL I +F  AYS   L +Y G       G  LLR +S YVL+L++NGV+ECF ++A++K E+ R+   M+  S  F   S  L  ++G VG I ANC NM LRI  S  +IR+++  S     + LR       PH +V++A  +S +      S+ CC      +L H+++G   ++     +   E    QF+  K Q L +   K T
Sbjct:    1 MIAKCLVTVVLVVSAPQWGLFIFSAAQCVYTGFLLTCYVVYF--IHFLGSEEAEKKSFPVYRMTDLLPS----KVDHEPLLNWKLTTLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIINNLGSMVARFLFLPIEESFYVFFAKVLERGRDVQHQKQEEVSMAAEVLECLLKLVLLIGLIITVFGYAYSHLALDIYGGELLSNGAGPALLRCYSCYVLLLAINGVTECFVFAAMSKEEVDRYNLVMLGLSASFLLLSYWLTWMFGGVGFILANCCNMALRITHSIVYIRQYFLQSEHRPLWGLR-------PHSAVLVALGVSAVITAFSESVFCCDGGWLLRLFHVAVGAVCLLTVVITVFLTETRLVQFV--KTQLLPKYNKKLT 380          
BLAST of Protein RFT1 homolog vs. Ensembl Xenopus
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:780289])

HSP 1 Score: 241.506 bits (615), Expect = 2.818e-70
Identity = 177/525 (33.71%), Postives = 288/525 (54.86%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSK 2240
            Q +FR+LTF +N   +R++ K+I+G+VNVRL L ++T++F+ RE FR+ CLS +   + R  I+L WL VP  +  S    +IW + +  P    I Y  Y + V  +G S+++ELL+EP W+++Q +L V+ + + E+LA+  R  ++ IL       GL  F +AQ+ Y+  ++  Y  YF + +  L+  K       ++R R+  P   + +  ++  Q  +   F     LKQILTEGERY+MT  N +S   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G   + Q +++I  + ++L + LK+V L+GL I+ F  AYS   L +Y G   +      LLR +  YVL+L++NGV+ECF ++++ K ++ R+ Y M+  S  F   S  +    G+VG I ANC NM LRI  S  +I  +Y+ S Y     +  S P    +LA   ++       +CC       L HI +G   ++V     +  E   + FI     S  +RK +
Sbjct:   21 QILFRVLTFALNAFTLRYVSKEIIGIVNVRLTLFYTTVVFLAREAFRRACLSHSAQQSWRHTIHLTWLAVPLGICWSFILGWIWLQILEVPEPEAIPY--YNIGVWAFGFSAVVELLAEPFWVLAQAHLFVKLKVVAESLAIIIRCSVTVILVLLCPQWGLLIFSLAQVLYTSALALCYIAYFARFLGSLEAEKK---PFPLRRMREFLPRFSSSQAFLDWKQAWLAWSFFKQSFLKQILTEGERYVMTFLNVLSFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKKVQSQRKEEISMASEVLESLLKLVTLIGLVIIAFGYAYSHLALDIYGGSMLSGGSGPVLLRCYCLYVLLLAINGVTECFTFASMGKEDVDRYNYVMLGLSLSFLCLSYYMTLWLGSVGFILANCFNMGLRITHSLLYIMRYYKGSPYQPLIGLLPS-PVVVCVLAVSAAVTGYSEVALCCDKGWLLCLGHIVVGGLCLLVTLGAAVLSEKKLTHFIRSHLLSRHQRKEQ 539          
BLAST of Protein RFT1 homolog vs. Ensembl Xenopus
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:780289])

HSP 1 Score: 240.35 bits (612), Expect = 5.406e-70
Identity = 177/523 (33.84%), Postives = 287/523 (54.88%), Query Frame = 3
Query:  696 IFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSK 2240
            +FR+LTF +N   +R++ K+I+G+VNVRL L ++T++F+ RE FR+ CLS +   + R  I+L WL VP  +  S    +IW + +  P    I Y  Y + V  +G S+++ELL+EP W+++Q +L V+ + I E+LA+  R  ++ IL       GL  F +AQ+ Y+  ++  Y  YF + +  L+  K       ++R R+  P   + +  ++  Q  +   F     LKQILTEGERY+MT  N +S   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G   + Q +++I  + ++L + LK+V L+GL I+ F  AYS   L +Y G   +      LLR +  YVL+L++NGV+ECF ++++ K ++ R+ Y M+  S  F   S  +    G+VG I ANC NM LRI  S  +I  +Y+ S Y     +  S P    +LA   ++       +CC       L HI +G   ++V     +  E   + FI     S  +RK +
Sbjct:   15 LFRVLTFALNAFTLRYVSKEIIGIVNVRLTLFYTTVVFLAREAFRRACLSHSAQQSWRHTIHLTWLAVPLGICWSFILGWIWLQILEVPEPEAIPY--YNIGVWAFGFSAVVELLAEPFWVLAQAHLFVKLKVIAESLAIIIRCSVTVILVLLCPQWGLLIFSLAQVLYTSALALCYIAYFARFLGSLEAEKK---PFPLRRMREFLPRFSSSQAFLDWKQAWLAWSFFKQSFLKQILTEGERYVMTFLNVLSFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKKVQSQRKEEISMASEVLESLLKLVTLIGLVIIAFGYAYSHLALDIYGGSMLSGGSGPVLLRCYCLYVLLLAINGVTECFTFASMGKEDVDRYNYVMLGLSLSFLCLSYYMTLWLGSVGFILANCFNMGLRITHSLLYIMRYYKGSPYQPLIGLLPS-PVVVCVLAVSAAVTGYSEVALCCDKGWLLCLGHIVVGGLCLLVTLGAAVLSEKKLTHFIRSHLLSRHQRKEQ 531          
BLAST of Protein RFT1 homolog vs. Ensembl Xenopus
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:780289])

HSP 1 Score: 240.35 bits (612), Expect = 6.909e-70
Identity = 177/523 (33.84%), Postives = 287/523 (54.88%), Query Frame = 3
Query:  696 IFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSK 2240
            +FR+LTF +N   +R++ K+I+G+VNVRL L ++T++F+ RE FR+ CLS +   + R  I+L WL VP  +  S    +IW + +  P    I Y  Y + V  +G S+++ELL+EP W+++Q +L V+ + I E+LA+  R  ++ IL       GL  F +AQ+ Y+  ++  Y  YF + +  L+  K       ++R R+  P   + +  ++  Q  +   F     LKQILTEGERY+MT  N +S   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G   + Q +++I  + ++L + LK+V L+GL I+ F  AYS   L +Y G   +      LLR +  YVL+L++NGV+ECF ++++ K ++ R+ Y M+  S  F   S  +    G+VG I ANC NM LRI  S  +I  +Y+ S Y     +  S P    +LA   ++       +CC       L HI +G   ++V     +  E   + FI     S  +RK +
Sbjct:   18 LFRVLTFALNAFTLRYVSKEIIGIVNVRLTLFYTTVVFLAREAFRRACLSHSAQQSWRHTIHLTWLAVPLGICWSFILGWIWLQILEVPEPEAIPY--YNIGVWAFGFSAVVELLAEPFWVLAQAHLFVKLKVIAESLAIIIRCSVTVILVLLCPQWGLLIFSLAQVLYTSALALCYIAYFARFLGSLEAEKK---PFPLRRMREFLPRFSSSQAFLDWKQAWLAWSFFKQSFLKQILTEGERYVMTFLNVLSFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKKVQSQRKEEISMASEVLESLLKLVTLIGLVIIAFGYAYSHLALDIYGGSMLSGGSGPVLLRCYCLYVLLLAINGVTECFTFASMGKEDVDRYNYVMLGLSLSFLCLSYYMTLWLGSVGFILANCFNMGLRITHSLLYIMRYYKGSPYQPLIGLLPS-PVVVCVLAVSAAVTGYSEVALCCDKGWLLCLGHIVVGGLCLLVTLGAAVLSEKKLTHFIRSHLLSRHQRKEQ 534          
BLAST of Protein RFT1 homolog vs. Ensembl Xenopus
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:780289])

HSP 1 Score: 239.965 bits (611), Expect = 9.168e-70
Identity = 175/512 (34.18%), Postives = 283/512 (55.27%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFI 2201
            Q +FR+LTF +N   +R++ K+I+G+VNVRL L ++T++F+ RE FR+ CLS +   + R  I+L WL VP  +  S    +IW + +  P    I Y  Y + V  +G S+++ELL+EP W+++Q +L V+ + I E+LA+  R  ++ IL       GL  F +AQ+ Y+  ++  Y  YF + +  L+  K       ++R R+  P   + +  ++  Q  +   F     LKQILTEGERY+MT  N +S   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G   + Q +++I  + ++L + LK+V L+GL I+ F  AYS   L +Y G   +      LLR +  YVL+L++NGV+ECF ++++ K ++ R+ Y M+  S  F   S  +    G+VG I ANC NM LRI  S  +I  +Y+ S Y     +  S P    +LA   ++       +CC       L HI +G   ++V     +  E   + FI
Sbjct:   14 QILFRVLTFALNAFTLRYVSKEIIGIVNVRLTLFYTTVVFLAREAFRRACLSHSAQQSWRHTIHLTWLAVPLGICWSFILGWIWLQILEVPEPEAIPY--YNIGVWAFGFSAVVELLAEPFWVLAQAHLFVKLKVIAESLAIIIRCSVTVILVLLCPQWGLLIFSLAQVLYTSALALCYIAYFARFLGSLEAEKK---PFPLRRMREFLPRFSSSQAFLDWKQAWLAWSFFKQSFLKQILTEGERYVMTFLNVLSFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKKVQSQRKEEISMASEVLESLLKLVTLIGLVIIAFGYAYSHLALDIYGGSMLSGGSGPVLLRCYCLYVLLLAINGVTECFTFASMGKEDVDRYNYVMLGLSLSFLCLSYYMTLWLGSVGFILANCFNMGLRITHSLLYIMRYYKGSPYQPLIGLLPS-PVVVCVLAVSAAVTGYSEVALCCDKGWLLCLGHIVVGGLCLLVTLGAAVLSEKKLTHFI 519          
BLAST of Protein RFT1 homolog vs. Ensembl Xenopus
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:780289])

HSP 1 Score: 238.81 bits (608), Expect = 2.523e-69
Identity = 176/526 (33.46%), Postives = 290/526 (55.13%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSY-SLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSK 2240
            + +FR+LTF +N   +R++ K+I+G+VNVRL L ++T++F+ RE FR+ CLS +   + R  I+L WL VP  +  S    +IW + +  P    I Y  Y + V  +G S+++ELL+EP W+++Q +L V+ + I E+LA+  R  ++ IL       GL  F +AQ+ Y+  ++  Y  YF + +  L+  K       ++R R+  P   + +  ++  Q  +   F     LKQILTEGERY+MT  N +S   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G   + Q +++I  + ++L + LK+V L+GL I+ F  AYS   L +Y G   +      LLR +  YVL+L++NGV+ECF ++++ K ++ R+ Y M+  S  F   S  +    G+VG I ANC NM LRI  S  +I  +Y+ S Y  L  ++   V         ++ ++A+    +CC       L HI +G   ++V     +  E   + FI     S  +RK +
Sbjct:   21 RILFRVLTFALNAFTLRYVSKEIIGIVNVRLTLFYTTVVFLAREAFRRACLSHSAQQSWRHTIHLTWLAVPLGICWSFILGWIWLQILEVPEPEAIPY--YNIGVWAFGFSAVVELLAEPFWVLAQAHLFVKLKVIAESLAIIIRCSVTVILVLLCPQWGLLIFSLAQVLYTSALALCYIAYFARFLGSLEAEKK---PFPLRRMREFLPRFSSSQAFLDWKQAWLAWSFFKQSFLKQILTEGERYVMTFLNVLSFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKKVQSQRKEEISMASEVLESLLKLVTLIGLVIIAFGYAYSHLALDIYGGSMLSGGSGPVLLRCYCLYVLLLAINGVTECFTFASMGKEDVDRYNYVMLGLSLSFLCLSYYMTLWLGSVGFILANCFNMGLRITHSLLYIMRYYKGSPYQPLIGLLPSPV---------VVCVLAVSAVALCCDKGWLLCLGHIVVGGLCLLVTLGAAVLSEKKLTHFIRSHLLSRHQRKEQ 532          
BLAST of Protein RFT1 homolog vs. Ensembl Mouse
Match: Rft1 (RFT1 homolog [Source:MGI Symbol;Acc:MGI:3607791])

HSP 1 Score: 245.743 bits (626), Expect = 5.068e-72
Identity = 170/490 (34.69%), Postives = 285/490 (58.16%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWD-KAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIG 2135
            Q +FR++TF++N  ++RFL K+I+G+VNVRL LL+ST  F+ RE FR+ CLS     +  + +NL+WL VP  +F S    ++W + +  P    + Y  Y   V+ +GLS+++ELL EP W+++Q ++ V+ + + E++++  R +L+ +L       GLY F +AQL Y+ V+   Y IY  +++   ++ K L  +  + R   + P I      +   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  RLIF  +E+S +L F+++ ++   A  Q QD +  +  +L + LK+ +L GLT+ +F  AYS   L +Y G    + +G  L+R +  YVL+L++NGV+ECF ++A++K E+ R+ + M+A S  F   S +L    G+VG I ANC NM +RI  S  FI  ++ +S +   + +  S P    +      + ++  + +CC+     +L HI++G
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGIVNVRLTLLYSTTTFLAREAFRRACLSGGAQRDWSQTLNLLWLTVPLGIFWSSCLGWVWLQLLEVPDPDVVPY--YGTGVLFFGLSAVVELLGEPFWVLAQAHMFVKLKVLAESMSVILRSVLTALLVLWLPHWGLYIFSLAQLLYTTVLVLCYAIYLIQLLRSPESAKQL--TLPVSRVTQLLPSISRSRAFVNWKEAGLAWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPVEESFYLFFAKVLEREKDASLQKQDDVAVAAAVLESLLKLALLTGLTMTVFGFAYSQLALDIYGGAMLSSGSGPVLMRCYCLYVLLLAINGVTECFMFAAMSKEEVDRYNFTMLALSSSFLVLSYLLTSWCGSVGFIMANCFNMGIRITQSLSFIHHYFRESPHRPLAGLRLS-PVLLGVFILSAGITSVSEAFLCCERGWPARLAHIAVG 505          
BLAST of Protein RFT1 homolog vs. Ensembl Mouse
Match: Rft1 (RFT1 homolog [Source:MGI Symbol;Acc:MGI:3607791])

HSP 1 Score: 178.718 bits (452), Expect = 3.200e-49
Identity = 124/344 (36.05%), Postives = 204/344 (59.30%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG 1700
            Q +FR++TF++N  ++RFL K+I+G+VNVRL LL+ST  F+ RE FR+ CLS     +  + +NL+WL VP  +F S    ++W + +  P    + Y  Y   V+ +GLS+++ELL EP W+++Q ++ V+ + + E++++  R +L+ +L       GLY F +AQL Y+ V+   Y IY  +++   ++ K L  +  + R   + P I      +   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  RLIF  +E+S +L F+++ ++   A  Q QD +  +  +L + LK+ +L GLT+ +F  AYS   L +Y G
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGIVNVRLTLLYSTTTFLAREAFRRACLSGGAQRDWSQTLNLLWLTVPLGIFWSSCLGWVWLQLLEVPDPDVVPY--YGTGVLFFGLSAVVELLGEPFWVLAQAHMFVKLKVLAESMSVILRSVLTALLVLWLPHWGLYIFSLAQLLYTTVLVLCYAIYLIQLLRSPESAKQL--TLPVSRVTQLLPSISRSRAFVNWKEAGLAWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPVEESFYLFFAKVLEREKDASLQKQDDVAVAAAVLESLLKLALLTGLTMTVFGFAYSQLALDIYGG 360          
BLAST of Protein RFT1 homolog vs. Ensembl Mouse
Match: Rft1 (RFT1 homolog [Source:MGI Symbol;Acc:MGI:3607791])

HSP 1 Score: 133.65 bits (335), Expect = 2.227e-34
Identity = 93/264 (35.23%), Postives = 153/264 (57.95%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLAS-SQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDI 1460
            Q +FR++TF++N  ++RFL K+I+G+VNVRL LL+ST  F+ RE FR+ CLS     +  + +NL+WL VP  +F S    ++W + +  P    + Y  Y   V+ +GLS+++ELL EP W+++Q ++ V+ + + E++++  R +L+ +L       GLY F +AQL Y+ V+   Y IY  +I  L++ +S    +  + R   + P I      +   +  +   F     LKQILTEGERY+MT  N ++   QG+  I
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGIVNVRLTLLYSTTTFLAREAFRRACLSGGAQRDWSQTLNLLWLTVPLGIFWSSCLGWVWLQLLEVPDPDVVPY--YGTGVLFFGLSAVVELLGEPFWVLAQAHMFVKLKVLAESMSVILRSVLTALLVLWLPHWGLYIFSLAQLLYTTVLVLCYAIY--LIQLLRSPESAKQLTLPVSRVTQLLPSISRSRAFVNWKEAGLAWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGKMCI 280          
BLAST of Protein RFT1 homolog vs. UniProt/SwissProt
Match: sp|Q96AA3|RFT1_HUMAN (Protein RFT1 homolog OS=Homo sapiens OX=9606 GN=RFT1 PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 4.612e-76
Identity = 180/487 (36.96%), Postives = 285/487 (58.52%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIG 2135
            Q +FR++TF++N  ++RFL K+I+G+VNVRL LL+ST +F+ RE FR+ CLS     +  + +NL+WL VP  +F S+   +IW + +  P       Y   V+++GLS+++ELL EP W+++Q ++ V+ + I E+L++  + +L+  L       GLY F +AQL Y+ V+   Y IYF  +L    +  L  +  + R  D+ P+I      I   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  RLIF  IE+S ++ F+++ ++G  A  Q Q+ +  +  +L + LK+ +L GLTI +F  AYS   L +Y G    + +G  LLR +  YVL+L++NGV+ECF ++A++K E+ R+ + M+A S  F   S +L    G+VG I ANC NM +RI  S  FI  +Y  S +   + +H S P      A    + A+    +CC+     +L HI++G
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGVVNVRLTLLYSTTLFLAREAFRRACLSGGTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGVVLFGLSAVVELLGEPFWVLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLYIFSLAQLFYTTVLVLCYVIYFTKLLGSPESTKL-QTLPVSRITDLLPNITRNGAFINWKEAKLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPIEESFYIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLALLAGLTITVFGFAYSQLALDIYGGTMLSSGSGPVLLRSYCLYVLLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSYLLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLS-PVLLGTFALSGGVTAVSEVFLCCEQGWPARLAHIAVG 505          
BLAST of Protein RFT1 homolog vs. UniProt/SwissProt
Match: sp|Q8C3B8|RFT1_MOUSE (Protein RFT1 homolog OS=Mus musculus OX=10090 GN=Rft1 PE=2 SV=2)

HSP 1 Score: 245.743 bits (626), Expect = 3.545e-71
Identity = 170/490 (34.69%), Postives = 285/490 (58.16%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWD-KAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIG 2135
            Q +FR++TF++N  ++RFL K+I+G+VNVRL LL+ST  F+ RE FR+ CLS     +  + +NL+WL VP  +F S    ++W + +  P    + Y  Y   V+ +GLS+++ELL EP W+++Q ++ V+ + + E++++  R +L+ +L       GLY F +AQL Y+ V+   Y IY  +++   ++ K L  +  + R   + P I      +   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  RLIF  +E+S +L F+++ ++   A  Q QD +  +  +L + LK+ +L GLT+ +F  AYS   L +Y G    + +G  L+R +  YVL+L++NGV+ECF ++A++K E+ R+ + M+A S  F   S +L    G+VG I ANC NM +RI  S  FI  ++ +S +   + +  S P    +      + ++  + +CC+     +L HI++G
Sbjct:   21 QVLFRLITFVLNAFILRFLSKEIVGIVNVRLTLLYSTTTFLAREAFRRACLSGGAQRDWSQTLNLLWLTVPLGIFWSSCLGWVWLQLLEVPDPDVVPY--YGTGVLFFGLSAVVELLGEPFWVLAQAHMFVKLKVLAESMSVILRSVLTALLVLWLPHWGLYIFSLAQLLYTTVLVLCYAIYLIQLLRSPESAKQL--TLPVSRVTQLLPSISRSRAFVNWKEAGLAWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPVEESFYLFFAKVLEREKDASLQKQDDVAVAAAVLESLLKLALLTGLTMTVFGFAYSQLALDIYGGAMLSSGSGPVLMRCYCLYVLLLAINGVTECFMFAAMSKEEVDRYNFTMLALSSSFLVLSYLLTSWCGSVGFIMANCFNMGIRITQSLSFIHHYFRESPHRPLAGLRLS-PVLLGVFILSAGITSVSEAFLCCERGWPARLAHIAVG 505          
BLAST of Protein RFT1 homolog vs. UniProt/SwissProt
Match: sp|Q0D2E8|RFT1_XENTR (Protein RFT1 homolog OS=Xenopus tropicalis OX=8364 GN=rft1 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.493e-69
Identity = 177/525 (33.71%), Postives = 288/525 (54.86%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYF-KIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSK 2240
            Q +FR+LTF +N   +R++ K+I+G+VNVRL L ++T++F+ RE FR+ CLS +   + R  I+L WL VP  +  S    +IW + +  P    I Y  Y + V  +G S+++ELL+EP W+++Q +L V+ + + E+LA+  R  ++ IL       GL  F +AQ+ Y+  ++  Y  YF + +  L+  K       ++R R+  P   + +  ++  Q  +   F     LKQILTEGERY+MT  N +S   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G   + Q +++I  + ++L + LK+V L+GL I+ F  AYS   L +Y G   +      LLR +  YVL+L++NGV+ECF ++++ K ++ R+ Y M+  S  F   S  +    G+VG I ANC NM LRI  S  +I  +Y+ S Y     +  S P    +LA   ++       +CC       L HI +G   ++V     +  E   + FI     S  +RK +
Sbjct:   21 QILFRVLTFALNAFTLRYVSKEIIGIVNVRLTLFYTTVVFLAREAFRRACLSHSAQQSWRHTIHLTWLAVPLGICWSFILGWIWLQILEVPEPEAIPY--YNIGVWAFGFSAVVELLAEPFWVLAQAHLFVKLKVVAESLAIIIRCSVTVILVLLCPQWGLLIFSLAQVLYTSALALCYIAYFARFLGSLEAEKK---PFPLRRMREFLPRFSSSQAFLDWKQAWLAWSFFKQSFLKQILTEGERYVMTFLNVLSFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKKVQSQRKEEISMASEVLESLLKLVTLIGLVIIAFGYAYSHLALDIYGGSMLSGGSGPVLLRCYCLYVLLLAINGVTECFTFASMGKEDVDRYNYVMLGLSLSFLCLSYYMTLWLGSVGFILANCFNMGLRITHSLLYIMRYYKGSPYQPLIGLLPS-PVVVCVLAVSAAVTGYSEVALCCDKGWLLCLGHIVVGGLCLLVTLGAAVLSEKKLTHFIRSHLLSRHQRKEQ 539          
BLAST of Protein RFT1 homolog vs. UniProt/SwissProt
Match: sp|Q9Y123|RFT1_DROME (Protein RFT1 homolog OS=Drosophila melanogaster OX=7227 GN=CG3149 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.086e-52
Identity = 165/492 (33.54%), Postives = 264/492 (53.66%), Query Frame = 3
Query:  633 KSTMESSIMIRKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSR----KLINLMWLIVPFILFISMSFTFIWCEFISY--PIKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSG---LGLYAFGIAQLAYSLVIS-GSY-FIYFKIILHLKTNKSLASSQTIKR-------------YRDIFP----------DIYNFEIEH-NQFL--MIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATG--TDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSS 1991
            ++ +ESS++    F++  FQ + RILTF IN  +VR + +++LG++NVRL+LL ST++F++RE   +  LS N     R    +LIN MWL VP    +     +IW  ++S    I   +Y+        S ++EL++E    ++Q+   V+ + ++  L +  R   S I  +  +G     + AF IAQL+ ++ I  G Y F YF    +LK  K   + Q  K+             + D FP           ++N   +H N+ L  +   FV   +LKQILTEGE+Y+M++S  +S   Q  +D+++NLGS+A R IF  IEDS +  F++   + +    Q Q+++R +  +L N L  V  +GL    F Q+YS+P+L+LY G D  A G    LL+     + +L+VNG+SE + ++     ++ ++ Y M  FS  F   S +L  I+G VG I+ANCINM+ RI+ ST +IR  Y   S
Sbjct:    3 RNVLESSLL-GAGFSII-FQILCRILTFGINAYIVRHVGREVLGIMNVRLLLLESTLLFLSREAINRAALSANAQQGDRCSWAQLINQMWLTVPICAVLCAPCLYIWLNWLSAVDAIYASQYEFACYAVAFSCVLELMAESAVFVAQVFCFVKLKILLNTLHILVR---SAIFLWIVTGDRSAAINAFAIAQLSSAVTIVLGQYGFFYF----YLKGFKDFVTQQAKKKPVAPKAWQVSLYEHMDDFPFKQLSDFLPGVMFNPNGKHFNRELQTLTLSFVKQGVLKQILTEGEKYVMSVSPVLSFGEQATYDVVNNLGSMAARFIFRPIEDSSYFYFTQTLSRDIKLAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVLLLYGGPDFVAGGLPQSLLQWHCLAIYLLAVNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTGIFGPVGFIFANCINMLSRILYSTYYIRHQYRPLS 485          
BLAST of Protein RFT1 homolog vs. UniProt/SwissProt
Match: sp|Q23444|RFT1_CAEEL (Protein RFT1 homolog OS=Caenorhabditis elegans OX=6239 GN=rfth-1 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.957e-40
Identity = 133/453 (29.36%), Postives = 225/453 (49.67%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGL----GLYA---FGIAQ----LAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVI 2012
            Q I RI++F IN+ L+R +  D+LGLVNVRL LL+S+I+F+TREP RK  +      +  K INL+WL       IS+   ++W  F S      E    V++    S I       + +  + L  +  ++ +  A+   +++     F  +GL    G+Y    F  AQ    +AY L    +++IY +       NKS+   +    + D+FP  ++  I+ +    +     + ILKQ+LT+G  Y+MT +  +SL+ Q  +D +  +GS+  R I S I+++C+  FS   ++      ++ D   D    L+  L +V ++G     F   YS  ++ LY G   +  G   LL ++S Y+LV ++NG++E F  ++++  ++  H   +   S +    + VL     + G I AN INM +RII + R IRE+  D   S   V+
Sbjct:   14 QLIARIISFAINMYLLRRINNDVLGLVNVRLTLLYSSILFLTREPLRKAEI---IRGSLPKFINLLWLSPIISTVISVVCVYLWYAFSS---TSDEVSWSVLLSFPISAIIESIAEPFSVISLRLESKCGSLAQHFAIGQGMLICVKRIFVLAGLFMFPGMYHLELFAYAQYIGAIAYLLFNFVAFYIYIR-------NKSIPELEQFSTFSDLFPK-FSEGIDRDSIHAVFTMFSHSILKQLLTDGSAYVMTFTELLSLKDQAVYDAVERVGSIIVRTILSPIDENCNAYFSNTIRKESSVFNKNTDNHDDLVDTLSKVLHVVGVIGFVACTFGIPYSPVVISLYGGKLLSENGGALLLSLYSGYILVTAINGITEGFAMASMDNRQIFTHGKFLFVTSIIHLIINYVLCVYMNSAGFIVANIINMSVRIIYNWRTIREYLGDKCPSFTEVL 452          
BLAST of Protein RFT1 homolog vs. TrEMBL
Match: A0A3M0JGN3 (Protein RFT1 homolog OS=Hirundo rustica rustica OX=333673 GN=DUI87_23438 PE=3 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.732e-80
Identity = 195/531 (36.72%), Postives = 301/531 (56.69%), Query Frame = 3
Query:  663 RKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSY-SLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKS 2237
            R + + A  Q +FR++TF +N   +R+L ++++G+VNVRL LL+ST++F+ RE FR+ CLS +   N  K INL+WL VP  +F S+    +W   +  P       Y+  V+ +GLS+IIELL EP W+++Q +L V  + I E+L++ ++ IL   L   +   GLY F +AQL Y  V+   Y IYF  ++ L + ++   S  + R + + P     E  +   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G P + Q QD +  +  +L   LK+V+L+GLTI +F  AYS   L +Y G    + TG DLLR +S YVL L+VNGV+ECF  + + K E+ R+ + M+A S +F   S  L H YG+VG I ANC NM +RI  ST +I  F+ +S++  LR ++    P   ++     ++      + CC      +LIHIS G   +      + Y E     F+  +F S   +K 
Sbjct:   12 RLASSSALLQVLFRVVTFGLNAFTLRYLSRELIGVVNVRLTLLYSTVVFLAREAFRRACLSGSAKRNWTKTINLLWLTVPLGVFWSLILGLVWLHLLEVPDPSVVPHYQAGVVAFGLSAIIELLGEPFWVLAQAHLFVRLKVIAESLSVVSKCILMVTLVILYPHWGLYIFCLAQLLYVSVLVMCYVIYF--VMFLGSPEATKKSFPVARVKALLPSFVEDETFVNWREARLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKPVKDQKQDDVAMAANVLELLLKLVLLIGLTITVFGYAYSQLALDIYGGSMLSSGTGPDLLRCYSLYVLFLAVNGVTECFTSALMCKEEVDRYNFVMLALSFIFLCISYFLTHRYGSVGFILANCFNMGIRITHSTHYIHHFFRESTHRPLRGLLPS--PALLLVYILSAAVTTFSEVLFCCDKGWMARLIHISTGALCLAATLVTMFYSETKLIHFVRSQFLSRYLKKG 538          
BLAST of Protein RFT1 homolog vs. TrEMBL
Match: A0A091L0X3 (Protein RFT1 homolog (Fragment) OS=Chlamydotis macqueenii OX=187382 GN=N324_09940 PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 2.743e-79
Identity = 189/530 (35.66%), Postives = 301/530 (56.79%), Query Frame = 3
Query:  663 RKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKS 2237
            R + + A  Q +FR++TF +N   +R+L ++++G+VNVRL LL+ST++F+ RE FR+ CLS +   N  K INL+WL VP  +F S+  + +W   +  P       Y+  V+ +GLS+IIELL EP W+++Q +L V  + I E+L++ ++ IL+ IL   +   GLY F +AQL Y  V+   Y IYF I L   + ++   S  + R + + P++   E  +   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++N GSL  R IF  IE+S ++ F+++ ++G   + Q QD +  +  +L   LK+V+++GLTI +F  AYS   L +Y G    + TG DLLR +S YVL L+VNGV+ECF ++ + K E+ R+ + M+A S  F   S  L H +G++G I ANC NM +RI  S  +I +++++S+Y+  + +  S P   ++      +        CC      +LIHIS+G          +   E     F+  +F S   +K 
Sbjct:    6 RLASSSALLQVLFRVVTFGLNAFTLRYLSRELIGVVNVRLTLLYSTVVFLAREAFRRACLSGSTKRNWTKTINLLWLTVPLGVFWSIFLSLVWLYLLEVPDPAVVPHYQAGVVAFGLSAIIELLGEPFWVLAQAHLFVRLKVIAESLSVVSKCILTVILVVLYPRWGLYIFSLAQLLYVSVLVMCYVIYFTIFL--GSPEARKKSFPVARMKALLPNLVEDETFVNWKEARLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNFGSLVARFIFLPIEESFYVFFAKVLERGKNVKDQKQDDVAMAANVLELLLKLVLMIGLTITVFGYAYSQLALDIYGGSMLSSGTGPDLLRCYSLYVLFLAVNGVTECFTFALMCKEEVDRYNFVMLALSFTFLCVSYFLTHWHGSIGFILANCFNMAIRIAHSIHYIYDYFKESTYNPLTGLLPS-PFLVLVCIVSGVITGFSEVFFCCDKGWMARLIHISLGALCFAATIVTMFCTETKLIHFVRSQFLSRYMKKG 532          
BLAST of Protein RFT1 homolog vs. TrEMBL
Match: A0A091JZH2 (Protein RFT1 homolog (Fragment) OS=Colius striatus OX=57412 GN=N325_07201 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.303e-79
Identity = 192/521 (36.85%), Postives = 299/521 (57.39%), Query Frame = 3
Query:  690 QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKS 2237
            Q +FR++TF +N   +R+L ++++G+VNVRL LL+ST++F+ RE FR+ CLS +   N  K INL+WL VP  +F S+    +W   +  P       Y+  V+ +GLS+IIELL EPLW+++Q +L V  + I E+L++ ++ IL+ IL   +   GLY F +AQ+ Y  V+   Y IYF  +  L + ++   S  I R + + P++   E  +   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  R IF  IE+S ++ F+++ ++G   + Q QD +  +  +L   LK+V+L+GLTI +F  AYS   L +Y G    + TG DLLR +S YVL L+VNGV+ECF ++ + K E+ R+ + M+A S  F   S  L H YG++G I ANC NM +RI  S  +I +++++S+Y   + +  S P   +I      +      + CC     G+LIHIS+G          +   E     F+  +F S   +K 
Sbjct:    1 QVLFRVVTFGLNAFTLRYLSRELIGVVNVRLTLLYSTVVFLAREAFRRACLSGSTKRNWTKTINLLWLTVPLGVFWSIFLGLVWLHLLEVPDPSVVPHYQAGVVTFGLSAIIELLGEPLWVLAQAHLFVRLKVIAESLSVVSKCILTVILVVLYPQWGLYVFALAQILYVSVLVMCYVIYF--VTFLGSPEATKKSFPIARIKALLPNMVEDETFVNWKEARLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKVLERGKNVKDQKQDDVAMAANVLELLLKLVLLIGLTITVFGYAYSQLALDIYGGSMLSSGTGPDLLRCYSLYVLFLAVNGVTECFTFALMCKEEVDRYNFVMLALSFTFLCISYFLTHWYGSIGFILANCFNMGIRIAHSIHYIYDYFKESTYRPLTGLLPS-PFLVLIYILSGVITGFSEVLFCCDKGWMGRLIHISMGALCFAATIVTMFCTETKLIHFVRSQFLSRYMKKG 518          
BLAST of Protein RFT1 homolog vs. TrEMBL
Match: A0A091LFJ2 (Protein RFT1 homolog (Fragment) OS=Cathartes aura OX=43455 GN=N323_05692 PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 3.413e-79
Identity = 191/530 (36.04%), Postives = 303/530 (57.17%), Query Frame = 3
Query:  663 RKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKS 2237
            R + + A  Q +FR++TF +N   +R+L ++++G+VNVRL LL+ST++F+ RE FR+ CLS +   N  K INL+WLIVP  +F S+    +W   +  P       Y+  V+ +GLS+IIELL EP W+++Q +L V  + I E+L++ ++ IL+ IL   +   GLY F +AQL Y  V+   Y IYF  ++ L + ++   S  + R + + P++   E  +   +  +   F     LKQ+LTEGERY+MT  N ++   QG +DI++NLGSL  R IF  IE+S ++ F++L ++G   + Q QD +  +  +L   LK+V+L+GLTI +F  AYS   L +Y G    + TG DLLR +S YVL L++NGV+ECF ++ + K E+ R+ + M+A S  F   S  L H +G++G I ANC NM +RI  S  +I +++++S+Y   + +  S P   ++      +        CC      +LIHIS+G        F +   E     F+  +F S   +K 
Sbjct:    6 RLASSSALLQVLFRVVTFGLNAFTLRYLSRELIGVVNVRLTLLYSTVVFLAREAFRRACLSGSTKRNWTKTINLLWLIVPLGVFWSVFLGLVWLHLLEVPDPSVVPHYQAGVVAFGLSAIIELLGEPFWVLAQAHLFVRLKVIAESLSVVSKCILTVILVVLYPQWGLYIFSLAQLLYVSVLVMCYVIYF--VMFLGSPEATKKSFPVARMKALLPNLMEDETFVNWKEARLTWSFFKQSFLKQVLTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARFIFLPIEESFYVFFAKLLERGKNVKDQKQDDVAMAANVLELLLKLVLLIGLTITVFGYAYSRLALDIYGGSMLSSGTGPDLLRCYSLYVLFLAINGVTECFTFALMCKEEVDRYNFVMLALSFTFLCISYFLTHWHGSIGFILANCFNMGIRIAHSIHYIYDYFKESAYRPLTGLLPS-PFLVLVYIISGVITGFSEVFFCCDKGWMARLIHISMGALCFAATIFTMFCTETKLIHFVRSQFLSRYMKKG 532          
BLAST of Protein RFT1 homolog vs. TrEMBL
Match: U3JLI4 (Protein RFT1 homolog OS=Ficedula albicollis OX=59894 GN=RFT1 PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 5.861e-79
Identity = 190/530 (35.85%), Postives = 298/530 (56.23%), Query Frame = 3
Query:  663 RKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKS 2237
            R + + A  Q +FR++TF +N   +R+L ++++G+VNVRL LL+ST+ F+ RE FR+ CLS +   N  K INL+WL VP  +F S+    +W   +  P       Y   V+ +GLS+IIELL EP W+++Q +L V  + I E+L++ ++ IL+  L   +   GLY F +AQL Y  V+   Y IYF  ++ L + ++   S  + R + + P     E  +   +  +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGSL  R +F  IE+S ++ F+++ ++G   + Q QD +  +  +L   LK V+L+GLTI +F  AY+   L +Y G    + TG DLLR +S YVL L+VNGV+ECF ++ + K E+ R+ + M+A S +F   S  L H YG+VG I ANC NM +RI  ST +I  ++ +S++   + +  S P   ++      + A    + CC      +LIHIS+G   +      +   E     F+  +F S   +K 
Sbjct:   12 RLASSSALLQVLFRVITFGLNAFTLRYLSREVIGVVNVRLTLLYSTVGFLAREAFRRACLSGSAKRNWTKTINLLWLTVPLGVFWSLILGLVWLYLLEVPDPSVVPHYPAGVVAFGLSAIIELLGEPFWVLAQAHLFVRLKVIAESLSVVSKCILTVTLVILYPHWGLYIFSLAQLLYVSVLVACYVIYF--VMFLGSPEATKKSFPVARVKALLPSFVEDETFVNWKEARLTWSFFKQSFLKQILTEGERYMMTFLNVLNFGDQGIYDIVNNLGSLVARFVFLPIEESFYVFFAKVLERGKSVKDQKQDDVAMAANVLELLLKFVLLIGLTITVFGYAYAQLALDIYGGSMLSSGTGPDLLRCYSLYVLFLAVNGVTECFTFALMCKEEVDRYNFVMLALSFIFLCISYFLTHWYGSVGFILANCFNMGIRIAHSTHYIYCYFRESTHRPLTGLLPS-PALLLVYVIGAVVTAFSEMLFCCDKGWMARLIHISMGALCLAATLVTMFCTETKLIHFVRSQFLSRYLKKG 538          
BLAST of Protein RFT1 homolog vs. Ensembl Cavefish
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:103041796])

HSP 1 Score: 226.868 bits (577), Expect = 4.295e-65
Identity = 183/546 (33.52%), Postives = 303/546 (55.49%), Query Frame = 3
Query:  642 MESSIMIRKSFTLAGF----QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLS-LNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIKY--KEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILH-LKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVF--NCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSKAT 2246
            M S  +++ +  LA +    Q +FR+LTF +N   +RF+ K+++G+VNVRL+LL++T++F++RE FR+ CLS      + R++INL+WL +P      +    +W   +  P       Y   V ++ L+++ ELL+EPLW+++  +++V  + + E+LA+  + +++ ++  +    GLY F  AQ  Y+  +   Y +YF   LH L + ++   +  +     + P   N +   N  L    + F     LKQILTEGERY+MT  N ++   QG +DI++NLGS+  R +F  IE+S ++ F+++ ++G  A+ Q Q++I  +  +L   LK+V+L+GL I  F  +YS   L +Y G    + TG  LLR +SFYVL+L+VNGV+ECF ++A++K E+ R+   M+A S  F   S  L  ++G VG I ANC NM LRI+ S  +I  F++ S ++  + +    P   + L     L A    M CC      +L HI+ G   ++    V+   E    QFI  + Q L +   K T
Sbjct:    1 MGSEEVLKSASALASYSVLLQVMFRLLTFFLNAFTLRFVSKELIGVVNVRLMLLYTTLVFLSREAFRRACLSGEGAGRDWRQVINLLWLTLPLGCLWGVLLVCVWWWLLQAPDPQTIPHYVPAVGIFCLAALTELLAEPLWVLAHAHMLVRLKVVAESLAMIAKCVVTVVMVVSAPQWGLYIFSAAQCVYAGFLLLCYVVYF---LHFLGSEEAEKKAFPLHNISQLLPTKVNGQPLINWKLATLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSMVARFLFLPIEESFYVFFAKVLERGQNAQQQKQEEISIAADVLECLLKLVLLVGLIITAFGYSYSHLALDMYGGELLSSGTGPSLLRCYSFYVLLLAVNGVTECFVFAAMSKEEVDRYNLVMLALSASFLLLSYWLTWLFGGVGFILANCCNMGLRIMHSIIYIHRFFQHSDHTPLAGLRPH-PALLITLVISSVLTAFSERMFCCDHGWFLRLAHITTGAVCLLAVVTVVFLTETRLVQFI--RTQLLPKYSKKHT 540          
BLAST of Protein RFT1 homolog vs. Ensembl Cavefish
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:103041796])

HSP 1 Score: 203.371 bits (516), Expect = 1.136e-56
Identity = 176/559 (31.48%), Postives = 295/559 (52.77%), Query Frame = 3
Query:  642 MESSIMIRKSFTLAGF----QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLS-LNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIKY--KEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTY----------------RMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSKAT 2246
            M S  +++ +  LA +    Q +FR+LTF +N   +RF+ K+++G+VNVRL+LL++T++F++RE FR+ CLS      + R++INL+WL +P      +    +W   +  P       Y   V ++ L+++ ELL+EPLW+++  +++V  + + E+LA+  + +++ ++  +    GLY F  AQ+  ++     Y +  K    L  +      Q +  ++                 +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGS+  R +F  IE+S ++ F+++ ++G  A+ Q Q++I  +  +L   LK+V+L+GL I  F  +YS   L +Y G    + TG  LLR +SFYVL+L+VNGV+ECF ++A++K E+ R+ +                 M+A S  F   S  L  ++G VG I ANC NM LRI+ S  +I  F++ S ++  + +    P   + L     L A    M CC      +L HI+ G   ++    V+   E    QFI  + Q L +   K T
Sbjct:    1 MGSEEVLKSASALASYSVLLQVMFRLLTFFLNAFTLRFVSKELIGVVNVRLMLLYTTLVFLSREAFRRACLSGEGAGRDWRQVINLLWLTLPLGCLWGVLLVCVWWWLLQAPDPQTIPHYVPAVGIFCLAALTELLAEPLWVLAHAHMLVRLKVVAESLAMIAKCVVTVVMVVSAPQWGLYIFSAAQVRLTM-----YVVLCKKCCQLMHDCVFLCLQPLINWKLA--------------TLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSMVARFLFLPIEESFYVFFAKVLERGQNAQQQKQEEISIAADVLECLLKLVLLVGLIITAFGYSYSHLALDMYGGELLSSGTGPSLLRCYSFYVLLLAVNGVTECFVFAAMSKEEVDRYMHFLHISASFLYVCRYNLVMLALSASFLLLSYWLTWLFGGVGFILANCCNMGLRIMHSIIYIHRFFQHSDHTPLAGLRPH-PALLITLVISSVLTAFSERMFCCDHGWFLRLAHITTGAVCLLAVVTVVFLTETRLVQFI--RTQLLPKYSKKHT 537          
BLAST of Protein RFT1 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001723.1 (pep scaffold:Pmarinus_7.0:GL480527:320:5020:1 gene:ENSPMAG00000001557.1 transcript:ENSPMAT00000001723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 1.986e-33
Identity = 76/197 (38.58%), Postives = 125/197 (63.45%), Query Frame = 3
Query: 1410 MTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG--WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSY 1994
            MT  N ++   QG +D+++NLGS+ PR +F  IEDS ++ F+R   +G  A  Q++D I    K+L + LK+V+L+G+T++ F  +YS+  L LY G     +  G  LLR +S YVL L++NG++ECF ++A+ ++E+ R+  R++  S VF   S  L   +G+VG + ANC+NM LR+  S +FI  ++ D+ +
Sbjct:    1 MTFFNVLNFGDQGIYDVVNNLGSMVPRFVFLPIEDSFYVFFARSLIRGKIAMQQNEDDIAIMAKVLQSLLKLVLLIGVTVLTFGFSYSYLALDLYGGSLLSSSGAGPMLLRWYSAYVLFLALNGITECFVFAAMEQSEVDRYNMRLLFLSVVFLVLSYALTRAFGSVGFVLANCLNMALRLASSLKFIAAYFRDTPH 197          
BLAST of Protein RFT1 homolog vs. Ensembl Yeast
Match: RFT1 (Membrane protein required for translocation of Man5GlcNac2-PP-Dol; required for translocation of Man5GlcNac2-PP-Dol from the cytoplasmic side to the lumenal side of the ER membrane but is not the flippase; mutation is suppressed by expression of human p53 protein; essential gene [Source:SGD;Acc:S000000116])

HSP 1 Score: 107.071 bits (266), Expect = 1.194e-24
Identity = 135/505 (26.73%), Postives = 246/505 (48.71%), Query Frame = 3
Query:  648 SSIMIRKSFTLAGF----QFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNS--------------------RKLINLMWLIVPFILFISMSFTFIWCEFI---SYPIKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFT----------------WSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDI------FPDIYNFEIEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGT-DLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXH--IYGTVGVIWANCINMMLRI----IISTRFIREFYEDSSY 1994
            S  ++ +S T A F    Q   +++TF++N  L+RFL   I G +   L  +  T++F +R+  R   L ++ + N                     +  +N  +  +PF +   +S   I  ++    +Y I    ++  + +  LS I+ELLSEP ++++Q  L    R+  E++A+ T  I++ I+ +                   G+ + AF + +LA+S+ +   Y  Y+  + + K  K  ++  T  + R+       +P   ++  +++     K   F    K +LTEG++  + I++  ++E QG + ++SN GSL  RL+F+ IE+S  L  +RL     P        ++ S ++L N  +  I L L I++F  A S  LL    G   + T   D +R++ FY+  LS+NG+ E F+ S    +++ +H+Y M+AFSG+F  +S +L+        G+I +N INM+LRI    +   +F RE + DSS+
Sbjct:   12 SEQILERSTTGATFLMMGQLFTKLVTFILNNLLIRFLSPRIFG-ITAFLEFIQGTVLFFSRDAIRLSTLRISDSGNGIIDDDDEEEYQETHYKSKVLQTAVNFAY--IPFWIGFPLSIGLIAWQYRNINAYFITLPFFRWSIFLIWLSIIVELLSEPFFIVNQFMLNYAARSRFESIAVTTGCIVNFIVVYAVQQSRYPMGVVTSDIDKEGIAILAFALGKLAHSITLLACY--YWDYLKNFKPKKLFSTRLTKIKTRENNELKKGYPKSTSYFFQNDILQHFKKVYFQLCFKHLLTEGDK--LIINSLCTVEEQGIYALLSNYGSLLTRLLFAPIEESLRLFLARLLSSHNP------KNLKLSIEVLVNLTRFYIYLSLMIIVFGPANSSFLLQFLIGSKWSTTSVLDTIRVYCFYIPFLSLNGIFEAFFQSVATGDQILKHSYFMMAFSGIFLLNSWLLIEKLKLSIEGLILSNIINMVLRILYCGVFLNKFHRELFTDSSF 503          
BLAST of Protein RFT1 homolog vs. Ensembl Nematostella
Match: EDO41402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4E5])

HSP 1 Score: 258.455 bits (659), Expect = 2.698e-77
Identity = 179/546 (32.78%), Postives = 305/546 (55.86%), Query Frame = 3
Query:  630 KKSTMESSIMIRKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSR---KLINLMWLIVPFILFISMSFTFIWCEFISYPIK--YKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNK-SLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAG-WDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSYSLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKSK 2240
             KS + S++  R +      Q  FRILTF +N  L+RF+ +D+LG+VNVRL+LL  TI F++RE FRK CL+ + + + +   ++INL+W + P  +  S    F+W  ++  P       Y + V+++  +  IELLSE LW+ISQ+ L    + ++E +A F + +L+  L   + GLG+ +F +AQ+++S++  G Y+ YF  +  L+T + S  +   +K   D  P I   +  +      +   F     LK+ILTEGER++MT+   ++   QG +D+I+NLGSL  R +F  IE+S +  FS +  +G  A+ Q  +  + + + L   LK  +L+G+TI++F  AYS+ LL +Y G       G+ LLR +  YVL+++VNG++ECF ++A++K ++  + Y+M+ FS +F  +S  L  I+G+ G I ANC+NM+LRI  S  FI+ F++++      V     P           +      ++CC      +++HI+IG A +     ++ ++E     F+    Q ++  K K
Sbjct:    3 DKSIVGSTV--RSASYNVALQVTFRILTFFMNGILMRFISRDMLGVVNVRLVLLQQTITFVSREAFRKSCLTKSASGSEQHWPQVINLLWCVFPIGVVTSALLGFVWIYYLEKPDPNIVANYSLAVVIFASTGAIELLSEQLWVISQVFLFFRLKVVIEGIANFVKCVLTVFLVIVFPGLGVMSFCLAQVSFSVLSVGLYYAYF--VHQLQTGEASKINDFPLKSMTDCLPAIIPGKAIVSLEMASLTWSFFKQSFLKKILTEGERFIMTLFQALTFAEQGIYDVINNLGSLVARCVFMPIEESYYTFFSHVLSRGKLAKDQPGESAKMAAQALELVLKFAVLVGMTILVFGYAYSYLLLDIYGGSMLSGGEGSSLLRWYCVYVLIIAVNGITECFMFAAMSKQDVDLYNYKMMLFSVIFLFASWYLT-IFGSAGFIMANCLNMLLRIAHSIGFIQHFFKETPNLQPLVGLVPSPMVVAAYFASAVITIASEILLCCDHGWGYRILHIAIGAACLFFTGMIVFFKETALKGFV---LQQMLGVKKK 540          
BLAST of Protein RFT1 homolog vs. Ensembl Medaka
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:101154940])

HSP 1 Score: 243.047 bits (619), Expect = 4.196e-71
Identity = 186/546 (34.07%), Postives = 305/546 (55.86%), Query Frame = 3
Query:  642 MESSIMIRKSFTLAG----FQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLS--LNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYP----IKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSY-SLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKS 2237
            M S   +R +FTLA      Q +FR+LTFL+N   +RF+ K+++G+VNVRL LL+ST++F++RE FR+ CLS     N N R+ INL+WL VP  +  ++    +W   +  P    + Y  Y   V+++  S + ELL+EPLW+++Q ++ V  + + E+LA+  +  ++ +L       GLY F  A L Y+  +   Y  YFK  L   + ++   S  + R  D+ P   + E  I+ +   +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGS+  R +F  IE+S ++ F+ +  +G   R Q+Q+    + ++L   LK+V+++GL I +F   YS   L +Y G   ++     LLR +S YVL+L+VNGV+ECF ++ ++K E+ ++   M+A S  F   S +L    G VG I ANC+NM LRI+ S R+I  +++ S +  LR ++   +    + LA   ++ A+  + +CC      +L+HI++G A +++        E     FI     S  R+K+
Sbjct:    1 MNSVDKLRNTFTLASCNVLLQVMFRVLTFLLNGFTLRFVSKELIGVVNVRLTLLYSTLVFLSREAFRRACLSGESGTNQNWRQTINLLWLTVPIGVLWALFLGSVWLWLLEVPDPGAVPY--YGAAVVLFAFSGVQELLAEPLWVLAQAHMFVWLKVVAESLAMIAKCSVTVVLVLFAREWGLYIFSAAHLVYTGFLLLCYVAYFKRFL--GSEEAAKKSFPLHRVTDLLPGRIHGEPLIDWSAAQLTWSFFKQSFLKQILTEGERYIMTFFNVLTFGDQGVYDIVNNLGSMVARFVFLPIEESFYVFFANVLDRGRDVRRQEQEAASIAAEVLECLLKLVVVIGLIITVFGYGYSHLALDIYGGSLLSSGSGPVLLRCYSCYVLLLAVNGVTECFVFATMSKEEVDKYNLLMLALSASFLLLSYMLTWWAGGVGFILANCLNMGLRILHSLRYIHRYFQISQWRPLRGLLPSPL--LLLALAVSAAVTAVSEAALCCDGGWWLRLLHIAVGGACLLLVLAATALSEKQLLHFIRTHLLSQYRKKT 540          
BLAST of Protein RFT1 homolog vs. Ensembl Medaka
Match: rft1 (RFT1 homolog [Source:NCBI gene;Acc:101154940])

HSP 1 Score: 181.415 bits (459), Expect = 4.527e-49
Identity = 159/528 (30.11%), Postives = 272/528 (51.52%), Query Frame = 3
Query:  666 KSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILLHSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIWCEFISYPIKYKEYKVVVMMYGXXXXXXXXXXXXXXXXQMNLMVEFRAIVEALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILHLKTNKSLASSQTIKRYRDIFPDIYNFE--IEHNQFLMIKGFVFNCILKQILTEGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRLHQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVLYAGWDKAATGTD-LLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRMXXXXXXXXXXXXXXXHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSSY-SLRSVIHQSVPHKXXXXXXXXXXXXXXXXMVCCKSTITGQLIHISIGLAFIIVDFFVILYREPNFSQFISLKFQSLIRRKS 2237
            +S  +   Q +FR+LTFL+N   +RF+ K+++G+VNVR+             P                 I ++W +        +   ++W   +  P     Y   V+++  S + ELL+EPLW+++Q ++ V  + + E+LA+  +  ++ +L       GLY F  A L Y+  +   Y  YFK  L   + ++   S  + R  D+ P   + E  I+ +   +   F     LKQILTEGERY+MT  N ++   QG +DI++NLGS+  R +F  IE+S ++ F+ +  +G   R Q+Q+    + ++L   LK+V+++GL I +F   YS   L +Y G   ++     LLR +S YVL+L+VNGV+ECF ++ ++K E+ ++   M+A S  F   S +L    G VG I ANC+NM LRI+ S R+I  +++ S +  LR ++   +    + LA   ++ A+  + +CC      +L+HI++G A +++        E     FI     S  R+K+
Sbjct:   16 QSVCVCVLQVMFRVLTFLLNGFTLRFVSKELIGVVNVRV-------------P-----------------IGVLWALF-------LGSVWLWLLEVPDPGAVPYYGAAVVLFAFSGVQELLAEPLWVLAQAHMFVWLKVVAESLAMIAKCSVTVVLVLFAREWGLYIFSAAHLVYTGFLLLCYVAYFKRFL--GSEEAAKKSFPLHRVTDLLPGRIHGEPLIDWSAAQLTWSFFKQSFLKQILTEGERYIMTFFNVLTFGDQGVYDIVNNLGSMVARFVFLPIEESFYVFFANVLDRGRDVRRQEQEAASIAAEVLECLLKLVVVIGLIITVFGYGYSHLALDIYGGSLLSSGSGPVLLRCYSCYVLLLAVNGVTECFVFATMSKEEVDKYNLLMLALSASFLLLSYMLTWWAGGVGFILANCLNMGLRILHSLRYIHRYFQISQWRPLRGLLPSPL--LLLALAVSAAVTAVSEAALCCDGGWWLRLLHIAVGGACLLLVLAATALSEKQLLHFIRTHLLSQYRKKT 502          
The following BLAST results are available for this feature:
BLAST of Protein RFT1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RFT19.605e-7736.96RFT1 homolog [Source:HGNC Symbol;Acc:HGNC:30220][more]
RFT13.691e-5733.47RFT1 homolog [Source:HGNC Symbol;Acc:HGNC:30220][more]
RFT11.233e-4133.86RFT1 homolog [Source:HGNC Symbol;Acc:HGNC:30220][more]
AC096887.11.020e-1040.45novel transcript[more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rfth-12.325e-4129.36pep chromosome:WBcel235:IV:4508530:4511320:-1 gene... [more]
rfth-12.321e-2528.77pep chromosome:WBcel235:IV:4508530:4510864:-1 gene... [more]
rfth-12.321e-2528.77pep chromosome:WBcel235:IV:4508499:4511320:-1 gene... [more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG31491.083e-5333.54gene:FBgn0027564 transcript:FBtr0070846[more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rft14.069e-6933.51RFT1 homolog [Source:ZFIN;Acc:ZDB-GENE-110411-126][more]
rft11.195e-4132.41RFT1 homolog [Source:ZFIN;Acc:ZDB-GENE-110411-126][more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rft12.818e-7033.71RFT1 homolog [Source:NCBI gene;Acc:780289][more]
rft15.406e-7033.84RFT1 homolog [Source:NCBI gene;Acc:780289][more]
rft16.909e-7033.84RFT1 homolog [Source:NCBI gene;Acc:780289][more]
rft19.168e-7034.18RFT1 homolog [Source:NCBI gene;Acc:780289][more]
rft12.523e-6933.46RFT1 homolog [Source:NCBI gene;Acc:780289][more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rft15.068e-7234.69RFT1 homolog [Source:MGI Symbol;Acc:MGI:3607791][more]
Rft13.200e-4936.05RFT1 homolog [Source:MGI Symbol;Acc:MGI:3607791][more]
Rft12.227e-3435.23RFT1 homolog [Source:MGI Symbol;Acc:MGI:3607791][more]
back to top
BLAST of Protein RFT1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96AA3|RFT1_HUMAN4.612e-7636.96Protein RFT1 homolog OS=Homo sapiens OX=9606 GN=RF... [more]
sp|Q8C3B8|RFT1_MOUSE3.545e-7134.69Protein RFT1 homolog OS=Mus musculus OX=10090 GN=R... [more]
sp|Q0D2E8|RFT1_XENTR1.493e-6933.71Protein RFT1 homolog OS=Xenopus tropicalis OX=8364... [more]
sp|Q9Y123|RFT1_DROME1.086e-5233.54Protein RFT1 homolog OS=Drosophila melanogaster OX... [more]
sp|Q23444|RFT1_CAEEL2.957e-4029.36Protein RFT1 homolog OS=Caenorhabditis elegans OX=... [more]
back to top
BLAST of Protein RFT1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M0JGN31.732e-8036.72Protein RFT1 homolog OS=Hirundo rustica rustica OX... [more]
A0A091L0X32.743e-7935.66Protein RFT1 homolog (Fragment) OS=Chlamydotis mac... [more]
A0A091JZH23.303e-7936.85Protein RFT1 homolog (Fragment) OS=Colius striatus... [more]
A0A091LFJ23.413e-7936.04Protein RFT1 homolog (Fragment) OS=Cathartes aura ... [more]
U3JLI45.861e-7935.85Protein RFT1 homolog OS=Ficedula albicollis OX=598... [more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rft14.295e-6533.52RFT1 homolog [Source:NCBI gene;Acc:103041796][more]
rft11.136e-5631.48RFT1 homolog [Source:NCBI gene;Acc:103041796][more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001723.11.986e-3338.58pep scaffold:Pmarinus_7.0:GL480527:320:5020:1 gene... [more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RFT11.194e-2426.73Membrane protein required for translocation of Man... [more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO414022.698e-7732.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein RFT1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rft14.196e-7134.07RFT1 homolog [Source:NCBI gene;Acc:101154940][more]
rft14.527e-4930.11RFT1 homolog [Source:NCBI gene;Acc:101154940][more]
back to top
BLAST of Protein RFT1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000585 ID=SMED30000585|Name=Protein RFT1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2276bp
ATGAAAAACAATTGAACAATCGGGAACTTCTTGTTTCAATTCCGATATTT
CTGTTGATAATTGATTCTCGTTTCCTGTTATCAAAAAAAATTTGACATAG
ACATTCTCTGGATAGTTCATTTAGCCAGATGTATGTCAAGGCCTTATCAA
TTCATGTTTTTGTGATACACATTTGAATGACAACCAACCATTTGATGCAC
TAACAACGTTGTTTAGTGGTGAGTATCAAGAAGTAAAATCGAGTGTTTTG
TTGGAGGTTGTTAAACTACTGTTGCTAAGAGCGAAGTTGCAGGTAGTTTA
CAATTCACATGACAGATTAATATAAGAGTAAAACGTGATTTTTAAGATAT
TCAGCAGTAAATTACATCTACACTCATCATCTTGAGTTATGTACTATTGC
AATGAAATAAAAATAGTTTGTTTTATTAAATTACTTAACAGATTTAGAAC
TAATTTGAATATCATGAAATAAATATTGCCTAATACATTTTTTGAAATAA
ATATTCTAAATAAGAATTATTACAAATATCTTTAGTGTGTTTAAATAATT
AATCCCAAGCGAAACATTTCAAATTTAAAAGTATATAAAATAATTAATTA
TTGTTAATTAAGTTATCATTTTGATTTTTAAAAAATCTACAATGGAATCT
TCTATAATGATTCGTAAGTCATTTACTCTTGCTGGATTTCAGTTTATTTT
TCGAATTTTGACTTTTTTAATAAATCTTACATTGGTAAGGTTTTTACAAA
AAGATATTTTGGGATTAGTTAATGTTCGTCTGATTCTCTTACATTCAACA
ATTATTTTTATTACAAGAGAGCCATTTCGTAAAGTTTGTTTGAGTTTGAA
TTTCAATGATAATTCACGAAAACTAATAAATCTTATGTGGCTAATAGTTC
CATTTATTTTATTTATCAGTATGTCATTTACATTTATATGGTGCGAATTT
ATTTCGTATCCTATAAAATATAAAGAATATAAAGTTGTTGTAATGATGTA
TGGATTATCGAGTATTATCGAATTACTAAGTGAACCGTTATGGTTAATTA
GTCAAATGAATTTGATGGTCGAATTCAGAGCTATCGTTGAAGCGTTGGCG
TTATTTACTAGAATTATTCTTTCAACTATTTTATATTTTACTTGGTCTGG
TCTCGGGTTGTATGCTTTCGGAATAGCTCAATTGGCATATAGTCTTGTGA
TTTCTGGCAGCTATTTTATATATTTTAAGATAATCTTACATTTAAAAACT
AATAAATCACTAGCATCATCTCAGACAATAAAACGATATCGTGATATTTT
CCCCGATATTTACAATTTTGAAATCGAACATAACCAGTTTCTGATGATTA
AAGGATTCGTTTTCAATTGCATTCTAAAACAAATCTTAACAGAAGGTGAG
CGGTATCTAATGACGATCTCCAATTGGATATCTTTGGAAATGCAAGGCGA
ATTCGATATCATTAGCAATTTGGGATCGCTGGCTCCTCGTTTGATATTCA
GCTCAATCGAGGACAGCTGTCATTTAGCGTTCTCCAGGTTGCACCAGCAA
GGACTGCCCGCCAGATTCCAGGATCAAGACAAAATCAGAGACAGCTACAA
GATTCTAACAAATTCATTGAAAATCGTCATCCTATTAGGACTGACAATTG
TCATATTTGCTCAAGCGTACTCCTGGCCTTTACTGGTGCTGTATGCCGGT
TGGGATAAGGCTGCAACTGGCACCGACTTGTTGCGCATATTTTCATTTTA
CGTATTAGTTCTATCAGTCAATGGCGTTTCGGAATGCTTTTATTACAGTG
CAATCAATAAGAACGAATTGCACCGACACACATATCGAATGGTCGCATTC
TCTGGGGTTTTCTTCGCCAGTAGCTCGGTATTAGTTCATATTTATGGAAC
TGTTGGAGTTATTTGGGCAAATTGCATCAATATGATGTTACGGATCATCA
TTAGCACGAGATTCATTAGGGAGTTTTATGAAGATTCCTCGTATTCTTTA
AGGTCAGTTATCCATCAGTCGGTGCCTCATAAATCTGTGATCTTGGCATA
TCTATTGTCCTTAATAGCAATTCTTGTATCCATGGTGTGTTGCAAGTCGA
CAATAACCGGGCAATTAATTCATATTTCTATTGGTCTCGCCTTCATTATT
GTGGATTTCTTTGTCATTTTATACAGGGAGCCTAATTTTTCACAGTTTAT
CAGTTTAAAATTCCAATCTTTGATTCGTCGAAAATCAAAAGCAACTTGAA
GAATAATTATTATGAATAAATATCAA
back to top

protein sequence of SMED30000585-orf-1

>SMED30000585-orf-1 ID=SMED30000585-orf-1|Name=SMED30000585-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=536bp
MESSIMIRKSFTLAGFQFIFRILTFLINLTLVRFLQKDILGLVNVRLILL
HSTIIFITREPFRKVCLSLNFNDNSRKLINLMWLIVPFILFISMSFTFIW
CEFISYPIKYKEYKVVVMMYGLSSIIELLSEPLWLISQMNLMVEFRAIVE
ALALFTRIILSTILYFTWSGLGLYAFGIAQLAYSLVISGSYFIYFKIILH
LKTNKSLASSQTIKRYRDIFPDIYNFEIEHNQFLMIKGFVFNCILKQILT
EGERYLMTISNWISLEMQGEFDIISNLGSLAPRLIFSSIEDSCHLAFSRL
HQQGLPARFQDQDKIRDSYKILTNSLKIVILLGLTIVIFAQAYSWPLLVL
YAGWDKAATGTDLLRIFSFYVLVLSVNGVSECFYYSAINKNELHRHTYRM
VAFSGVFFASSSVLVHIYGTVGVIWANCINMMLRIIISTRFIREFYEDSS
YSLRSVIHQSVPHKSVILAYLLSLIAILVSMVCCKSTITGQLIHISIGLA
FIIVDFFVILYREPNFSQFISLKFQSLIRRKSKAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007594RFT1
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006869lipid transport
Vocabulary: molecular function
TermDefinition
GO:0005319lipid transporter activity