Septin-5

Overview
NameSeptin-5
Smed IDSMED30000577
Length (bp)1441
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Septin-5 (SMED30000577) t-SNE clustered cells

Violin plots show distribution of expression levels for Septin-5 (SMED30000577) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Septin-5 (SMED30000577) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Septin-5 (SMED30000577) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000577

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30000577h1SMcG0003991 Contig173GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30000577h1SMcG0003991 dd_Smed_v4_4312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000577h1SMcG0003991 dd_Smed_v4_4312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000577h1SMcG0003991 dd_Smed_v4_4312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000577h1SMcG0003991 dd_Smed_v4_4312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000577h1SMcG0003991 dd_Smed_v4_4312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000577h1SMcG0003991 dd_Smed_v4_4312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000577h1SMcG0003991 dd_Smed_v6_4312_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000577h1SMcG0010661 dd_Smed_v6_4312_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Septin-5 vs. Ensembl Human
Match: AC000093.1 (novel transcript)

HSP 1 Score: 191.045 bits (484), Expect = 1.791e-55
Identity = 109/335 (32.54%), Postives = 185/335 (55.22%), Query Frame = 3
Query:  351 NDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
             D L E  LS +   +Q Q  +    K  +  A  P  +++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K+ I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:    8 QDRLVEQLLSPR---TQAQRRLKDIDKQYVGFATLP--NQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 331          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN5 (septin 5 [Source:HGNC Symbol;Acc:HGNC:9164])

HSP 1 Score: 191.045 bits (484), Expect = 1.791e-55
Identity = 109/335 (32.54%), Postives = 185/335 (55.22%), Query Frame = 3
Query:  351 NDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
             D L E  LS +   +Q Q  +    K  +  A  P  +++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K+ I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:    8 QDRLVEQLLSPR---TQAQRRLKDIDKQYVGFATLP--NQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 331          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN5 (septin 5 [Source:HGNC Symbol;Acc:HGNC:9164])

HSP 1 Score: 189.119 bits (479), Expect = 6.068e-55
Identity = 99/296 (33.45%), Postives = 170/296 (57.43%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K+ I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:   33 QVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 322          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN2 (septin 2 [Source:HGNC Symbol;Acc:HGNC:7729])

HSP 1 Score: 189.119 bits (479), Expect = 1.190e-54
Identity = 109/340 (32.06%), Postives = 183/340 (53.82%), Query Frame = 3
Query:  306 SDNRSIYCSMRI----RKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            S+ R+    +R+    R +  L   D  S K    Q   F+N      +  A  P  +++ RK  +K   F L+V+GE+GLGK T I S+   +   +  +    E++E+ +   + + +  I +   K+ L ++    YG  +     F  I+ YI+  F      E  L+R  I D ++HCC YFI+P+GH LK LD+ FMK    K+NI+P+IAKAD     E +  K+ IL++ E+HNI +   Y   D+  D +ED ++    LK ++P SV+ SN+ ++  K ++ + R Y WGVV+ ++ E++ FL L  +L+ +H+   + +T+ +HYEN+R
Sbjct:    5 SEGRATRPCLRVPSARRGDEGLHQRDEASQKMSKQQPTQFINPETPGYVGFANLP--NQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQ--IEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI---YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQ-LIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFR 335          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN2 (septin 2 [Source:HGNC Symbol;Acc:HGNC:7729])

HSP 1 Score: 186.037 bits (471), Expect = 7.117e-54
Identity = 103/303 (33.99%), Postives = 170/303 (56.11%), Query Frame = 3
Query:  417 NQFIKPEIKS----AETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
             QFI PE       A  P  +++ RK  +K   F L+V+GE+GLGK T I S+   +   +  +    E++E+ +   + + +  I +   K+ L ++    YG  +     F  I+ YI+  F      E  L+R  I D ++HCC YFI+P+GH LK LD+ FMK    K+NI+P+IAKAD     E +  K+ IL++ E+HNI +   Y   D+  D +ED ++    LK ++P SV+ SN+ ++  K ++ + R Y WGVV+ ++ E++ FL L  +L+ +H+   + +T+ +HYEN+R
Sbjct:    7 TQFINPETPGYVGFANLP--NQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQ--IEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI---YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQ-LIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFR 300          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-59 (pep chromosome:WBcel235:I:13629227:13633494:1 gene:WBGene00006793.1 transcript:W09C5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-59)

HSP 1 Score: 149.828 bits (377), Expect = 8.069e-40
Identity = 91/299 (30.43%), Postives = 161/299 (53.85%), Query Frame = 3
Query:  477 RKLSRKSLHFNLLVIGEAGLGKRTFIQSI-ISE--NSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRS-SIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRV-QFILQHVNENSDDP 1358
            R+  +    F L+V+G +GLGK TFI ++ ++E  N  +KE+    P      +   LV     + + +  + L ++    +G  + +   +  I+ Y+   F E F  E  +DR   I D+ +H CLYFI P GH LK +DIE MK    ++NI+P+I+KAD   + EL  FK+ I+ D E   I L+ +    D   D     +   ++L++ +P ++I SN  +     ++ + R+Y WG V+ ++ +++ FL L ++++++++I    +T++VHYEN+R  Q      NE + DP
Sbjct:   39 RRAVKNGFDFTLMVVGRSGLGKSTFINTLFLAEINNLNEKESAPTHPHPSTVRVEEKLVK----LVENSVSLNLTLVDTPGFGDAVNNSKCWEPIVNYVESKFFEQFCEETRIDRGEKIVDKCVHLCLYFIEPSGHGLKPIDIELMKHLHGRVNIVPVISKADCLTRDELLRFKKQIVKDAETAEIKLYKFPELEDPYTD-----KVAIEKLRKALPFAIIGSN-MLKEKDGKKIRYREYPWGTVEVENMQHNDFLTLRDMIIRTNLIDMIDVTRNVHYENFRFRQMEGLPKNEKNRDP 327          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 137.502 bits (345), Expect = 2.171e-35
Identity = 83/286 (29.02%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  465 HKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDL-GYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDR--SSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            H+L +K       FNL+ +GE G GK T I+S+         NMK+  E    +L    L + +  +A+   ++ L ++    +G  L  D +   I++Y+   F    + E    R      D +IH CLYFI+P GH LK+LD+  ++    ++N+IP+IAK+D   + EL  FK  IL++ +   I+++ +  +       +E V     E+ ++VP +V+ S + +     Q  + RQY WG+V+ ++  +  F+ L   LL++++   +  T    YENYR
Sbjct:   87 HQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLF--------NMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTD-------DETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYR 357          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 137.502 bits (345), Expect = 2.414e-35
Identity = 83/286 (29.02%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  465 HKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDL-GYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDR--SSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            H+L +K       FNL+ +GE G GK T I+S+         NMK+  E    +L    L + +  +A+   ++ L ++    +G  L  D +   I++Y+   F    + E    R      D +IH CLYFI+P GH LK+LD+  ++    ++N+IP+IAK+D   + EL  FK  IL++ +   I+++ +  +       +E V     E+ ++VP +V+ S + +     Q  + RQY WG+V+ ++  +  F+ L   LL++++   +  T    YENYR
Sbjct:   87 HQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLF--------NMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTD-------DETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYR 357          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731136:14734237:-1 gene:WBGene00006795.1 transcript:Y50E8A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 137.887 bits (346), Expect = 3.950e-35
Identity = 83/286 (29.02%), Postives = 145/286 (50.70%), Query Frame = 3
Query:  465 HKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDL-GYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDR--SSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            H+L +K       FNL+ +GE G GK T I+S+         NMK+  E    +L    L + +  +A+   ++ L ++    +G  L  D +   I++Y+   F    + E    R      D +IH CLYFI+P GH LK+LD+  ++    ++N+IP+IAK+D   + EL  FK  IL++ +   I+++ +  +       +E V     E+ ++VP +V+ S + +     Q  + RQY WG+V+ ++  +  F+ L   LL++++   +  T    YENYR
Sbjct:  156 HQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLF--------NMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTD-------DETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYR 426          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074371)

HSP 1 Score: 192.2 bits (487), Expect = 2.530e-56
Identity = 99/288 (34.38%), Postives = 167/288 (57.99%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQ 1331
            ++ RK  ++   F L+V+GE+GLGK T I S+   +  K   M    E +EK     +  K+  I +   ++ L ++    +G  +  + ++    +YI+  FR+ F  E  L+R +I+D ++HCCLYF+ P+GHSL+ +D++ ++    K+NI+ +I KAD  N+ E++  K+ IL D E ++I L+  +  CDS  D ++D +    ELK ++P +V+ SN  I+    ++ + RQY WGVV  +D E+S F+ L   L+ +H+   K  T+ VHYEN+R Q I Q
Sbjct:   22 QVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEK--TTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLY-QFPECDS--DEDDDFKQQDRELKASIPFAVVGSN-TILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQ 303          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074368)

HSP 1 Score: 192.586 bits (488), Expect = 6.878e-56
Identity = 99/288 (34.38%), Postives = 167/288 (57.99%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQ 1331
            ++ RK  ++   F L+V+GE+GLGK T I S+   +  K   M    E +EK     +  K+  I +   ++ L ++    +G  +  + ++    +YI+  FR+ F  E  L+R +I+D ++HCCLYF+ P+GHSL+ +D++ ++    K+NI+ +I KAD  N+ E++  K+ IL D E ++I L+  +  CDS  D ++D +    ELK ++P +V+ SN  I+    ++ + RQY WGVV  +D E+S F+ L   L+ +H+   K  T+ VHYEN+R Q I Q
Sbjct:   74 QVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTK--VEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLY-QFPECDS--DEDDDFKQQDRELKASIPFAVVGSN-TILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQ 355          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074366)

HSP 1 Score: 192.586 bits (488), Expect = 6.878e-56
Identity = 99/288 (34.38%), Postives = 167/288 (57.99%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQ 1331
            ++ RK  ++   F L+V+GE+GLGK T I S+   +  K   M    E +EK     +  K+  I +   ++ L ++    +G  +  + ++    +YI+  FR+ F  E  L+R +I+D ++HCCLYF+ P+GHSL+ +D++ ++    K+NI+ +I KAD  N+ E++  K+ IL D E ++I L+  +  CDS  D ++D +    ELK ++P +V+ SN  I+    ++ + RQY WGVV  +D E+S F+ L   L+ +H+   K  T+ VHYEN+R Q I Q
Sbjct:   74 QVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTK--VEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLY-QFPECDS--DEDDDFKQQDRELKASIPFAVVGSN-TILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQ 355          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074365)

HSP 1 Score: 192.586 bits (488), Expect = 6.878e-56
Identity = 99/288 (34.38%), Postives = 167/288 (57.99%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQ 1331
            ++ RK  ++   F L+V+GE+GLGK T I S+   +  K   M    E +EK     +  K+  I +   ++ L ++    +G  +  + ++    +YI+  FR+ F  E  L+R +I+D ++HCCLYF+ P+GHSL+ +D++ ++    K+NI+ +I KAD  N+ E++  K+ IL D E ++I L+  +  CDS  D ++D +    ELK ++P +V+ SN  I+    ++ + RQY WGVV  +D E+S F+ L   L+ +H+   K  T+ VHYEN+R Q I Q
Sbjct:   74 QVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTK--VEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLY-QFPECDS--DEDDDFKQQDRELKASIPFAVVGSN-TILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQ 355          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074369)

HSP 1 Score: 192.586 bits (488), Expect = 6.878e-56
Identity = 99/288 (34.38%), Postives = 167/288 (57.99%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQ 1331
            ++ RK  ++   F L+V+GE+GLGK T I S+   +  K   M    E +EK     +  K+  I +   ++ L ++    +G  +  + ++    +YI+  FR+ F  E  L+R +I+D ++HCCLYF+ P+GHSL+ +D++ ++    K+NI+ +I KAD  N+ E++  K+ IL D E ++I L+  +  CDS  D ++D +    ELK ++P +V+ SN  I+    ++ + RQY WGVV  +D E+S F+ L   L+ +H+   K  T+ VHYEN+R Q I Q
Sbjct:   74 QVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTK--VEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLY-QFPECDS--DEDDDFKQQDRELKASIPFAVVGSN-TILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQ 355          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept5b (septin 5b [Source:ZFIN;Acc:ZDB-GENE-040808-43])

HSP 1 Score: 197.208 bits (500), Expect = 3.248e-58
Identity = 104/296 (35.14%), Postives = 172/296 (58.11%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T I S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +  ++  I +YI   F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+EFMK  Q K+NI+P+I+KAD     E++  K  +  + EK  I ++  + +CDS  D +E+++    ELKE+ P +VI SN  IV  K Q  + R Y WG+V+ ++  +  F+ L N+L++SH+   K IT   HYENYR Q I Q  ++ + D
Sbjct:   31 QVHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTDLYKDRKLLNAEERISQTVE--IIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTESWRTITDYIEQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVEFMKALQDKVNIVPLISKADCLTPAEMRKMKDRVREEIEKFGIKVY-QFPDCDS--DEDEELKQQDRELKESTPFAVIGSN-TIVEVKGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDITCDAHYENYRAQCIQQMTSKLTQD 320          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept4a (septin 4a [Source:ZFIN;Acc:ZDB-GENE-051120-87])

HSP 1 Score: 194.126 bits (492), Expect = 7.942e-56
Identity = 97/286 (33.92%), Postives = 171/286 (59.79%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   M    E + + +   +   +  I ++  K+ L I+    +G  + +  ++  I++YI+  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+EFMK+   K+NI+P++AK D     E++  K  I  + E+ +I ++  +  C+S  D  ++ +    ELK++VP +VI SN + V ++ +  + RQY WG+V+ ++ E+S FL L N+L+++H+   K +T+  HYENYR Q I
Sbjct:  125 QVHRKSVKKGFAFTLMVAGESGLGKSTLVNSLFLTDLYKDRKMPNAEERIAQTVE--ITKHTVAIEEKGVKLRLTIVDTPGFGDAVNNTESWRAIVDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPIDVEFMKILHEKVNIVPVLAKTDSLTPEEVRKMKMKIREEIERFDIMIY-QFPECES--DEEDEFKLQQQELKDSVPFAVIGSNVQ-VESQGRRFRGRQYPWGLVEVENPEHSDFLKLRNMLVRTHMQDLKDVTRETHYENYRAQCI 404          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept5a (septin 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7868])

HSP 1 Score: 186.422 bits (472), Expect = 1.236e-53
Identity = 99/296 (33.45%), Postives = 167/296 (56.42%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   +   +  I ++  K+ L I+    +G  + ++  +  I +YI+  F + F+ E  L+R +I D ++HCCLYFI P+GH L+ +D+EFMK    K+NIIP+I+KAD     E++  K  + ++ E+  I ++  +  CDS  D  E+ + M  ELKE  P +VI SN  +V  + Q  + R Y WG+V+ ++  +  F+ L N+L++SH+   K +T  VHYENYR   I +  ++ + D
Sbjct:   72 QVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVE--ITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWRPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLISKADCLTPTEVKKLKDRVRDEIERFGIKVY-QFPECDS--DEEEEFKQMDKELKECTPFAVIGSN-TVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQD 361          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 183.341 bits (464), Expect = 2.957e-52
Identity = 100/281 (35.59%), Postives = 162/281 (57.65%), Query Frame = 3
Query:  477 RKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQ-KICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            RK  ++   F L+V+GE+GLGK T I S+   +   K+     P   ++      V +S ++ KE   ++ L I+    +G  + +   +  ++ YI+  F +    E  ++R  + D ++HCCLYFIAP GH LK LDIEFMK    K+N+IP+IAKAD     E Q FK+ I+ + ++H I ++ +    D     +ED + +  ++KE +PL+V+ SN  I VN +K   + RQY WGV + ++ E+  F +L N+L+++H+   K +T +VHYENYR
Sbjct:   31 RKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKD----YPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTED-----DEDSK-LIRKIKEKMPLAVVGSNVVIEVNGRKV--RGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYR 299          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 182.956 bits (463), Expect = 3.426e-52
Identity = 100/281 (35.59%), Postives = 162/281 (57.65%), Query Frame = 3
Query:  477 RKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQ-KICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            RK  ++   F L+V+GE+GLGK T I S+   +   K+     P   ++      V +S ++ KE   ++ L I+    +G  + +   +  ++ YI+  F +    E  ++R  + D ++HCCLYFIAP GH LK LDIEFMK    K+N+IP+IAKAD     E Q FK+ I+ + ++H I ++ +    D     +ED + +  ++KE +PL+V+ SN  I VN +K   + RQY WGV + ++ E+  F +L N+L+++H+   K +T +VHYENYR
Sbjct:   32 RKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKD----YPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTED-----DEDSK-LIRKIKEKMPLAVVGSNVVIEVNGRKV--RGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYR 300          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: metap1d (methionyl aminopeptidase type 1D (mitochondrial) [Source:Xenbase;Acc:XB-GENE-960806])

HSP 1 Score: 190.66 bits (483), Expect = 1.869e-56
Identity = 98/286 (34.27%), Postives = 170/286 (59.44%), Query Frame = 3
Query:  471 LRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            + RK  +K   F L+V GE+GLGK T I S+   +  +  ++ + PEE        +V ++  I ++  ++ L ++    YG  + ++  +  + +YI+  F + F+ E  L+R +++D ++HCCLYF++P GH ++ +DIEF++  Q K+NI+PI+ KAD     ELQ  KQ I ++ +K+ I ++  +  CD   D +ED +    ELK+++P +VI SN  I VN ++   + R Y WGVV+ ++ E+  F+ L  +L+++H+   K +T+  HYENYR Q I
Sbjct:    1 MHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHI-LSPEERVTQT-VEIVKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRVHCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIY-QFPECDP--DEDEDFKQQDIELKKSIPFAVIGSNTIIEVNGRRV--RGRMYPWGVVEVENEEHCDFIKLRTMLIRTHMQDLKDVTRETHYENYRAQCI 279          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: metap1d (methionyl aminopeptidase type 1D (mitochondrial) [Source:Xenbase;Acc:XB-GENE-960806])

HSP 1 Score: 189.889 bits (481), Expect = 4.530e-56
Identity = 98/286 (34.27%), Postives = 170/286 (59.44%), Query Frame = 3
Query:  471 LRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            + RK  +K   F L+V GE+GLGK T I S+   +  +  ++ + PEE        +V ++  I ++  ++ L ++    YG  + ++  +  + +YI+  F + F+ E  L+R +++D ++HCCLYF++P GH ++ +DIEF++  Q K+NI+PI+ KAD     ELQ  KQ I ++ +K+ I ++  +  CD   D +ED +    ELK+++P +VI SN  I VN ++   + R Y WGVV+ ++ E+  F+ L  +L+++H+   K +T+  HYENYR Q I
Sbjct:    1 MHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHI-LSPEERVTQT-VEIVKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRVHCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIY-QFPECDP--DEDEDFKQQDIELKKSIPFAVIGSNTIIEVNGRRV--RGRMYPWGVVEVENEEHCDFIKLRTMLIRTHMQDLKDVTRETHYENYRAQCI 279          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: metap1d (methionyl aminopeptidase type 1D (mitochondrial) [Source:Xenbase;Acc:XB-GENE-960806])

HSP 1 Score: 191.815 bits (486), Expect = 5.861e-56
Identity = 98/287 (34.15%), Postives = 171/287 (59.58%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++ RK  +K   F L+V GE+GLGK T I S+   +  +  ++ + PEE        +V ++  I ++  ++ L ++    YG  + ++  +  + +YI+  F + F+ E  L+R +++D ++HCCLYF++P GH ++ +DIEF++  Q K+NI+PI+ KAD     ELQ  KQ I ++ +K+ I ++  +  CD   D +ED +    ELK+++P +VI SN  I VN ++   + R Y WGVV+ ++ E+  F+ L  +L+++H+   K +T+  HYENYR Q I
Sbjct:   71 QMHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHI-LSPEERVTQT-VEIVKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRVHCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIY-QFPECDP--DEDEDFKQQDIELKKSIPFAVIGSNTIIEVNGRRV--RGRMYPWGVVEVENEEHCDFIKLRTMLIRTHMQDLKDVTRETHYENYRAQCI 350          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: metap1d (methionyl aminopeptidase type 1D (mitochondrial) [Source:Xenbase;Acc:XB-GENE-960806])

HSP 1 Score: 192.971 bits (489), Expect = 1.409e-55
Identity = 98/287 (34.15%), Postives = 171/287 (59.58%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++ RK  +K   F L+V GE+GLGK T I S+   +  +  ++ + PEE        +V ++  I ++  ++ L ++    YG  + ++  +  + +YI+  F + F+ E  L+R +++D ++HCCLYF++P GH ++ +DIEF++  Q K+NI+PI+ KAD     ELQ  KQ I ++ +K+ I ++  +  CD   D +ED +    ELK+++P +VI SN  I VN ++   + R Y WGVV+ ++ E+  F+ L  +L+++H+   K +T+  HYENYR Q I
Sbjct:   94 QMHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHI-LSPEERVTQT-VEIVKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRVHCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIY-QFPECDP--DEDEDFKQQDIELKKSIPFAVIGSNTIIEVNGRRV--RGRMYPWGVVEVENEEHCDFIKLRTMLIRTHMQDLKDVTRETHYENYRAQCI 373          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: metap1d (methionyl aminopeptidase type 1D (mitochondrial) [Source:Xenbase;Acc:XB-GENE-960806])

HSP 1 Score: 192.586 bits (488), Expect = 3.582e-55
Identity = 98/287 (34.15%), Postives = 171/287 (59.58%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++ RK  +K   F L+V GE+GLGK T I S+   +  +  ++ + PEE        +V ++  I ++  ++ L ++    YG  + ++  +  + +YI+  F + F+ E  L+R +++D ++HCCLYF++P GH ++ +DIEF++  Q K+NI+PI+ KAD     ELQ  KQ I ++ +K+ I ++  +  CD   D +ED +    ELK+++P +VI SN  I VN ++   + R Y WGVV+ ++ E+  F+ L  +L+++H+   K +T+  HYENYR Q I
Sbjct:  128 QMHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHI-LSPEERVTQT-VEIVKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRVHCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIY-QFPECDP--DEDEDFKQQDIELKKSIPFAVIGSNTIIEVNGRRV--RGRMYPWGVVEVENEEHCDFIKLRTMLIRTHMQDLKDVTRETHYENYRAQCI 407          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Gm49601 (predicted gene, 49601 [Source:MGI Symbol;Acc:MGI:6215011])

HSP 1 Score: 190.274 bits (482), Expect = 1.523e-55
Identity = 109/334 (32.63%), Postives = 184/334 (55.09%), Query Frame = 3
Query:  354 DLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            D L E  LS +   +Q Q  +    K  +  A  P  +++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K  I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:    9 DRLVEQLLSPR---TQAQRRLKDIDKQYVGFATLP--NQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 331          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept5 (septin 5 [Source:MGI Symbol;Acc:MGI:1195461])

HSP 1 Score: 190.274 bits (482), Expect = 1.951e-55
Identity = 109/335 (32.54%), Postives = 184/335 (54.93%), Query Frame = 3
Query:  351 NDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
             D L E  LS +   +Q Q  +    K  +  A  P  +++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K  I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:    8 QDRLVEQLLSPR---TQAQRRLKDIDKQYVGFATLP--NQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 331          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept5 (septin 5 [Source:MGI Symbol;Acc:MGI:1195461])

HSP 1 Score: 188.348 bits (477), Expect = 8.507e-55
Identity = 99/296 (33.45%), Postives = 169/296 (57.09%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K  I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:   33 QVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 322          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept2 (septin 2 [Source:MGI Symbol;Acc:MGI:97298])

HSP 1 Score: 184.496 bits (467), Expect = 2.056e-53
Identity = 102/303 (33.66%), Postives = 170/303 (56.11%), Query Frame = 3
Query:  417 NQFIKPEIKS----AETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
             QFI PE       A  P  +++ RK  +K   F L+V+GE+GLGK T I S+   +   +  +    E++E+ +   + + +  I +   K+ L ++    YG  +     F  I+ YI+  F      E  L+R  I D ++HCC YFI+P+GH LK LD+ FMK    K+NI+P+IAKAD     E +  K+ IL++ E+H+I +   Y   D+  D +ED ++    LK ++P SV+ SN+ ++  K ++ + R Y WGVV+ ++ E++ FL L  +L+ +H+   + +T+ +HYEN+R
Sbjct:    7 TQFINPETPGYVGFANLP--NQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQ--IEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKI---YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQ-LIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFR 300          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept2 (septin 2 [Source:MGI Symbol;Acc:MGI:97298])

HSP 1 Score: 184.496 bits (467), Expect = 2.056e-53
Identity = 102/303 (33.66%), Postives = 170/303 (56.11%), Query Frame = 3
Query:  417 NQFIKPEIKS----AETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
             QFI PE       A  P  +++ RK  +K   F L+V+GE+GLGK T I S+   +   +  +    E++E+ +   + + +  I +   K+ L ++    YG  +     F  I+ YI+  F      E  L+R  I D ++HCC YFI+P+GH LK LD+ FMK    K+NI+P+IAKAD     E +  K+ IL++ E+H+I +   Y   D+  D +ED ++    LK ++P SV+ SN+ ++  K ++ + R Y WGVV+ ++ E++ FL L  +L+ +H+   + +T+ +HYEN+R
Sbjct:    7 TQFINPETPGYVGFANLP--NQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQ--IEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKI---YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQ-LIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFR 300          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q9BGQ3|SEPT5_MACFA (Septin-5 OS=Macaca fascicularis OX=9541 GN=SEPTIN5 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 8.160e-55
Identity = 109/335 (32.54%), Postives = 185/335 (55.22%), Query Frame = 3
Query:  351 NDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
             D L E  LS +   +Q Q  +    K  +  A  P  +++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K+ I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:    8 QDRLVEQLLSPR---TQAQRRLKDIDKQYVGFATLP--NQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVDNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 331          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q0VC68|SEPT5_BOVIN (Septin-5 OS=Bos taurus OX=9913 GN=SEPTIN5 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.442e-54
Identity = 99/296 (33.45%), Postives = 171/296 (57.77%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K+  +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K+ I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:   33 QVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKERKLLSAEERISQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPGEIRKLKERIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 322          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q99719|SEPT5_HUMAN (Septin-5 OS=Homo sapiens OX=9606 GN=SEPTIN5 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.914e-54
Identity = 99/296 (33.45%), Postives = 170/296 (57.43%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K+ I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:   33 QVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 322          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q9Z2Q6|SEPT5_MOUSE (Septin-5 OS=Mus musculus OX=10090 GN=Septin5 PE=1 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 5.951e-54
Identity = 99/296 (33.45%), Postives = 169/296 (57.09%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + +   +  I +Y++  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ +D+ FMK    K+NI+P+IAKAD     E++  K  I  + +K  I+++  +  CDS  D +ED +    ELKE+ P +VI SN  +V  K Q  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T  VHYENYR   I Q  ++ + D
Sbjct:   33 QVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVE--ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVY-QFPECDS--DEDEDFKQQDRELKESAPFAVIGSN-TVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD 322          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q91Y81|SEPT2_RAT (Septin-2 OS=Rattus norvegicus OX=10116 GN=Septin2 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.821e-53
Identity = 103/303 (33.99%), Postives = 171/303 (56.44%), Query Frame = 3
Query:  417 NQFIKPEIKS----AETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
             QFI PE       A  P  +++ RK  +K   F L+V+GE+GLGK T I S+   +   +  +    E++E+ +   + + +  I +   K+ L ++    YG  + S   F  I+ YI+  F      E  L+R  I D ++HCC YFI+P+GH LK LD+ FMK    K+NI+P+IAKAD     E +  K+ IL++ E+H+I +   Y   D+  D +ED ++    LK ++P SV+ SN+ ++  K ++ + R Y WGVV+ ++ E++ FL L  +L+ +H+   + +T+ +HYEN+R
Sbjct:    7 TQFINPETPGYVGFANLP--NQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQ--IEASTVEIEERGVKLRLTVVDTPGYGDAINSRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKI---YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQ-LIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFR 300          
BLAST of Septin-5 vs. TrEMBL
Match: A0A5K3EVC6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 3.579e-58
Identity = 105/302 (34.77%), Postives = 175/302 (57.95%), Query Frame = 3
Query:  471 LRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSNL 1376
            + RK  +K  +F L++ GE+GLGK T + S+  ++ + K+   V   E  K +   +  +   + +   K+ L I+    +   + ++  +  I +YI+ TF + FK EC L+R +I+D ++HCCLYFI+PYGH L+ +D+EFM+  Q K+NI+P+IAKAD     EL+  K  I++D +K+ I+++     CDS  D  ED++ +  E+K  +P +VI SN  I     +  + RQY WGVV+ ++ ++  F  L   LLK+H+   K +T  VHYENYR ++I + ++    D  E   +
Sbjct:    1 MHRKAVKKGFNFTLMIAGESGLGKATLVNSLFMQD-LYKDRASVDASEKVKKV-TKIEKRQIELDERGVKLRLTIVDTPGFNDAVNAEDCWKPIEDYIDSTFEQYFKDECGLNRKNIQDNRVHCCLYFISPYGHGLRQVDVEFMRRLQNKVNIVPVIAKADALTASELRTLKDRIMSDLDKYKIDIY-RLPECDS--DEEEDIKRLDREIKAVLPFAVIGSNCVIEGEGGKRVRGRQYPWGVVEVENPKHCDFTKLRIFLLKTHMQDLKDMTLEVHYENYRAKYITERMSRRQTDRREVGGV 297          
BLAST of Septin-5 vs. TrEMBL
Match: S5XLH6 (Putative septin; Septin-5 OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.668e-57
Identity = 106/308 (34.42%), Postives = 180/308 (58.44%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRT-----FIQSIISENSIKKENMKVQPE-ELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSN 1373
            ++ RK  +K  +F L+V+GE+GLGK T     F+Q +  +  I + N ++Q   ++EK        +   + +   K+ L ++    +G  +  +  +  I +YI+ TF + FK EC L+R +I D ++HCCLYFI+PYGH L+ +D+EFM+  Q K+NI+P+IAKAD     EL+ FK+ I+ DF+++ I+++     CDS  D  ++++ +  E+K  +P +V+ SN  I  +  +  + RQY WG V+ ++  +  F  L   LLK+H+   K +T  VHYENYR ++I + +++   D  E  N
Sbjct:   74 QMHRKAVKKGFNFTLMVVGESGLGKSTLINSLFVQDLYKDREIIEANNRIQSTTQIEK--------RQIELDERGVKLRLTVVDTPGFGDAVNCNDCWKPIEDYIDSTFEQYFKDECGLNRKNIHDHRVHCCLYFISPYGHGLRQIDVEFMRRLQHKVNIVPVIAKADALTANELRAFKERIMTDFDRYKIDIY-RLPECDS--DEEDEIKRLDKEIKAVLPFAVVGSNCVIDLDGSRRARGRQYPWGSVEVENSRHCDFTKLRIFLLKTHMQDLKDMTLDVHYENYRAKYITERMSKRQSDRREGVN 370          
BLAST of Septin-5 vs. TrEMBL
Match: A0A4E0RTG5 (Septin-5 OS=Fasciola hepatica OX=6192 GN=D915_009058 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 3.694e-57
Identity = 107/304 (35.20%), Postives = 177/304 (58.22%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYL-IAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSNL 1376
            ++ RK  +K  +F L+V+GE+GLGK T I S+  ++  K   +   P+  ++      + K  + + +   K+ L ++    +   +     +  I +YI+GTF + FK EC L+R +I D ++HCCLYFI+PYGH L+ +D+ FM+  Q K+NI+PIIAKAD     EL  FK+ I++DF+++ I+++     CDS  D  E+++ +  E+K  +P +VI SN  +V       + RQY WGVV+ ++ ++  F  L   LLK+H+   K +T  VHYENYR ++I + +++   D  E   L
Sbjct:  239 QMHRKAVKKGFNFTLMVVGESGLGKSTLINSLFMQDLYKDREV---PDAGDRVRSTTQIEKRQIELDERGVKLRLTVVDTPGFNDAVNCTDCWKPIEDYIDGTFEQYFKDECGLNRKNIHDHRVHCCLYFISPYGHGLRQVDVAFMRRLQHKVNIVPIIAKADALTAAELHTFKERIMSDFDRYKIDIY-RLPECDS--DEEEEIKRLDKEIKSVLPFAVIGSN-CVVEVDGHRVRGRQYPWGVVEVENTKHCDFTKLRVFLLKTHMQDLKDMTLDVHYENYRAKYITERMSKRQTDRREGGGL 535          
BLAST of Septin-5 vs. TrEMBL
Match: A0A504Y6C7 (Septin-5 OS=Fasciola gigantica OX=46835 GN=FGIG_05397 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 4.137e-57
Identity = 107/304 (35.20%), Postives = 177/304 (58.22%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYL-IAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSNL 1376
            ++ RK  +K  +F L+V+GE+GLGK T I S+  ++  K   +   P+  ++      + K  + + +   K+ L ++    +   +     +  I +YI+GTF + FK EC L+R +I D ++HCCLYFI+PYGH L+ +D+ FM+  Q K+NI+PIIAKAD     EL  FK+ I++DF+++ I+++     CDS  D  E+++ +  E+K  +P +VI SN  +V       + RQY WGVV+ ++ ++  F  L   LLK+H+   K +T  VHYENYR ++I + +++   D  E   L
Sbjct:  239 QMHRKAVKKGFNFTLMVVGESGLGKSTLINSLFMQDLYKDREV---PDAGDRVRSTTQIEKRQIELDERGVKLRLTVVDTPGFNDAVNCTDCWKPIEDYIDGTFEQYFKDECGLNRKNIHDHRVHCCLYFISPYGHGLRQVDVAFMRRLQHKVNIVPIIAKADALTAAELHTFKERIMSDFDRYKIDIY-RLPECDS--DEEEEIKRLDKEIKSVLPFAVIGSN-CVVEVDGHRVRGRQYPWGVVEVENTKHCDFTKLRVFLLKTHMQDLKDMTLDVHYENYRAKYITERMSKRQTDRREGGGL 535          
BLAST of Septin-5 vs. TrEMBL
Match: A0A0A9Y2S3 (Septin-4 OS=Lygus hesperus OX=30085 GN=SEPT4 PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 4.295e-57
Identity = 103/288 (35.76%), Postives = 168/288 (58.33%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQ 1331
            ++ RK  ++   F L+V+GE+GLGK T + S+   +  K   +    ++LE+     +  K+  I +   K+ L ++    +G  L  D ++  ++ YI+  FR+ F  E  L+R +I+D ++HCCLYFI PYGH L+ +D+E MK    K+NI+P+I KAD     E++  KQ IL+D  +H I ++  +  CDS  D +E+ +    ELK ++P SVI SN  ++       + RQY WGVV+ ++ ++S F  L N+L+ +H+   K +T+ VHYEN+R Q I Q
Sbjct:   15 QIHRKSVKRGFDFTLMVVGESGLGKSTLVNSLFLSDLYKDRKIPEVADKLERTTT--IERKTMDIEERGVKLRLTVVDTPGFGDALNCDDSWKVVVNYIDDQFRQYFTDESGLNRKNIQDNRVHCCLYFIPPYGHGLRQIDVELMKRLHQKVNIVPVIGKADALTLPEIKKLKQRILDDIGEHGIQIY-QFPECDS--DEDEEFKQQDRELKASLPFSVIGSN-TVIEVGGSRTRGRQYPWGVVEVENPKHSDFNKLRNMLITTHMQDLKDVTEDVHYENFRAQCISQ 296          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept4a (septin-5-like [Source:NCBI gene;Acc:103047659])

HSP 1 Score: 195.282 bits (495), Expect = 1.018e-56
Identity = 101/286 (35.31%), Postives = 169/286 (59.09%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++ RK  +K   F L+V GE+GLGK T I S+   +  K   M    E + + +   ++  +  I ++  K+ L I+    +G  + +  ++  I++++   F + F+ E  L+R +I+D ++HCCLYFI+PYGH L+ +D+EFMK    K+NI+P++AKAD     EL   K  I  + E+  I+++  + +CDS  D    +QD   ELKE++P +V+ SN  +V +K +  + R Y WGVV+ ++  +S FL L N+L+++H+   K +T+  HYENYR Q I
Sbjct:  102 QVHRKSVKKGFAFTLMVAGESGLGKSTLINSLFLTDLYKDRKMLNAEERITQTVE--IIKHTIGIEEKGVKLKLTIVDTPGFGDAVNNTESWRPIVDFVEQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPYGHGLRPIDVEFMKALHEKVNIVPVLAKADCLTPAELSLKKIKIREEIERFGIHIY-QFPDCDSDEDEEFKLQDQ--ELKESIPFAVVGSN-ILVESKGRRFRGRTYPWGVVEVENPAHSDFLKLRNMLVRTHMQDLKDVTRETHYENYRAQCI 381          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept4a (septin-5-like [Source:NCBI gene;Acc:103047659])

HSP 1 Score: 195.282 bits (495), Expect = 1.540e-56
Identity = 101/286 (35.31%), Postives = 169/286 (59.09%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++ RK  +K   F L+V GE+GLGK T I S+   +  K   M    E + + +   ++  +  I ++  K+ L I+    +G  + +  ++  I++++   F + F+ E  L+R +I+D ++HCCLYFI+PYGH L+ +D+EFMK    K+NI+P++AKAD     EL   K  I  + E+  I+++  + +CDS  D    +QD   ELKE++P +V+ SN  +V +K +  + R Y WGVV+ ++  +S FL L N+L+++H+   K +T+  HYENYR Q I
Sbjct:  102 QVHRKSVKKGFAFTLMVAGESGLGKSTLINSLFLTDLYKDRKMLNAEERITQTVE--IIKHTIGIEEKGVKLKLTIVDTPGFGDAVNNTESWRPIVDFVEQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPYGHGLRPIDVEFMKALHEKVNIVPVLAKADCLTPAELSLKKIKIREEIERFGIHIY-QFPDCDSDEDEEFKLQDQ--ELKESIPFAVVGSN-ILVESKGRRFRGRTYPWGVVEVENPAHSDFLKLRNMLVRTHMQDLKDVTRETHYENYRAQCI 381          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept5a (septin 5 [Source:NCBI gene;Acc:103046048])

HSP 1 Score: 186.422 bits (472), Expect = 3.412e-54
Identity = 99/296 (33.45%), Postives = 168/296 (56.76%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   +   +  I ++  K+ L I+    +G  + ++  +  I +YI+  F + F+ E  L+R +I D ++HCCLYFI P+GH L+ +D+EFMK    K+NIIP++AKAD     E++  K  + ++ E+  I ++  +  CDS  D +E+ + M  ELKE  P +VI SN  +V  + Q  + R Y WG+V+ ++  +  F+ L N+L++SH+   K +T  VHYENYR   I +  ++ + D
Sbjct:   31 QVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVE--ITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLVAKADCLTPNEIKKLKDRVRDEIERFGIKVY-QFPECDS--DEDEEFKQMDKELKECTPFAVIGSN-TVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQD 320          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept5a (septin 5 [Source:NCBI gene;Acc:103046048])

HSP 1 Score: 186.422 bits (472), Expect = 4.660e-54
Identity = 99/296 (33.45%), Postives = 168/296 (56.76%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+GLGK T + S+   +  K   +    E + + +   +   +  I ++  K+ L I+    +G  + ++  +  I +YI+  F + F+ E  L+R +I D ++HCCLYFI P+GH L+ +D+EFMK    K+NIIP++AKAD     E++  K  + ++ E+  I ++  +  CDS  D +E+ + M  ELKE  P +VI SN  +V  + Q  + R Y WG+V+ ++  +  F+ L N+L++SH+   K +T  VHYENYR   I +  ++ + D
Sbjct:   38 QVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVE--ITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLVAKADCLTPNEIKKLKDRVRDEIERFGIKVY-QFPECDS--DEDEEFKQMDKELKECTPFAVIGSN-TVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQD 327          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept2 (septin 2 [Source:NCBI gene;Acc:103037588])

HSP 1 Score: 185.652 bits (470), Expect = 5.381e-54
Identity = 104/320 (32.50%), Postives = 176/320 (55.00%), Query Frame = 3
Query:  417 NQFIKPEIKS----AETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE 1364
             QF  PE       A  P  +++ RK  +K   F L+V+GE+GLGK T I S+   +   +  +    E++E+ +   + + +  I +   K+ L ++    YG  + S   FS I+ YI+  F      E  L+R  I D ++HCC YFI+P GH LK LD++FMK    K+N++P+IAKAD     E +  K+ IL++ ++H I +   Y   D+  D +ED ++    LK ++P +V+ SN++I   K ++ + R Y WGVV+ ++ E++ FL L  +L+ +H+   + +T+ +HYEN+R +  L+       +P E
Sbjct:   10 GQFTNPETPGYVGFANLP--NQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQ--IEASTVEIEERGVKLRLTVVDTPGYGDAINSQDCFSTIIAYIDDQFERYLHDESGLNRRHIVDNRVHCCFYFISPLGHGLKPLDVQFMKAIHNKVNVVPVIAKADTLTLKERERLKRRILDEIDEHGIKI---YHLPDAESDEDEDFKEQTRILKTSIPFAVVGSNQQI-EAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSER-LKRGGRKGPEPEE 319          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: zgc:162239 (zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28])

HSP 1 Score: 174.481 bits (441), Expect = 3.153e-50
Identity = 85/286 (29.72%), Postives = 160/286 (55.94%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++ RK  +K   F L+V GE+GLGK T I S+   +     +  + P + ++     ++ ++  I ++  ++ L+++    +   + +   +  ++EY+   F   F+ E  LDR +++D ++HCCLYFI+PYGH LK LD+EFMK    K+NI+P+IAKAD     E +  K+ +  +  +++I ++  +  CDS  D +++ +   +ELK ++P +VI     +V    +  + R Y WG+ + D  E+     L  +L+++H+   K +T+ +HYE +R + I
Sbjct:   33 QVHRKSVKKGFEFTLMVAGESGLGKSTLINSLFLTDLY--HDRVLLPADGKRCDTTEILRRTLEIEEKGVRLRLSLVDTPGFADAIDNTECWQPVVEYVEEQFESYFREESGLDRKNLQDTRVHCCLYFISPYGHGLKPLDVEFMKALHNKVNIVPVIAKADTLTMRERETLKRRVQEELSENDIKIY-QFPECDS--DEDDEFKRQDEELKASIPFAVI-GGSAVVEASGRRVRGRLYPWGIAEVDSSEHCDLAKLRTMLIRTHMQDLKDVTRDLHYEEHRARCI 312          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 171.785 bits (434), Expect = 1.153e-48
Identity = 95/294 (32.31%), Postives = 161/294 (54.76%), Query Frame = 3
Query:  477 RKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR---VQFILQHVNENS 1349
            RK +++   F L+V+GE+G+GK T I S+  +  +  E      + ++K +   +     +I +E   + L I+    YG  + +      ++++I+  F +    E  ++R  + D ++H CLYFIAP GH LK+LDIEFMK    K+NIIP++AKAD F   E   FK+ I+ D   +NI ++ +    D      E+   + +++KE +PL+VI SN  +    ++    R Y WGV + D+ E+  F  L  +L+++H+   K +T +VHYEN+R   +  +  +V ENS
Sbjct:   45 RKAAKRGFEFTLMVVGESGVGKSTLINSMF-KTDLYSEEFPGPTKRIQKTVK--VEQSKVVIREEGVHLTLTIVDTPGYGDFINNSECVQPVIDHIDSQFEDYLNAESRVNRRPMPDSRVHACLYFIAPSGHGLKALDIEFMKRLHNKVNIIPLVAKADAFLPTECCAFKKQIMKDIHDNNIKIYQFTDTHD------EEDNKLLNKIKERLPLAVIGSNVVVDVGGRRVWG-RHYPWGVAEVDNVEHCDFTTLRRMLIRTHMQDLKDVTNNVHYENFRSCKLAALTGNVAENS 328          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 160.229 bits (404), Expect = 2.188e-45
Identity = 87/287 (30.31%), Postives = 163/287 (56.79%), Query Frame = 3
Query:  462 LHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSS-IEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEK-IVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRV 1316
            L ++RRK  ++   FN++V+G++GLGK T + ++      +K       E++ K +   + S S++I ++  K+ L +I    +G  + ++  +  +++YIN  + +    E ++ R   I D ++HCC+YFI   GHSL+ LDIEFMK     +NI+P+IAK+D     E Q FK+ I    E   I+++ +  +     D +E+ + + ++++E +P +V+ S++  +VN +K     R+  WG+++ ++  + +F  L  +L++SH    K +T  VHYE YRV
Sbjct:   53 LEQMRRKAMKQGFEFNIMVVGQSGLGKSTLVNTLFKSPVSRKSCTPNHEEKIPKTVE--IKSVSHVIEEKGVKMKLTVIDTPGFGDQINNNNCWEPVLKYINDQYEKYLAEEVNITRKKVIPDSRVHCCIYFIPATGHSLRLLDIEFMKRLGKVVNIVPVIAKSDTLTLEERQAFKKKIREQLETQGISIYPHKEH-----DEDEEDRSVNNKIRELMPFAVVGSDKDYLVNGRKTLG--RKTKWGIIEIENVAHCEFSQLRELLIRSHTQDLKEVTSCVHYEGYRV 330          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 137.887 bits (346), Expect = 1.535e-37
Identity = 77/269 (28.62%), Postives = 145/269 (53.90%), Query Frame = 3
Query:  522 GEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSS-IEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCD--ELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQ 1319
            G++GLGK T + ++      +K       E + K +   + S S++I +   K+ L +I    +G  + ++  +  I++YI   + +  + E  + R   I D ++HCC+Y I P GHSL+ LD+EFM+     ++++P+I KAD     E   F+Q I  D   H I+++          +++ED Q   +  E++E +P +V+ S+ +   N ++    R+  WG+V+ ++  + +F LL ++L++SH+   K +T S+ YE YRV+
Sbjct:    1 GQSGLGKSTLVNTLFKSRVSRKSCTPNYQERILKTVE--IQSVSHVIEERGVKMKLTVIDTPGFGDQINNENCWEPILKYIGEQYEKYLREEVRITRKRHIPDTRVHCCIYCIPPSGHSLRPLDVEFMQHLSKVVSVVPVITKADTLTLEERHLFRQRIQADLVAHGIDVYPQR-------EFDEDEQGRLENAEVREKIPFAVVGSDREYQENGRRVLG-RKTRWGLVEVENINHCEFALLRDLLIRSHMEDLKDVTHSILYETYRVR 259          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 124.02 bits (310), Expect = 3.992e-33
Identity = 66/192 (34.38%), Postives = 108/192 (56.25%), Query Frame = 3
Query:  465 HKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQ-KICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGY 1037
            +++ RK  ++   F L+V+GE+GLGK T I S+   +    E      + + K L    V +S ++ KE   ++ L I+    +G  + + + + +I++YI+    +    E  ++R  + D ++HCCLYFI P GH LK LDIEFMK    K+NIIP+IAKAD     E Q FK+ I+ +  +H I ++ +
Sbjct:   24 NQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYASE-YPGPSQRVRKTLQ---VEQSKVVLKEGGVQLTLTIVDTPGFGDAVDNSSCWQSIIDYIDSKCEDYLNAEARVNRRLMPDSRVHCCLYFIFPSGHQLKPLDIEFMKRLHDKVNIIPLIAKADSLTTEECQQFKKTIMKEILEHKIKIYEF 211          
BLAST of Septin-5 vs. Ensembl Yeast
Match: CDC3 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble with other septins into rod-like complexes that can associate with other rods to form filament polymers; septin rings at the mother-bud neck act as scaffolds for recruiting factors needed for cell division and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000004306])

HSP 1 Score: 156.762 bits (395), Expect = 1.001e-42
Identity = 121/387 (31.27%), Postives = 197/387 (50.90%), Query Frame = 3
Query:  258 QKSENEDKTDS--TASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQM---QIFVNQ----FIKPEIKS----AETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLG-----------------YGLVSKSY--LIAKENQKICLNIIHNHDYGTGLKSDT-TFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLF--GYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            Q+S++ D  DS  T   Q+D+   + +     E+D+  E  L     SSQ    Q+  +Q    FI+ +I      A  P   +  R+  +    FNLL +G  G+GK T ++++ + + I+   +K   EEL  D                   + +  KSY  +I +   K+ LN+I    +G  L +D  ++  I++ I+  F +    E  ++R SI D++IH CLYFI P GH LK LD++FM+    K N+IP+IAK+DI    E+ +FK+ I+N   + NI LF    Y+N D+   +      + + L  ++P +VI SN+ + N    + + R Y WGV++ D+  +S F LL+N+L+K  +   K  T  + YENYR
Sbjct:   31 QESQDHDGVDSQYTNGTQNDDSERFEAA----ESDVKVEPGLGMGITSSQSEKGQVLPDQPEIKFIRRQINGYVGFANLP--KQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIKEIDSRFDQYLDAENKINRHSINDKRIHACLYFIEPTGHYLKPLDLKFMQSVYEKCNLIPVIAKSDILTDEEILSFKKTIMNQLIQSNIELFKPPIYSNDDAENSH------LSERLFSSLPYAVIGSNDIVENYSGNQVRGRSYPWGVIEVDNDNHSDFNLLKNLLIKQFMEELKERTSKILYENYR 405          
BLAST of Septin-5 vs. Ensembl Yeast
Match: CDC11 (Component of the septin ring that is required for cytokinesis; present at the ends of rod-like septin hetero-oligomers; C-terminal extension is important for recruitment of Bni5p to the mother-bud neck, which in turn is required for Myo1p recruitment and cytokinesis; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000003837])

HSP 1 Score: 144.821 bits (364), Expect = 3.690e-39
Identity = 85/287 (29.62%), Postives = 153/287 (53.31%), Query Frame = 3
Query:  474 RRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSY-LIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSS-IEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            +RK  ++ + F ++++G++G G+ TFI ++  +  +      + P +   ++   L  ++  L   E  KI LNII    +G  L +  +F  I +YI   + E    E  + R+   +D ++HCCLY I P GH LK +D+EF++   + +NIIP+I+K+D   + EL+  K+ I+ D ++ N+ ++ +  + D   D  ED +     L+  +P ++I SNE   +       + R+Y WG++  +D   S F++L N LL SH+   K  T  + YE YR + +
Sbjct:   13 KRKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDTSTEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDELKLNKKLIMEDIDRWNLPIYNFPFDEDEISD--EDYETNM-YLRTLLPFAIIGSNEVYEMGGDVGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEAL 296          
BLAST of Septin-5 vs. Ensembl Yeast
Match: SHS1 (Component of the septin ring that is required for cytokinesis; present at the ends of rod-like septin hetero-oligomers; C-terminal extension is important for recruitment of Bni5p to the mother-bud neck, which in turn is required for Myo1p recruitment and cytokinesis; undergoes sumoylation and phosphorylation during mitosis; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002384])

HSP 1 Score: 139.813 bits (351), Expect = 1.530e-36
Identity = 92/358 (25.70%), Postives = 158/358 (44.13%), Query Frame = 3
Query:  438 IKSAETPPLHKLRRKLS-RKSLHFNLLVIGEAGLGKRTFIQSII------------------------------------SENSIKKENMKVQPEELEKDLGYGLVSKSYLIAK----------ENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSS-IEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEK--VRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPN 1361
            + +A TPP++  RRK   ++ + + +L+ G AG GK  F  +++                                    S+N I     +  P     + G  + S S  +            E+  +  N+I  H  G  L        +M Y+   F      E  + R+   ED ++H  LYFI P GH L+ +D+E MK      N++PII +AD F + EL  F++NI+ D E++N+ ++ +  + +          D  + ++EN  L+ +     I ++ +  E   VR+Y WG++  DD + S   +L+N+L  SH+  FK  T+++ YENYR + +    N     PN
Sbjct:    1 MSTASTPPINLFRRKKEHKRGITYTMLLCGPAGTGKTAFANNLLETKIFPHKYQYGKSNASISSNPEVKVIAPTKVVSFNSKNGIPSYVSEFDPMRANLEPGITITSTSLELGGNKDQGKPEMNEDDTVFFNLIMTHGIGENLDDSLCSEEVMSYLEQQFDIVLAEETRIKRNPRFEDTRVHVALYFIEPTGHGLREVDVELMKSISKYTNVLPIITRADSFTKEELTQFRKNIMFDVERYNVPIYKFEVDPE---------DDDLESMEENQALASLQPFAIITSDTRDSEGRYVREYPWGIISIDDDKISDLKVLKNVLFGSHLQEFKDTTQNLLYENYRSEKLSSVANAEEIGPN 349          
BLAST of Septin-5 vs. Ensembl Yeast
Match: CDC12 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate with other rods to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000001149])

HSP 1 Score: 129.798 bits (325), Expect = 1.085e-33
Identity = 84/293 (28.67%), Postives = 152/293 (51.88%), Query Frame = 3
Query:  504 FNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDY----NED--VQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE 1364
            F +++ GE+GLGK TFI ++      + +  + + E + K +   +     L+ +++ ++ +N+I    +G  + ++  +  ++++I+       + E    R+   D ++H  LYFI P GH LK +DIE MK   T+ N+IP+IAKAD     ELQ FK  I    E   I +F    + DS  D     N D    +   +L E +P +++ S +K  N +  +   R+Y WG+V+ ++  +  F  L  +LL+++++   + T+ +HYE YR   +  H  EN+ + NE
Sbjct:   35 FTVMLCGESGLGKTTFINTLFQTVLKRADGQQHRQEPIRKTVEIDITRA--LLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDDQHDSYMRQEQQPYRTKKFDLRVHAVLYFIRPTGHGLKPIDIETMKRLSTRANLIPVIAKADTLTAQELQQFKSRIRQVIEAQEIRIFTPPLDADSKEDAKSGSNPDSAAVEHARQLIEAMPFAIVGSEKKFDNGQGTQVVARKYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYRRLRLEGH--ENTGEGNE 323          
BLAST of Septin-5 vs. Ensembl Yeast
Match: SPR3 (Sporulation-specific homolog of the CDC3/10/11/12 family of genes; septin protein involved in sporulation; regulated by ABFI; the yeast CDC3/10/11/12 family is a family of bud neck microfilament genes [Source:SGD;Acc:S000003291])

HSP 1 Score: 129.413 bits (324), Expect = 5.614e-33
Identity = 75/280 (26.79%), Postives = 141/280 (50.36%), Query Frame = 3
Query:  486 SRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            ++  + F L+V G++GLGK TFI S+ S + I  +  + +P          ++    ++  +   +  N+I    +G  + +  T+  ++ YI+   R     E   DR+ + D ++HCCLYF+ P    + +LD+  MK    ++N+IP+IAK+D+  + EL+NFK  +       +I +         C  + ++V +   ++ +  P S+I SNE I N K ++ K RQY WG V  ++ +   F +L+  +   ++I     T+  +YE  R + +
Sbjct:  104 AKNGIDFTLMVAGQSGLGKTTFINSLFSTSLIDDDIKENKP----------IIRYKSIVEGDGTHLNFNVIDTPGFGNNMDNAFTWRTMVNYIDEEIRSYIFQEEQPDRTKMVDNRVHCCLYFLRPSNKGIDTLDVVTMKKLAKRVNLIPVIAKSDLLTKEELKNFKTQVREIIRVQDIPV---------CFFFGDEVLNATQDIFQKYPFSIIASNEYIFNEKGEKVKGRQYKWGAVDIENEKYCDFKILQKTIFDWNLIDLVESTED-YYEKCRSEML 363          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO47409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX3])

HSP 1 Score: 183.341 bits (464), Expect = 1.876e-53
Identity = 91/287 (31.71%), Postives = 166/287 (57.84%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFIL 1328
            ++ RK  +K   F L+V+GE+GLGK T I S+   +    ++  + P +        + S +  I ++  ++ L ++    +   + +  ++  I++YI+  F    + E  L+R +I D ++HCCLYFI P+GH L+ +D+EFMK   TK+NI+P+IAK+D   + E+   K+ +L++   H I ++  +  CDS  D  E+   +  +LK ++P +VI SN  ++  K ++ + R Y WG  + ++ ++  F+ L N+L+++H+   K +T+ VHYENYR Q +L
Sbjct:   26 QVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLY--DDKSIPPAKGRIGQTVHIESNTVEIEEKGVRLRLTVVDTPGFADAVDNTYSWEPIVDYIDHQFESYLRDESGLNRRNIMDTRVHCCLYFINPHGHGLRPVDVEFMKALHTKVNIVPVIAKSDSLTKTEISRLKRKVLDEIADHEIKIYS-FPECDSEDD--EEFLAINKDLKASLPFAVIGSN-TVIEVKGRKVRARWYPWGYAEVENPDHCDFIKLRNMLVRTHMQDLKDVTQDVHYENYRAQRLL 306          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO34522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP25])

HSP 1 Score: 172.555 bits (436), Expect = 8.176e-49
Identity = 94/281 (33.45%), Postives = 156/281 (55.52%), Query Frame = 3
Query:  477 RKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQ-KICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKI-VNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYR 1313
            RK  +K   F ++V+GE+GLGK T + S+   +     +     E+L K +    V    +  KE   ++ L ++    +G  + +   +  +++YI+  F E    E  + RS   D ++HCCLYFI+P GHSLK LDIEFMK    K+NI+P+I+KAD     E   FK+ IL + +++NI+++ +       +   ED +     +++ VP +V+ SN  + VN K+   + R Y WGVV+ ++ E+  F+ L N+L+++H+   K +T   HYENYR
Sbjct:   16 RKSVKKGFEFTVMVVGESGLGKSTLLNSLFLTDLYTPSSYPSIKEKLNKTVE---VKPCTVELKEGGVRLRLTVVDTPGFGDAVDNTDCWKPVIKYIDSKFEEHLNAESRVQRSPFPDNRVHCCLYFISPTGHSLKPLDIEFMKKLHNKVNIVPVISKADTLTTEECTRFKKQILQEIKENNISIYEF-----PDLGGEEDAELDAVNMRDKVPFAVVGSNTVLEVNGKRV--RARVYPWGVVEVENVEHCDFVALRNMLIRTHMQDLKDVTNDAHYENYR 286          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO33106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST61])

HSP 1 Score: 158.688 bits (400), Expect = 2.634e-45
Identity = 86/262 (32.82%), Postives = 144/262 (54.96%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILL 1253
            ++ RK  +K   F L+V+GE+GLGK T I S+   +      +    E ++K +   + + +  I +   K+ L ++    YG G+    +F  I++Y N  F    K E  L+R  I D ++HCC YFIAP GH LK LDIEFMK     +NI+P+I KAD     EL+  K+ +L++ +++ I ++     CDS  D +E+  +   +LKE +P +V+ SN  +++   ++ + R Y WGVV+ ++  +  F  L  +L+
Sbjct:   13 QVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERIKKTVK--IETSTVEIEERGVKLRLTVVDTPGYGDGINHKNSFKPILDYANNQFESYLKDESGLNRRHIIDSRVHCCFYFIAPTGHGLKPLDIEFMKALHHIVNIVPVIGKADTLTPTELKEMKRRVLDEIDEYGIQIY-ELPQCDS--DEDEEFIEQTRQLKEGMPFAVVGSN-TLIDVCGKKVRGRLYPWGVVEVENPIHCDFSKLRAMLM 268          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO37950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE59])

HSP 1 Score: 147.517 bits (371), Expect = 4.500e-40
Identity = 91/296 (30.74%), Postives = 157/296 (53.04%), Query Frame = 3
Query:  492 KSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRS--SIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSN 1373
            +   FN+L IGE G+GK T + ++       +   + QP       G  +   +Y + + N  + L I+    YG  +  + + S+I+ YI+  F      E  + R+  +  D +IH CLYFI+P GHSLKSLD+  MK    K+NIIPIIAKAD   + EL+ FKQ I+++ E + + ++ +  +       +E V +M   +   +P +V+ S E+++ NK +  + R Y WG V+ ++  +  F+ L  +L+++++      T +VHYE +R +  L+ +  N  D N  S+
Sbjct:   41 RGFAFNILCIGETGIGKSTLMDTLF------QTTFEGQPHSHHLP-GVQIEHHTYDLNESNVMLKLTIVDTVGYGDQINKEDSSSSIVNYIDQQFDTYLHQELKIKRTMDTFHDTRIHACLYFISPTGHSLKSLDLVCMKQLDKKVNIIPIIAKADTIAKSELKQFKQKIMDELESNGVEIYRFPVD-------DETVAEMNSTMNNEIPFAVVGSREEVMVNKTK-SRARVYPWGTVEVENENHCDFVKLREMLIRTNMQSLIDKTHTVHYELFR-RNKLEEMGFNDGDANNKSH 320          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO47975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG1])

HSP 1 Score: 128.257 bits (321), Expect = 9.209e-35
Identity = 64/188 (34.04%), Postives = 110/188 (58.51%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSS-IEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINL 1028
            ++RRK  ++   FNL+V+G +GLGK T + ++  +  + +     +P  + K +   + S S++I ++  ++ L I     +G  + +D  +  IM+YIN  + +    E +++R   I D ++HCCLYFIAP GH LK +D+EFMK     +NI+P+IAKAD     E + F++ +  D + HNIN+
Sbjct:   11 QIRRKSLKRGFEFNLMVVGASGLGKSTMVNTLF-KGKLSRPTSTGKPTIIPKTVD--VKSVSHVIEEKGVRLKLTITDTPGFGDQINNDKCWEPIMDYINSQYDKFLTEEVTIERKPRIPDSRVHCCLYFIAPTGHRLKPIDVEFMKRLDKCVNIVPVIAKADNMTLEEREAFRRRLREDIQAHNINI 195          
BLAST of Septin-5 vs. Ensembl Medaka
Match: ENSORLT00000001335.2 (septin-5 [Source:NCBI gene;Acc:101166318])

HSP 1 Score: 192.586 bits (488), Expect = 1.567e-56
Identity = 96/286 (33.57%), Postives = 168/286 (58.74%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            +L RK  +K   F LLV GEAGLGK T + S+   +  K+  +    E +++ +   +  ++  I ++  K+ L I+     G  + +   +  + +YI+  F + F+ E  L+R +I+D ++HCCLYFI+P+G  L+ +D+EFMK  Q K N++P+IAKAD    +E++  K+ +  + +K+ I ++  + +CDS  D +E+ +    ELKE++P +VI  N  ++  + Q  + R Y WGVV+ ++  +  F+ L N+L+++H+   K  T  +HYENYR Q I
Sbjct:   32 QLHRKSVKKGFDFTLLVAGEAGLGKSTLVNSLFLTDLYKERKLLNAEERIKQTVE--ITKRTVDIEEKGVKLKLTIVDTPGVGDAVNNTQCWRPVTDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGQGLRPIDVEFMKALQDKANVVPVIAKADCLTPLEIKKLKERVREEIDKYGIKIY-QFPDCDS--DEDEESKQQDRELKESIPFAVIGGN-TVIEVRGQRVRGRLYPWGVVEVENPSHCDFVKLRNMLIRTHMHDLKDTTNDLHYENYRAQAI 311          
BLAST of Septin-5 vs. Ensembl Medaka
Match: sept5a (septin 5 [Source:NCBI gene;Acc:101158828])

HSP 1 Score: 188.734 bits (478), Expect = 3.635e-55
Identity = 100/296 (33.78%), Postives = 170/296 (57.43%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+G+GK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + ++  +  I +YI+  F + F+ E  L+R +I+D ++HCCLYFI P+GH L+ +D+EFMK    K+NIIP+IAKAD     E++  K  I  + +K  I ++  +  CDS  D +E+ + +  ELKE  P +VI SN  +V  + Q  + R Y WG+V+ ++  +  F+ L N+L++SH+   K +T  VHYENYR Q I +  ++ + D
Sbjct:   19 QVHRKSVKKGFDFTLMVAGESGMGKSTLVNSLFLTDLYKDRKLLNAEERINQTVE--IIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIDKFGIKVY-QFPECDS--DEDEEFKQLDKELKECTPFAVIGSN-TVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAQCIQEMTSKLAQD 308          
BLAST of Septin-5 vs. Ensembl Medaka
Match: sept5a (septin 5 [Source:NCBI gene;Acc:101158828])

HSP 1 Score: 189.119 bits (479), Expect = 4.133e-55
Identity = 100/296 (33.78%), Postives = 170/296 (57.43%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+G+GK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + ++  +  I +YI+  F + F+ E  L+R +I+D ++HCCLYFI P+GH L+ +D+EFMK    K+NIIP+IAKAD     E++  K  I  + +K  I ++  +  CDS  D +E+ + +  ELKE  P +VI SN  +V  + Q  + R Y WG+V+ ++  +  F+ L N+L++SH+   K +T  VHYENYR Q I +  ++ + D
Sbjct:   33 QVHRKSVKKGFDFTLMVAGESGMGKSTLVNSLFLTDLYKDRKLLNAEERINQTVE--IIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIDKFGIKVY-QFPECDS--DEDEEFKQLDKELKECTPFAVIGSN-TVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAQCIQEMTSKLAQD 322          
BLAST of Septin-5 vs. Ensembl Medaka
Match: sept5a (septin 5 [Source:NCBI gene;Acc:101158828])

HSP 1 Score: 189.504 bits (480), Expect = 2.177e-54
Identity = 100/296 (33.78%), Postives = 170/296 (57.43%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            ++ RK  +K   F L+V GE+G+GK T + S+   +  K   +    E + + +   ++  +  I ++  K+ L I+    +G  + ++  +  I +YI+  F + F+ E  L+R +I+D ++HCCLYFI P+GH L+ +D+EFMK    K+NIIP+IAKAD     E++  K  I  + +K  I ++  +  CDS  D +E+ + +  ELKE  P +VI SN  +V  + Q  + R Y WG+V+ ++  +  F+ L N+L++SH+   K +T  VHYENYR Q I +  ++ + D
Sbjct:  124 QVHRKSVKKGFDFTLMVAGESGMGKSTLVNSLFLTDLYKDRKLLNAEERINQTVE--IIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIDKFGIKVY-QFPECDS--DEDEEFKQLDKELKECTPFAVIGSN-TVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAQCIQEMTSKLAQD 413          
BLAST of Septin-5 vs. Ensembl Medaka
Match: ENSORLT00000009841.2 (septin-4 [Source:NCBI gene;Acc:101169222])

HSP 1 Score: 183.726 bits (465), Expect = 1.731e-53
Identity = 93/271 (34.32%), Postives = 159/271 (58.67%), Query Frame = 3
Query:  513 LVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFI 1325
            +V GE+GLGK T + S+   +  K   +    E + + +   +   +  I ++  K+ L I+    +G  + +   + ++ +YI+  F + F+ E  L+R +I+D ++HCCLYFI+P+GH L+ LD+EFMK    K+NI+P++AKAD     E+Q  K  I  + E++ I ++  + +CDS  D     QD+  ELKE++P +VI SN  +V  K +  + R Y WG+V+ ++  +  F+ L N+L+++H+   K +T+  HYENYR Q I
Sbjct:    1 MVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERITQTVE--ITKHTVDIEEKGVKLKLTIVDTPGFGDAIDNTECWKSVADYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHEKVNIVPVLAKADTLTPTEVQKKKIKIREEIEQYGIKIY-QFPDCDSDEDEEFKQQDL--ELKESIPFAVIGSN-TVVEAKGKRVRGRLYPWGIVEVENSAHCDFVKLRNMLVRTHMQDLKDVTRETHYENYRAQCI 265          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000046276.1 (SMESG000046276.1)

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 377/381 (98.95%), Postives = 378/381 (99.21%), Query Frame = 3
Query:  237 MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSNLI 1379
            MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGK TFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFI+PYGHSLK LDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTD CENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSNLI
Sbjct:    1 MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKGTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFISPYGHSLKPLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDYCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNEYSNLI 381          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000046276.1 (SMESG000046276.1)

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 372/376 (98.94%), Postives = 373/376 (99.20%), Query Frame = 3
Query:  237 MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE 1364
            MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGK TFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFI+PYGHSLK LDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTD CENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE
Sbjct:    1 MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKGTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFISPYGHSLKPLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDYCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE 376          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000046276.1 (SMESG000046276.1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 372/376 (98.94%), Postives = 373/376 (99.20%), Query Frame = 3
Query:  237 MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE 1364
            MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGK TFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFI+PYGHSLK LDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTD CENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE
Sbjct:    1 MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNKRESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGLGKGTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFISPYGHSLKPLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDYCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDDPNE 376          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000076922.1 (SMESG000076922.1)

HSP 1 Score: 192.586 bits (488), Expect = 1.055e-55
Identity = 100/297 (33.67%), Postives = 179/297 (60.27%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYL-IAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVNENSDD 1355
            +++RK  +K  +F L+++GE+GLGK TF+ S++++ SI  E      E++        + K ++ + ++  K+ L I+    +G GL     +  I+EYI+ TF + FK EC+++R +I+D ++HCCLYFI+P GH +K +D+E MK    K+NI+PIIAKAD   + EL+ FK+ +++D EK+ IN +     C S  D  ++ +    E++  +P SV+ SN  + ++  ++ + RQY WG+ + ++ ++  F +L   +L++H+   K +T  + YENYR Q I   +   ++D
Sbjct:   56 QMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQ-SIYTEPRDSSSEDMINSTTK--IEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFY-QPPICGS--DEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNND 346          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000048968.1 (SMESG000048968.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.164e-52
Identity = 100/291 (34.36%), Postives = 167/291 (57.39%), Query Frame = 3
Query:  468 KLRRKLSRKSLHFNLLVIGEAGLGKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKICLNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKIHCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFKQNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSNEKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTITKSVHYENYRVQFILQHVN 1340
            ++ RK  +K  +F+++V+GE+GLGK TF+ S++  +  K  + ++ P      +   +V +   + ++  K+ L II    +   +     +  I +YIN TF + FK EC L+R +I+D +IHCCLYF+ P+G  LK LD+E +K  Q K+NIIP+I KAD     EL+  KQ ILND E++ ++++     C+S  D    ++ +  E+K  +P S+I S + I N +  + + RQY WG  + ++ ++  F  L   LLK+H+   K +T  V YENYR   I + ++
Sbjct:   49 QMHRKAVKKGFNFSIMVVGESGLGKSTFVNSLLMTDLYK--DREILPAFESIAVTTKIVKRFIELDEKGVKLRLTIIDTPGFNDAVNCYNCWKPIEDYINDTFDQYFKEECGLNRKNIQDNRIHCCLYFVNPFGRGLKPLDVEVIKRLQCKINIIPVIGKADSLTADELKKLKQKILNDIERYQLDVY-RLPECES--DEEASIRTLDSEIKACLPFSIIGSPDIIDNTRGPKIRGRQYIWGTSEVENNKHCDFSRLRLFLLKTHMQDLKDMTSDVLYENYRANCITERIH 334          
The following BLAST results are available for this feature:
BLAST of Septin-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC000093.11.791e-5532.54novel transcript[more]
SEPTIN51.791e-5532.54septin 5 [Source:HGNC Symbol;Acc:HGNC:9164][more]
SEPTIN56.068e-5533.45septin 5 [Source:HGNC Symbol;Acc:HGNC:9164][more]
SEPTIN21.190e-5432.06septin 2 [Source:HGNC Symbol;Acc:HGNC:7729][more]
SEPTIN27.117e-5433.99septin 2 [Source:HGNC Symbol;Acc:HGNC:7729][more]
back to top
BLAST of Septin-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-598.069e-4030.43pep chromosome:WBcel235:I:13629227:13633494:1 gene... [more]
unc-612.171e-3529.02pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-612.414e-3529.02pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-613.950e-3529.02pep chromosome:WBcel235:V:14731136:14734237:-1 gen... [more]
back to top
BLAST of Septin-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sep42.530e-5634.38gene:FBgn0259923 transcript:FBtr0074371[more]
Sep46.878e-5634.38gene:FBgn0259923 transcript:FBtr0074368[more]
Sep46.878e-5634.38gene:FBgn0259923 transcript:FBtr0074366[more]
Sep46.878e-5634.38gene:FBgn0259923 transcript:FBtr0074365[more]
Sep46.878e-5634.38gene:FBgn0259923 transcript:FBtr0074369[more]
back to top
BLAST of Septin-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept5b3.248e-5835.14septin 5b [Source:ZFIN;Acc:ZDB-GENE-040808-43][more]
sept4a7.942e-5633.92septin 4a [Source:ZFIN;Acc:ZDB-GENE-051120-87][more]
sept5a1.236e-5333.45septin 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7868][more]
sept152.957e-5235.59septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
sept153.426e-5235.59septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
back to top
BLAST of Septin-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
metap1d1.869e-5634.27methionyl aminopeptidase type 1D (mitochondrial) [... [more]
metap1d4.530e-5634.27methionyl aminopeptidase type 1D (mitochondrial) [... [more]
metap1d5.861e-5634.15methionyl aminopeptidase type 1D (mitochondrial) [... [more]
metap1d1.409e-5534.15methionyl aminopeptidase type 1D (mitochondrial) [... [more]
metap1d3.582e-5534.15methionyl aminopeptidase type 1D (mitochondrial) [... [more]
back to top
BLAST of Septin-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm496011.523e-5532.63predicted gene, 49601 [Source:MGI Symbol;Acc:MGI:6... [more]
Sept51.951e-5532.54septin 5 [Source:MGI Symbol;Acc:MGI:1195461][more]
Sept58.507e-5533.45septin 5 [Source:MGI Symbol;Acc:MGI:1195461][more]
Sept22.056e-5333.66septin 2 [Source:MGI Symbol;Acc:MGI:97298][more]
Sept22.056e-5333.66septin 2 [Source:MGI Symbol;Acc:MGI:97298][more]
back to top
BLAST of Septin-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BGQ3|SEPT5_MACFA8.160e-5532.54Septin-5 OS=Macaca fascicularis OX=9541 GN=SEPTIN5... [more]
sp|Q0VC68|SEPT5_BOVIN1.442e-5433.45Septin-5 OS=Bos taurus OX=9913 GN=SEPTIN5 PE=2 SV=... [more]
sp|Q99719|SEPT5_HUMAN2.914e-5433.45Septin-5 OS=Homo sapiens OX=9606 GN=SEPTIN5 PE=1 S... [more]
sp|Q9Z2Q6|SEPT5_MOUSE5.951e-5433.45Septin-5 OS=Mus musculus OX=10090 GN=Septin5 PE=1 ... [more]
sp|Q91Y81|SEPT2_RAT1.821e-5333.99Septin-2 OS=Rattus norvegicus OX=10116 GN=Septin2 ... [more]
back to top
BLAST of Septin-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EVC63.579e-5834.77Uncharacterized protein OS=Mesocestoides corti OX=... [more]
S5XLH61.668e-5734.42Putative septin; Septin-5 OS=Schistosoma mansoni O... [more]
A0A4E0RTG53.694e-5735.20Septin-5 OS=Fasciola hepatica OX=6192 GN=D915_0090... [more]
A0A504Y6C74.137e-5735.20Septin-5 OS=Fasciola gigantica OX=46835 GN=FGIG_05... [more]
A0A0A9Y2S34.295e-5735.76Septin-4 OS=Lygus hesperus OX=30085 GN=SEPT4 PE=3 ... [more]
back to top
BLAST of Septin-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept4a1.018e-5635.31septin-5-like [Source:NCBI gene;Acc:103047659][more]
sept4a1.540e-5635.31septin-5-like [Source:NCBI gene;Acc:103047659][more]
sept5a3.412e-5433.45septin 5 [Source:NCBI gene;Acc:103046048][more]
sept5a4.660e-5433.45septin 5 [Source:NCBI gene;Acc:103046048][more]
sept25.381e-5432.50septin 2 [Source:NCBI gene;Acc:103037588][more]
back to top
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1622393.153e-5029.72zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28][more]
SEPTIN71.153e-4832.31septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN92.188e-4530.31septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN91.535e-3728.62septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN73.992e-3334.38septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
back to top
BLAST of Septin-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC31.001e-4231.27Component of the septin ring that is required for ... [more]
CDC113.690e-3929.62Component of the septin ring that is required for ... [more]
SHS11.530e-3625.70Component of the septin ring that is required for ... [more]
CDC121.085e-3328.67Component of the septin ring that is required for ... [more]
SPR35.614e-3326.79Sporulation-specific homolog of the CDC3/10/11/12 ... [more]
back to top
BLAST of Septin-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474091.876e-5331.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345228.176e-4933.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331062.634e-4532.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379504.500e-4030.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479759.209e-3534.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Septin-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001335.21.567e-5633.57septin-5 [Source:NCBI gene;Acc:101166318][more]
sept5a3.635e-5533.78septin 5 [Source:NCBI gene;Acc:101158828][more]
sept5a4.133e-5533.78septin 5 [Source:NCBI gene;Acc:101158828][more]
sept5a2.177e-5433.78septin 5 [Source:NCBI gene;Acc:101158828][more]
ENSORLT00000009841.21.731e-5334.32septin-4 [Source:NCBI gene;Acc:101169222][more]
back to top
BLAST of Septin-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046276.10.000e+098.95SMESG000046276.1[more]
SMESG000046276.10.000e+098.94SMESG000046276.1[more]
SMESG000046276.10.000e+098.94SMESG000046276.1[more]
SMESG000076922.11.055e-5533.67SMESG000076922.1[more]
SMESG000048968.11.164e-5234.36SMESG000048968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000577 ID=SMED30000577|Name=Septin-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1441bp
AATAGATCCAATTAAAGGAAGATGTGTGATTATTTAAATTAAGATGCTTA
GTACAGTGCCGGTCGGTAATGTGAAAATTGTGCGTGCAATGATAATATTG
TGCATGCGTGTATAATTATGAATATATAACTATCATTTCGGTGTAAACGA
ACAAAAACGGATATCATTTTTAAAATAATTTTTCAGTTTTATCGATTTTT
TGTTAGATAAATTTTTCACAATTTATTAATTTTGCTATGAATTCGGATGC
TAATAGTCAAAAAAGTGAAAATGAAGATAAAACGGACTCAACTGCGTCCT
TCCAAAGTGACAATAGATCAATTTATTGCAGCATGAGAATTCGGAAAGAA
AACGATTTACTAAATGAAGACTTTCTATCAAATAAAAGAGAATCGTCACA
AATGCAAATATTTGTTAATCAGTTTATTAAACCAGAAATCAAGAGTGCTG
AAACTCCGCCACTGCATAAGTTGAGACGAAAATTGTCAAGGAAAAGTCTA
CATTTTAATTTATTGGTAATCGGTGAAGCAGGTCTTGGAAAACGTACATT
TATTCAGTCAATCATTTCTGAGAATTCAATCAAAAAAGAAAATATGAAAG
TACAGCCAGAGGAATTAGAAAAAGATTTAGGATATGGTTTAGTTTCCAAG
TCATATTTAATTGCAAAAGAAAATCAAAAAATATGTCTTAATATTATTCA
TAATCATGATTATGGTACAGGATTAAAAAGTGATACGACGTTTTCGAATA
TTATGGAGTATATAAATGGAACATTTAGAGAGTGCTTCAAATTTGAATGT
TCGCTGGATAGGTCATCAATTGAAGATAGAAAGATTCATTGTTGCCTGTA
CTTTATTGCGCCATACGGACACAGTTTGAAGTCATTAGACATAGAATTTA
TGAAAATGTTTCAAACAAAACTCAACATAATTCCAATTATTGCAAAAGCG
GACATTTTCAATCAAGTTGAATTGCAAAATTTTAAACAAAATATTTTAAA
TGATTTTGAAAAGCATAATATTAATTTATTTGGTTATTATGCAAATTGTG
ATTCTTGTGTAGATTACAACGAAGACGTTCAAGATATGTGTGATGAATTA
AAAGAAAACGTTCCACTTTCAGTAATTTTGTCGAATGAAAAAATCGTAAA
TAACAAGAAACAAGAAGAGAAAGTCCGACAATATTCTTGGGGAGTTGTAA
AAACTGATGATTGTGAAAATAGTCAATTTTTGTTGTTGGAAAATATTTTA
CTAAAATCTCATATCATCTACTTCAAAACAATAACAAAATCAGTTCATTA
TGAAAATTATCGCGTTCAATTTATTTTACAACATGTCAATGAAAATTCGG
ATGATCCAAATGAGTATTCAAATTTAATTTAGTGTCAATGATAAAATCTA
GAATTTTATTGAAAATTATAGATTGTTTTCCGTTAAAAAAA
back to top

protein sequence of SMED30000577-orf-1

>SMED30000577-orf-1 ID=SMED30000577-orf-1|Name=SMED30000577-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=382bp
MNSDANSQKSENEDKTDSTASFQSDNRSIYCSMRIRKENDLLNEDFLSNK
RESSQMQIFVNQFIKPEIKSAETPPLHKLRRKLSRKSLHFNLLVIGEAGL
GKRTFIQSIISENSIKKENMKVQPEELEKDLGYGLVSKSYLIAKENQKIC
LNIIHNHDYGTGLKSDTTFSNIMEYINGTFRECFKFECSLDRSSIEDRKI
HCCLYFIAPYGHSLKSLDIEFMKMFQTKLNIIPIIAKADIFNQVELQNFK
QNILNDFEKHNINLFGYYANCDSCVDYNEDVQDMCDELKENVPLSVILSN
EKIVNNKKQEEKVRQYSWGVVKTDDCENSQFLLLENILLKSHIIYFKTIT
KSVHYENYRVQFILQHVNENSDDPNEYSNLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016491Septin
IPR027417P-loop_NTPase
IPR030379G_SEPTIN_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016491SeptinPIRSFPIRSF006698Septincoord: 2..379
e-value: 2.0E-78
score: 261.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 72..366
e-value: 9.1E-72
score: 243.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR18884SEPTINcoord: 79..369
NoneNo IPR availablePANTHERPTHR18884:SF120SEPTIN-7coord: 79..369
IPR030379Septin-type guanine nucleotide-binding (G) domainPFAMPF00735Septincoord: 87..367
e-value: 3.4E-72
score: 243.1
IPR030379Septin-type guanine nucleotide-binding (G) domainPROSITEPS51719G_SEPTINcoord: 86..365
score: 59.424
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 86..322