SMED30000573

Overview
NameSMED30000573
Smed IDSMED30000573
Length (bp)2191
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000573 (SMED30000573) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000573 (SMED30000573) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000573 (SMED30000573) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000573 (SMED30000573) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000573

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000573h1SMcG0005214 SmedASXL_011707SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30000573h1SMcG0005214 dd_Smed_v4_1722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000573 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017879:2044..4232 +10846
Homology
BLAST of SMED30000573 vs. Ensembl Human
Match: PTCD3 (pentatricopeptide repeat domain 3 [Source:HGNC Symbol;Acc:HGNC:24717])

HSP 1 Score: 83.1889 bits (204), Expect = 8.448e-16
Identity = 125/505 (24.75%), Postives = 221/505 (43.76%), Query Frame = -1
Query:  716 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFED-KKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQE--YESSKFSPEITQELLDLLCFGIRLNNNYLETQPE-EFYFSNDVYSE---------------------WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEM--RSIYPDSFPNTKTCNLLLRSLESFSCN-DDSFLIKI--LMKILTGMSFYQVAPDVFTFNNAIYAI---NTRSRTAGLIENLYTEMRYLNIEPTLGTFCLIF----QCRNFRKNHAAMVIDLITILSQRR---KDNIFEEVHTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFK 2110
            +E+ IP K   D +++L+ L++ V  ++++  Y   DDP L    S+  SR +LL+K SG   A+       KY    IA  EP I  LMP    E    ++K  +   E AL+  I L K   +   + +     +  S E T  LLDLLC+       Y + +P  +++F     SE                     W   N AE +F  +  K++ +Y +MI G  K R   +A+ L+ E+    ++ D +    T N L   +E+  C  ++ F  K   ++++L  M   +V P++ TFN  +  +   +  +R+  L   +  EM+ + IEP+L T+  I     Q  +  K  + ++ D++  L  +R   KD         DD   F+ AM   +  R  ELA +++ +   G     IG +     Y+   F++ I   + +D  +K  + ++P+ +         LL  + +     ++P+I    +  G  F+
Sbjct:   55 EEVVIPKKKTWDKVAVLQALASTVNRDTTAVPYVFQDDPYL-MPASSLESRSFLLAKKSGENVAKFIINSYPKYFQKDIA--EPHIPCLMP----EYFEPQIKDIS---EAALKERIELRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCY-------YGDQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHADVY----TFNAL---IEATVCAINEKFEEKWSKILELLRHMVAQKVKPNLQTFNTILKCLRRFHVFARSPAL--QVLREMKAIGIEPSLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKD--------PDDDKFFQSAMSICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDL-ICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFR 524          
BLAST of SMED30000573 vs. Ensembl Celegans
Match: let-630 (pep chromosome:WBcel235:I:5162599:5164884:-1 gene:WBGene00002804.1 transcript:Y110A7A.19.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-630)

HSP 1 Score: 59.3066 bits (142), Expect = 7.981e-9
Identity = 88/361 (24.38%), Postives = 159/361 (44.04%), Query Frame = -1
Query: 1163 RKHLGKFLSTCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSA-QLAFEDKKYDFLKIAKEEPKIKILMPM-ISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKF--SPEITQELLDLLCFGIRLNNNYLETQPEEFY----FSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPT---RAIELFNEMRS----IYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIEN-------LYTEMRYLNIEPTLGTFCLIFQ 2179
            R  LG+ ++    SLS     + +++ I   I R    +L  LS  V  ++++P +  IDDP ++   + S+ + Y ++K  G+ +A +LA E          +++P++ +  P  ++    VE         E  L  +I+  +  ++ + Y+   S     S ++  EL  L+ +    N  + E   EEF     F  D  S W     A++LF++L  K+      MI G  K  + +   RA EL+ E R+    +Y ++F         L    S+S            K++  M   ++ PD+FTFN    A+ + +  AG  E+       +  EM+ + +EP L +F LI +
Sbjct:    4 RMGLGRVITR---SLSSVEPALSQKLTIQPAIERSPTDLLNALSETVGPDTTAPHFAYIDDP-ITIPSTQSTKKTYFMAKEFGKRAARELATEWPT--LFAFDRDQPQLPVFRPRHLADPLQVEPT-------ENNLLKMISSREVKDSCILYERMRSENVDVSEKVQLELFRLVTYYNSSNVPFAEW--EEFVGMRNFGEDSTSSWKSGAVADLLFETL-PKTDETVSIMIAGLCKFSDHSSLERARELYKEHRAAKGKVYREAFNG-------LIGASSYSVGK---------KLVAEMISLRMTPDIFTFN----ALLSSAAKAGKFEDRVKAFTEIIGEMKEIGVEPALSSFHLIIK 328          
BLAST of SMED30000573 vs. Ensembl Fly
Match: CG4679 (gene:FBgn0033816 transcript:FBtr0087759)

HSP 1 Score: 110.153 bits (274), Expect = 1.035e-24
Identity = 125/501 (24.95%), Postives = 232/501 (46.31%), Query Frame = -1
Query:  710 STCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEE--IVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQ--EYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVYSE-----WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEM--RSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINT-----RSRTAGLIENLYTEMRYLNIEPTLGT--FCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDE-LALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKES 2155
            S  HY+ +      P  I+IPN+I R    +L+ L++ V  + ++P Y   DDP L   +SN++ R Y +SK SGR +A+   E+ +  F+   + +P I+   P + + E  +V+         E +L  +I+  +  +A L Y   E + +  SPE+ Q LL+L+CF         E   E ++  N+   E     W   + AE L+  ++ K+  +Y S+I G +K     RA  L  E   + +  D    T T N ++  + SF  +      ++   +L  MS  ++ P++ T N  +  I+T      +R A L      E + L + P+LG+  + LI  CR  R   + +++D++  +S +     F+  H K D   F  AM        D+ LA K++E+   G    ++G++F    Y+++   + + +T+  +  M +   +VPN++   P +   +L  + +      +P +   + +     +ES
Sbjct:   22 SGAHYTTAAPAEDAP--IEIPNRIERSPTDLLQALASTVARDYTAPHYKYHDDPFL-IPMSNAAKRTYAMSKESGRKAAKWIKEEHRELFMH-QEAQPAIEKFAPSMVYTEDSVVD---------ETSLAQLISQGELKDAVLVYNLLEQKGNPISPELKQSLLELVCFHNNQEPIPEEYIEERWFLQNNKRRERSGKTWKDGDLAEKLYSEIEPKTPQSYASLIRGMAKYLQCERAYALLQEAGEKQVQLD----TNTFNSVIE-IVSFLKDTAEQRWQLCKDLLNEMSQQKLRPNLGTLNAVLQCISTFGNFKVARAAAL--QALPEFKQLGVNPSLGSYYYLLIIFCRE-RGPVSHVIVDILNDISGKE----FQIQHPK-DTYFFATAMDVCRNHLHDKSLAKKVDELLHTGKNYDLVGDSFKESIYYRNYLAL-LCQTESTEDFMLSYDLLVPNIYIPEPGIMEEILRAIEINGAVEYVPRLWSDMVVFDHTHRES 495          
BLAST of SMED30000573 vs. Ensembl Zebrafish
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:NCBI gene;Acc:553325])

HSP 1 Score: 57.7658 bits (138), Expect = 3.912e-8
Identity = 117/501 (23.35%), Postives = 207/501 (41.32%), Query Frame = -1
Query:  752 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQE--YESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVYSE--------------------------WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTC-----NLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIEN-----LYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFE---EVHTK-------DDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEI 2110
            +EI IP K      ++L+ L++ VK + ++  Y L DD +     + S  + +  S+ SGR +A+  F +K   + +    +P I  LMP  + E  +E V       E AL+  I L K   A   Y +     +  S ++T +LLDL+C        Y E  P +  F  +  SE                          W  +N AE +F  L   +  +Y ++I G  K    T+A        S Y D   N         N LL ++ +     +    ++++ +L  M+  +V P++ T N    AI    R  G +       + +EM+ L+IEP+L ++           NH   +        Q   D + E   EV  K       DD   F  AM+   +++  E A +++E+   G     +G++F    Y+   F++ +   +++D +MK  + +VP+++  +    + LL  +       L+P+I
Sbjct:   45 EEIVIPKKKTWSKEAVLQALASTVKRDPTASDYRLQDD-SFLTPKTASDFKLFCRSQESGRNAAKY-FINKYPKYFEKDYAQPHIPCLMPE-TLEAQLEDVS------EAALKERIQLRKVKAAVDLYDQLLQAGTSVSLDLTNDLLDLICL-------YGEADPVQETFEAEQRSEEMEDIQDETQTKKGRSPKASDLLKTSWKENNNAERIFGLLSEPNTRSYSALIRGMVKHAAYTQAF-------STYTDLLNNRLKADVHIFNALLAAVPAVRPKYNEKW-ELILDLLKQMAEQKVKPNLLTLN----AILKSLRRCGALGRSQAFPVISEMKVLSIEPSLASY-----------NHLLAIFYRSGAQVQTPTDVLVEVMNEVSGKSFTPQDPDDAQFFTTAMRVCLDTKDMEQAYRVHELLGVGDNWRFMGSDFQQSIYYAWFFSL-LCMMENIDVVMKWYRDLVPSVYYPSSNAMSDLLRALDTDSRLDLIPKI 505          
BLAST of SMED30000573 vs. Ensembl Xenopus
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:NCBI gene;Acc:548397])

HSP 1 Score: 84.7297 bits (208), Expect = 2.101e-16
Identity = 118/505 (23.37%), Postives = 219/505 (43.37%), Query Frame = -1
Query:  716 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSP--EITQELLDLLCF-GIR-------------------LNNNYLETQPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTA-GLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEV-----------HTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFK 2110
            +EI IP +   D  ++L+ L+  V  + ++  Y   D+P L+   S+   R Y LSK SGR +A+        +  +    EP I  LMP    E +  +V+  +   E+AL+  I L +  E+   + +      +P  E T +LLDL+ F G R                         + +P ++  ++++   W  +N AE +F  +  ++  ++ ++I G +K  + ++A   FN    IY D   N  T +      L+L + +     ++ +   +++++L  M    V P++ TFN+ + ++      A GL      EM+ LNIEP+L T+           NH   V      LS R +  I  EV              DD+  F  AM+   + +  ELA +L+ +        ++G+ +    Y+   FN+ +   + +D ++K  + ++P+L+         LL  + +     L+P+I   I+  G + K
Sbjct:   58 EEIDIPRRKSWDKTAVLQALAYTVSHDPTAAHYMFQDEPFLAPKTSSEF-RLYSLSKESGRNAAKYIIGTYP-NLFQNDVAEPHIPCLMP----ENLQPQVEGVS---EEALKERIQLRRVKESVDLFDQLLQGGTAPSLETTNKLLDLISFYGDREPVRDIQTSEQEQQEVQDQQETEDPKKRPRQYRKASEILGSWRENNNAERIFNLMPERNAHSFCTLIQGMAKYGSSSKA---FN----IYTDLMNNRLTADVQTFNALILAAPDIKEKYNEKW--DLIVELLKHMVQQNVRPNLLTFNSVLKSLRKCGPMAKGLALQTINEMKALNIEPSLATY-----------NHLLGVF-YKGALSPRGQTEILSEVLDEIEGRSFTLRDPDDVYFFTNAMRVCLDLKDIELAYRLHTLQQTADNRGLMGDFYLQSTYYGRFFNL-LCMMESIDIILKWYRELIPSLYYPNSRGMLDLLQALDMDNRLDLIPQIWKDIKQIGHSNK 531          
BLAST of SMED30000573 vs. Ensembl Xenopus
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:NCBI gene;Acc:548397])

HSP 1 Score: 84.7297 bits (208), Expect = 2.401e-16
Identity = 118/505 (23.37%), Postives = 219/505 (43.37%), Query Frame = -1
Query:  716 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSP--EITQELLDLLCF-GIR-------------------LNNNYLETQPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTA-GLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEV-----------HTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFK 2110
            +EI IP +   D  ++L+ L+  V  + ++  Y   D+P L+   S+   R Y LSK SGR +A+        +  +    EP I  LMP    E +  +V+  +   E+AL+  I L +  E+   + +      +P  E T +LLDL+ F G R                         + +P ++  ++++   W  +N AE +F  +  ++  ++ ++I G +K  + ++A   FN    IY D   N  T +      L+L + +     ++ +   +++++L  M    V P++ TFN+ + ++      A GL      EM+ LNIEP+L T+           NH   V      LS R +  I  EV              DD+  F  AM+   + +  ELA +L+ +        ++G+ +    Y+   FN+ +   + +D ++K  + ++P+L+         LL  + +     L+P+I   I+  G + K
Sbjct:   58 EEIDIPRRKSWDKTAVLQALAYTVSHDPTAAHYMFQDEPFLAPKTSSEF-RLYSLSKESGRNAAKYIIGTYP-NLFQNDVAEPHIPCLMP----ENLQPQVEGVS---EEALKERIQLRRVKESVDLFDQLLQGGTAPSLETTNKLLDLISFYGDREPVRDIQTSEQEQQEVQDQQETEDPKKRPRQYRKASEILGSWRENNNAERIFNLMPERNAHSFCTLIQGMAKYGSSSKA---FN----IYTDLMNNRLTADVQTFNALILAAPDIKEKYNEKW--DLIVELLKHMVQQNVRPNLLTFNSVLKSLRKCGPMAKGLALQTINEMKALNIEPSLATY-----------NHLLGVF-YKGALSPRGQTEILSEVLDEIEGRSFTLRDPDDVYFFTNAMRVCLDLKDIELAYRLHTLQQTADNRGLMGDFYLQSTYYGRFFNL-LCMMESIDIILKWYRELIPSLYYPNSRGMLDLLQALDMDNRLDLIPQIWKDIKQIGHSNK 531          
BLAST of SMED30000573 vs. Ensembl Xenopus
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:NCBI gene;Acc:548397])

HSP 1 Score: 70.4774 bits (171), Expect = 5.707e-12
Identity = 109/484 (22.52%), Postives = 206/484 (42.56%), Query Frame = -1
Query:  716 RDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSP--EITQELLDLLCF-GIR-------------------LNNNYLETQPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTA-GLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFK 2080
            +D  ++L+ L+  V  + ++  Y   D+P L+   S+   R Y LSK SGR +A+        +  +    EP I  LMP    E +  +V+  +   E+AL+  I L +  E+   + +      +P  E T +LLDL+ F G R                         + +P ++  ++++   W  +N AE +F  +  ++  ++ ++I G +K  + ++A   FN    IY D   N  T +      L+L + +     ++ +   +++++L  M    V P++ TFN+ + ++      A GL      EM+ LNIEP+L T+           NH   V      LS R +  I  E     D+                ELA +L+ +        ++G+ +    Y+   FN+ +   + +D ++K  + ++P+L+         LL  + +     L+P+I   I+  G + K
Sbjct:   34 KDKTAVLQALAYTVSHDPTAAHYMFQDEPFLAPKTSSEF-RLYSLSKESGRNAAKYIIGTYP-NLFQNDVAEPHIPCLMP----ENLQPQVEGVS---EEALKERIQLRRVKESVDLFDQLLQGGTAPSLETTNKLLDLISFYGDREPVRDIQTSEQEQQEVQDQQETEDPKKRPRQYRKASEILGSWRENNNAERIFNLMPERNAHSFCTLIQGMAKYGSSSKA---FN----IYTDLMNNRLTADVQTFNALILAAPDIKEKYNEKW--DLIVELLKHMVQQNVRPNLLTFNSVLKSLRKCGPMAKGLALQTINEMKALNIEPSLATY-----------NHLLGVF-YKGALSPRGQTEILSECLDLKDI----------------ELAYRLHTLQQTADNRGLMGDFYLQSTYYGRFFNL-LCMMESIDIILKWYRELIPSLYYPNSRGMLDLLQALDMDNRLDLIPQIWKDIKQIGHSNK 470          
BLAST of SMED30000573 vs. Ensembl Mouse
Match: Ptcd3 (pentatricopeptide repeat domain 3 [Source:MGI Symbol;Acc:MGI:1917206])

HSP 1 Score: 87.8113 bits (216), Expect = 1.850e-17
Identity = 125/488 (25.61%), Postives = 211/488 (43.24%), Query Frame = -1
Query:  752 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLK-IAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYES-SKFSPEITQELLDLLCFGIRLNNNYLETQPEEFY-FSNDVY-------------------SEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEM--RSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKI--LMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIENLYT--EMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTK-------DDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEI 2110
            +EI IP K   D +++L+ L++ V  + ++  Y   DDP L    S   SR +LL+K SG T+A+         F K IA  EP I  LMP    E  +E V   A      LR +   +      +F Q  ++ +  S E T  LLDLLC+       Y + +P   Y F    +                     W   N AE +F  +  K+  +Y +MI G  K R   +A+ ++ E+    +  D +    T N L+ + ++F  N + F  K   ++ +L  M   +V P++ TFN  +  +  +  + G I  L    EM+++ IEP+L T+  I      R   A  +  LI         +I  E+  +       DD   F+ AM   +  R  ELA +++ +   G    ++G++     Y+   F++ I   + +D  +K  K ++P++F     +   LL  + +     L+P+I
Sbjct:   56 EEIVIPKKKTWDKVAVLQALASTVNRDPTAAPYVFHDDPYL-IPTSALESRSFLLAKKSGETAAKFIINSYPKYFQKDIA--EPHIPCLMPEY-FEPQIEDVSEAALEERIRLRKVRASVD-----MFDQLLQAGTTVSLETTNSLLDLLCY-------YGDQEPPADYPFQQTEHLENLEEAAEENNQTSKMESGPWKAQNNAERIFALMPEKNARSYCTMIRGMVKHRAYAQALNVYTELLNNRLSADVY----TFNALIEA-KTFILN-EKFEEKWNDILDLLKHMVAQKVKPNLQTFNTILKGLR-KCYSLGRIPALQILREMKHIGIEPSLATYHHIIHLFYPRDLSAIKMPSLIIY-------DIMNELEGRTFSPQDLDDGRFFQLAMSVCSSLRDLELAYQVHRLLNTGDNRKLVGHDPLRKVYYSKFFSL-ICSLEQIDVTLKWYKDLIPSVFLPHYQIFIGLLQALDVANRLELVPQI 512          
BLAST of SMED30000573 vs. Ensembl Mouse
Match: Ptcd3 (pentatricopeptide repeat domain 3 [Source:MGI Symbol;Acc:MGI:1917206])

HSP 1 Score: 55.0694 bits (131), Expect = 1.148e-7
Identity = 66/229 (28.82%), Postives = 95/229 (41.48%), Query Frame = -1
Query: 1490 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFED-KKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYES-SKFSPEITQELLDLLCFGIRLNNNYLETQPEEFY--------------------FSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKA 2110
            +EI IP K   D +++L+ L++ V  + ++  Y   DDP L    S   SR +LL+K SG T+A+       KY    IA  EP I  LMP    E  +E V   A      LR +   +      +F Q  ++ +  S E T  LLDLLC+       Y + +P   Y                     S      W   N AE +F  +  K+  +Y +MI G  K 
Sbjct:   56 EEIVIPKKKTWDKVAVLQALASTVNRDPTAAPYVFHDDPYL-IPTSALESRSFLLAKKSGETAAKFIINSYPKYFQKDIA--EPHIPCLMPEY-FEPQIEDVSEAALEERIRLRKVRASVD-----MFDQLLQAGTTVSLETTNSLLDLLCY-------YGDQEPPADYPFQQTEHLENLEEAAEENNQTSKMESGPWKAQNNAERIFALMPEKNARSYCTMIRGMVKG 268          
BLAST of SMED30000573 vs. UniProt/SwissProt
Match: sp|A1Z9A8|PTCD3_DROME (Protein PTCD3 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG4679 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.037e-23
Identity = 125/501 (24.95%), Postives = 232/501 (46.31%), Query Frame = -1
Query:  710 STCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEE--IVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQ--EYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVYSE-----WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEM--RSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINT-----RSRTAGLIENLYTEMRYLNIEPTLGT--FCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDE-LALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKES 2155
            S  HY+ +      P  I+IPN+I R    +L+ L++ V  + ++P Y   DDP L   +SN++ R Y +SK SGR +A+   E+ +  F+   + +P I+   P + + E  +V+         E +L  +I+  +  +A L Y   E + +  SPE+ Q LL+L+CF         E   E ++  N+   E     W   + AE L+  ++ K+  +Y S+I G +K     RA  L  E   + +  D    T T N ++  + SF  +      ++   +L  MS  ++ P++ T N  +  I+T      +R A L      E + L + P+LG+  + LI  CR  R   + +++D++  +S +     F+  H K D   F  AM        D+ LA K++E+   G    ++G++F    Y+++   + + +T+  +  M +   +VPN++   P +   +L  + +      +P +   + +     +ES
Sbjct:   22 SGAHYTTAAPAEDAP--IEIPNRIERSPTDLLQALASTVARDYTAPHYKYHDDPFL-IPMSNAAKRTYAMSKESGRKAAKWIKEEHRELFMH-QEAQPAIEKFAPSMVYTEDSVVD---------ETSLAQLISQGELKDAVLVYNLLEQKGNPISPELKQSLLELVCFHNNQEPIPEEYIEERWFLQNNKRRERSGKTWKDGDLAEKLYSEIEPKTPQSYASLIRGMAKYLQCERAYALLQEAGEKQVQLD----TNTFNSVIE-IVSFLKDTAEQRWQLCKDLLNEMSQQKLRPNLGTLNAVLQCISTFGNFKVARAAAL--QALPEFKQLGVNPSLGSYYYLLIIFCRE-RGPVSHVIVDILNDISGKE----FQIQHPK-DTYFFATAMDVCRNHLHDKSLAKKVDELLHTGKNYDLVGDSFKESIYYRNYLAL-LCQTESTEDFMLSYDLLVPNIYIPEPGIMEEILRAIEINGAVEYVPRLWSDMVVFDHTHRES 495          
BLAST of SMED30000573 vs. UniProt/SwissProt
Match: sp|Q32N55|PTCD3_XENLA (Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Xenopus laevis OX=8355 GN=ptcd3 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.369e-19
Identity = 130/532 (24.44%), Postives = 229/532 (43.05%), Query Frame = -1
Query:  716 TMFRKHLGKFLSTCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLK-IAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSP--EITQELLDLLCF-GIRLNNNYLET-------------------QPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTA-GLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEV-----------HTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFK 2188
            T+ R   G   S  H + + S+    +EI IP +   D  ++L+ L+  V  + ++  Y   DDP L    S+   R Y LSK SGR +A+         F   IA  EP I  LMP  + +  +E V       E+AL+  I L +  E+   + +      +P  E T  LLDL+CF G R     ++T                   +P ++  ++++   W  +N AE +F  +  ++  ++ ++I G  K  +  +A   FN     Y D   N  T +      L+L + +     ++ +   +++++L  M    V P++ TFN+ + ++      A GL      EM+ LNIEP+LGT+           NH   V      LS R +  I  EV              DD+  F  AM+   + +  ELA +L+ +        ++G+ +    Y+   FN+ +   +++D ++K  + ++P+L+         LL  + +     L+P+I   I+  G + K
Sbjct:   16 TLLRYFCG---SARHQAAAASH----EEIDIPRRKSWDKTAVLQALAYTVSHDPTAAHYMFQDDPFLVPKTSSEF-RLYSLSKESGRNAAKYIIGTHPKLFQNDIA--EPHIPCLMPE-NFQPQIEGVS------EEALKERIQLRRIKESIDLFDQLLQGGTAPSLETTNRLLDLICFYGDREPTRDIQTSEQNQQDDQDQQETEDSKKRPGQYRKASEILGSWRENNNAERIFNLMPERNAHSFCTLIQGMVKYGSSNKA---FN----TYTDLMNNRLTADVQTFNALILAAPDMKEKYNEKW--DLIVELLKHMVQQNVRPNLLTFNSVLKSLRKCGTMARGLALQTINEMKALNIEPSLGTY-----------NHLLGVF-YKGALSPRGQTEILSEVLDEIEGRSFTLRDPDDVYFFTNAMRVCLDLKDIELAYRLHALQQTADNRGLMGDFYLQSTYYGRFFNL-LCMMENIDVILKWYRELIPSLYYPNSRGMLDLLQALDMDNCLDLIPQIWKDIKQIGHSNK 508          
BLAST of SMED30000573 vs. UniProt/SwissProt
Match: sp|Q14C51|PTCD3_MOUSE (Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Ptcd3 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 1.294e-16
Identity = 125/488 (25.61%), Postives = 211/488 (43.24%), Query Frame = -1
Query:  752 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLK-IAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYES-SKFSPEITQELLDLLCFGIRLNNNYLETQPEEFY-FSNDVY-------------------SEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEM--RSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKI--LMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIENLYT--EMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTK-------DDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEI 2110
            +EI IP K   D +++L+ L++ V  + ++  Y   DDP L    S   SR +LL+K SG T+A+         F K IA  EP I  LMP    E  +E V   A      LR +   +      +F Q  ++ +  S E T  LLDLLC+       Y + +P   Y F    +                     W   N AE +F  +  K+  +Y +MI G  K R   +A+ ++ E+    +  D +    T N L+ + ++F  N + F  K   ++ +L  M   +V P++ TFN  +  +  +  + G I  L    EM+++ IEP+L T+  I      R   A  +  LI         +I  E+  +       DD   F+ AM   +  R  ELA +++ +   G    ++G++     Y+   F++ I   + +D  +K  K ++P++F     +   LL  + +     L+P+I
Sbjct:   56 EEIVIPKKKTWDKVAVLQALASTVNRDPTAAPYVFHDDPYL-IPTSALESRSFLLAKKSGETAAKFIINSYPKYFQKDIA--EPHIPCLMPEY-FEPQIEDVSEAALEERIRLRKVRASVD-----MFDQLLQAGTTVSLETTNSLLDLLCY-------YGDQEPPADYPFQQTEHLENLEEAAEENNQTSKMESGPWKAQNNAERIFALMPEKNARSYCTMIRGMVKHRAYAQALNVYTELLNNRLSADVY----TFNALIEA-KTFILN-EKFEEKWNDILDLLKHMVAQKVKPNLQTFNTILKGLR-KCYSLGRIPALQILREMKHIGIEPSLATYHHIIHLFYPRDLSAIKMPSLIIY-------DIMNELEGRTFSPQDLDDGRFFQLAMSVCSSLRDLELAYQVHRLLNTGDNRKLVGHDPLRKVYYSKFFSL-ICSLEQIDVTLKWYKDLIPSVFLPHYQIFIGLLQALDVANRLELVPQI 512          
BLAST of SMED30000573 vs. UniProt/SwissProt
Match: sp|Q0IHP3|PTCD3_XENTR (Pentatricopeptide repeat-containing protein 3, mitochondrial OS=Xenopus tropicalis OX=8364 GN=ptcd3 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.173e-15
Identity = 118/505 (23.37%), Postives = 219/505 (43.37%), Query Frame = -1
Query:  716 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSP--EITQELLDLLCF-GIR-------------------LNNNYLETQPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTA-GLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEV-----------HTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFK 2110
            +EI IP +   D  ++L+ L+  V  + ++  Y   D+P L+   S+   R Y LSK SGR +A+        +  +    EP I  LMP    E +  +V+  +   E+AL+  I L +  E+   + +      +P  E T +LLDL+ F G R                         + +P ++  ++++   W  +N AE +F  +  ++  ++ ++I G +K  + ++A   FN    IY D   N  T +      L+L + +     ++ +   +++++L  M    V P++ TFN+ + ++      A GL      EM+ LNIEP+L T+           NH   V      LS R +  I  EV              DD+  F  AM+   + +  ELA +L+ +        ++G+ +    Y+   FN+ +   + +D ++K  + ++P+L+         LL  + +     L+P+I   I+  G + K
Sbjct:   35 EEIDIPRRKSWDKTAVLQALAYTVSHDPTAAHYMFQDEPFLAPKTSSEF-RLYSLSKESGRNAAKYIIGTYP-NLFQNDVAEPHIPCLMP----ENLQPQVEGVS---EEALKERIQLRRVKESVDLFDQLLQGGTAPSLETTNKLLDLISFYGDREPVRDIQTSEQEQQEVQDQQETEDPKKRPRQYRKASEILGSWRENNNAERIFNLMPERNAHSFCTLIQGMAKFGSSSKA---FN----IYTDLMNNRLTADVQTFNALILAAPDIKEKYNEKW--DLIVELLKHMVQQNVRPNLLTFNSVLKSLRKCGPMAKGLALQTINEMKALNIEPSLATY-----------NHLLGVF-YKGALSPRGQTEILSEVLDEIEGRSFTLRDPDDVYFFTNAMRVCLDLKDIELAYRLHTLQQTADNRGLMGDFYLQSTYYGRFFNL-LCMMESIDIILKWYRELIPSLYYPNSRGMLDLLQALDMDNRLDLIPQIWKDIKQIGHSNK 508          
BLAST of SMED30000573 vs. UniProt/SwissProt
Match: sp|Q96EY7|PTCD3_HUMAN (Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3)

HSP 1 Score: 83.1889 bits (204), Expect = 4.057e-15
Identity = 125/505 (24.75%), Postives = 221/505 (43.76%), Query Frame = -1
Query:  716 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFED-KKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQE--YESSKFSPEITQELLDLLCFGIRLNNNYLETQPE-EFYFSNDVYSE---------------------WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEM--RSIYPDSFPNTKTCNLLLRSLESFSCN-DDSFLIKI--LMKILTGMSFYQVAPDVFTFNNAIYAI---NTRSRTAGLIENLYTEMRYLNIEPTLGTFCLIF----QCRNFRKNHAAMVIDLITILSQRR---KDNIFEEVHTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFK 2110
            +E+ IP K   D +++L+ L++ V  ++++  Y   DDP L    S+  SR +LL+K SG   A+       KY    IA  EP I  LMP    E    ++K  +   E AL+  I L K   +   + +     +  S E T  LLDLLC+       Y + +P  +++F     SE                     W   N AE +F  +  K++ +Y +MI G  K R   +A+ L+ E+    ++ D +    T N L   +E+  C  ++ F  K   ++++L  M   +V P++ TFN  +  +   +  +R+  L   +  EM+ + IEP+L T+  I     Q  +  K  + ++ D++  L  +R   KD         DD   F+ AM   +  R  ELA +++ +   G     IG +     Y+   F++ I   + +D  +K  + ++P+ +         LL  + +     ++P+I    +  G  F+
Sbjct:   55 EEVVIPKKKTWDKVAVLQALASTVNRDTTAVPYVFQDDPYL-MPASSLESRSFLLAKKSGENVAKFIINSYPKYFQKDIA--EPHIPCLMP----EYFEPQIKDIS---EAALKERIELRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCY-------YGDQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHADVY----TFNAL---IEATVCAINEKFEEKWSKILELLRHMVAQKVKPNLQTFNTILKCLRRFHVFARSPAL--QVLREMKAIGIEPSLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKD--------PDDDKFFQSAMSICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDL-ICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFR 524          
BLAST of SMED30000573 vs. TrEMBL
Match: A0A2L2YIN6 (PPR_long domain-containing protein (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 6.424e-32
Identity = 142/570 (24.91%), Postives = 261/570 (45.79%), Query Frame = -1
Query:  467 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEE---IVEKVKSGA---FHPEKALRLIINLLKPTEAWLFYQEYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFY-------FSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSR---TAGLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSD-ELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKESNIISNIIQATAMVFDQSLTTPVAKEESDHELRPKMIKSINRIFNTVFYEE-----PENLTNPKFISNLLNLIDKLRDLELKWKFIR 2110
            K+I +P KI R    ILK L++ +  + ++  Y   DDP    + + +  R + LSK SG+ +A+  F +K  +  K     P IK   P +++ E   + E +       F  + ++  I N+LK           +    S ++ Q+LLDLLCF      N +   P+++Y              +WN +  AE LF S++   K AY SMI G SK     RA+ L +EM+S        T+  N L+         D S   ++ M++L+ M+   V PD++T N  +  ++  SR   +  L  N+  EM+ L IEP+LGT+  +        +   +   +  I ++  K      +    D+L F  AM+   +S +D +LA +L+++        ++GN      YF+  F + ++ET+D+D  M+  ++ +PN +T  P +  S++  V     Y+ LP++   + +  +  + +NI+  +++A A              +++  ++  +I+ +  IF+ +         P   T P  +SN+L      +D+E  W  ++
Sbjct:    2 KDIVVPYKIERSPTDILKALNSTISKDHTAAHYKYEDDPYFIPASNVTK-RSFALSKESGKKAARY-FLEKYPELFKCNTSIPHIKAFDPPLTYTESDNVTETLLKDCILNFEVQNSID-IFNILKK----------KGIDVSKDVKQDLLDLLCF-----YNNIPPPPDDYYEERYFQRIDEATKQKWNANGMAEKLFDSMEKDGK-AYSSMIAGLSKYGEVERALFLHDEMKS--KGLIGTTQAYNSLISECHHLH-EDSSSCWEMAMRLLSQMNADGVNPDLYTMNGLLRILSKGSRWRKSRQLSLNVIGEMKRLKIEPSLGTYYYLLMVYGSDADAGVLYEIMGDIQNKEHK------IRHPSDVLFFATAMEVCWKSLADKDLAYRLHKLLEYKNNCKLLGNALAESHYFKCFFRL-LSETEDIDIFMELYEKFIPNSYTPEPIVTLSVIEAVHFVGAYKYLPKLCSDVLLFEQT-ERTNILEALLEAAACT------------KNEENIQKPLIEMVWNIFDNLITRSKGRRLPFEWTGP-MLSNILKTFMNGKDMEKSWPILQ 528          
BLAST of SMED30000573 vs. TrEMBL
Match: A0A4Y2BPM7 (Protein PTCD3, mitochondrial OS=Araneus ventricosus OX=182803 GN=CG4679_1 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.501e-29
Identity = 140/518 (27.03%), Postives = 242/518 (46.72%), Query Frame = -1
Query:  671 TMFRKHLGKFLSTCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQ--EYESSKFSPEITQELLDLLCF---GIRLNNNYLETQPEEFYFSNDVYSE--WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYA-INTRSRTAGLIE-NLYTEMRYLNIEPTLGTFCLIFQ--CRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQ-SLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKESNIISNIIQATAMV 2188
            T   KH   + +T   S+ V     P EI IP +I R    +LK L++ +  + ++P Y   DDP      SN + R + LSK SGR +A+   E+   +  K  K  P IK   P I + E  E V S      ++LR  I       + L Y   + +    S ++ Q+LL+LLCF      +++ Y E   E F+   D   E  W+    AE LF+ ++  S+ AY +MI G++K R+  RA+ LF EM+       P T      L S+ S            + ++L  M+   + P+++T N  + + +  R R +     ++  EMR L IEP++GT+ L+    C N   N A ++ D++  L  +       E+    D+  F  AM+  L   R  EL   ++ +        ++GN+F   +YF+  F + + +T+++D LM   ++ VPN +T  P +  +++  +     Y+ LP++   +    +  +E NI++ ++ A   +
Sbjct:   16 TFLFKHSVYYCTTT--SVQVKPETAPNEIVIPYRIERGPTDVLKALASTLSKDYTAPLYKYEDDPYF-IPSSNITKRSFALSKESGRKAARYFLENYP-ELFKCNKSVPHIKAFDPPIVYTE--ENVTSA-----ESLRDCIMDCHVDNSILVYNILKTKGIAVSEDLKQDLLELLCFYNCKQPVSDEYYE---ERFFARTDKGPEDKWDCKGMAEELFKEMEQGSQ-AYGAMISGAAKFRDADRALSLFAEMKD---KGLPGTVEVYNSLISISSLIQEAPQLRFDYVQQLLGNMTSDGLQPNLYTMNAILESFVQGRWRKSMPYSLSVLAEMRRLKIEPSVGTYYLLLMIFCSNDFSN-ATVLYDIMNQLGGKEL-----EIRHPTDVYFFNTAMEVCLKSLRDKELGYCIHNLLEFKNNCKLLGNSFSESQYFKFFFKL-LCQTEEMDKLMDIYEKYVPNSYTPEPSVTLAIIEAIHFSGNYKHLPKMCSDVLFFEQTERE-NILTALMDAAGCM 507          
BLAST of SMED30000573 vs. TrEMBL
Match: A0A3R7M0A7 (PTCD3-like protein, mitochondrial OS=Penaeus vannamei OX=6689 GN=C7M84_012327 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.213e-27
Identity = 135/500 (27.00%), Postives = 231/500 (46.20%), Query Frame = -1
Query:  740 KHLGKFLSTCHYSLSV-----SNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQ--EYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVYSE------WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFP-NTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYA---INTRSRTAGLIENLYTEMRYLNIEPTLGT--FCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSL-NESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEIL-DLI 2176
            +HL +   +C  S  V     S+ +  +EI IPN+I R +  IL+ L++ V  +SS P Y   DDP L    SN + R + LSK SGR +A+    DK  D      E+P I+   P IS  +  +         E  LR ++     ++A   YQ  + +  + S  + QELL+ L +     +   E   EE ++   + S       W     AE LF+SL  +   AY ++I G ++     RA +++ E         P +T+T N L+R + S          K++ +ILT MS   V P++ T N+ + +   I +  +T  L   +  E   L I+ +L +  F LI  CR  R   + ++ID++  ++    D  F  +    D   F  AM    N   S ELA +++++   G    +IG+++    Y++  F ++ + T  +D  M+    +VP+++T  P +   LL  + + +    LP++  D+I
Sbjct:   11 RHLQRLFGSCSISAPVRSVRTSSCNRAEEIVIPNRIPRSSTDILEALASTVGRDSSGPHYKYSDDPYL-TPASNVAKRSFSLSKESGRKAARW-IRDKHSDLFTHRPEDPFIEAFYPKISFTDESDV-------SEDTLRELMQKCMVSDAIQVYQICKTKGVELSDSVRQELLEFLGY-YNCEDALDEDWVEERWYRQGIMSRDRIRNTWKDHGLAEELFKSLSHQGSPAYCALIRGMTRYYQVDRAWQMYQE---TLEKGIPLDTETYNSLIR-VASLMREGSDLRWKLVKEILTAMSEAGVRPNLGTLNSTLESLSQIASWRQTKNLSLQVMAEFNRLGIQASLASYYFLLIIHCRE-RGPISHILIDIMNHIA----DKEF-SIQDPKDTFFFVTAMDVCRNHLHSKELAKRVDDLLHTGNNYMLIGDSYKESIYYRHYFALSCS-TDTVDQFMELYNELVPHIYTPEPGVMEELLKALKVHEALEYLPQLWSDMI 489          
BLAST of SMED30000573 vs. TrEMBL
Match: T1J0Z3 (AA_kinase domain-containing protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.692e-27
Identity = 126/485 (25.98%), Postives = 229/485 (47.22%), Query Frame = -1
Query:  752 YSLSVSNFHIPK--EIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXS-------RKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLII--NLLKPTEAWLFYQEYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEF--YFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSR---TAGLIENLYTEMRYLNIEPTLGTFCLIF--QCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKD--DLLLFRYAMQSLNESRSDE-LALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEI 2143
            YS +V ++ + K  +I+IP +I+R + +IL+ L+  V  + ++P Y  +DDP L  + +           R Y L+K SGR SA+  F ++     +I   +PKI+  +P  + +E     KS     E+ LR  +   L+K +       + +  + S E+ Q LL+L CF    +  + +   E +  Y   D    W     A+ LF S++ K+  AY +MI G +K  +  RA  L+ EMR      F +  T N L+ SL ++  +      ++  + LT M    V P++ TFN+A+  +    +   +  L   ++ EM+ L IEP+L ++  +    CR    ++  +   L  IL+Q       +E   +D  D+L F  AM   +    D+ +AL++N++   G    ++G +     Y+Q LF   +     L+   +  ++ VPN++T  P +   ++  + +   +  +PEI
Sbjct:   17 YSTNVKSYQVAKNGQIQIPKRIHRSSTAILEALAGTVSRDYTAPHYKYVDDPLLIPASNILKVPSYDRIKRSYALAKESGRKSARWIF-NQNPQLFEIVDGDPKIEAFLPQQTFDE-----KSDV--TEEILRTCVEKRLVKTSNTVYQLLQQKGLRVSAELKQSLLELFCFHNSQDPLHQDDTEERWFQYPQKDKRKTWEDGEMADQLFNSMEVKTPTAYCTMIRGLAKHLDVERAYALYQEMRE--KQMFIDVTTYNYLI-SLCNYLRDSHEMKWQLCEEFLTNMHQEGVKPNLQTFNSALEVLGRLPKWRNSKKLSLEIFGEMKQLGIEPSLASYNYLLNTHCR----DNGPISTILYDILNQIEG----KEFTIRDPRDVLFFLTAMVVCHNHLMDKNVALRINDLLNKGNNYSLLGTSIRESLYYQHLFK-CLCFADTLENFFEFYRKYVPNVYTPEPSVMLEIIQSIAVNSAWTFIPEI 481          
BLAST of SMED30000573 vs. TrEMBL
Match: B3NRN5 (Uncharacterized protein OS=Drosophila erecta OX=7220 GN=Dere\GG22508 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.747e-26
Identity = 135/517 (26.11%), Postives = 244/517 (47.20%), Query Frame = -1
Query:  710 RKHLGKFLST--CHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEE--IVEKVKSGAFHPEKALR---LIINLLKPTEAWLFYQEYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEF-----YFSNDVYSE-----WNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEM--RSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINT-----RSRTAGLIENLYTEMRYLNIEPTLGT--FCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDE-LALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKES 2179
            R ++ + LS+   HY+ +      P  I+IPN+I R    +L+ L+  V  + ++P Y   DDP L   +SN++ R Y +SK SGR +A+   E+ +  F+   + +P I+   P + + E  +V++   G    +  L+   L+ NLL          E + +  SP++ Q LL+L+CF     +N  E  PEE+     +  N+   E     W   + AE L+  ++ K+  +Y S+I G +K     RA  L  E   + +  D    T T N ++  + SF  +      ++  ++L  MS  ++ P++ T N  +  I+T      +RTA L      E + L + P+LGT  + LI  CR  R   + +++D++  +S +     F+  H K D   F  AM        D+ LA K++E+   G    +IG++F    Y+++   + + +T+ +D  M +  R+VPN++   P +   +L  + +      +P I   + +     +ES
Sbjct:   12 RANIARSLSSSGAHYTTAAPAEDAP--IEIPNRIERSPTDLLQALAGTVARDHTAPHYKYHDDPFL-IPMSNAAKRTYAMSKESGRKAAKWIKEEHRELFMH-QEAQPAIEKFAPSMVYTEDSVVDESSLGQLISQGELKDAVLVYNLL----------EQKGNPISPDLKQSLLELVCF-----HNNQEPLPEEYIEERWFLQNNRRRERSGKTWKDGDLAEKLYSEIEPKTPQSYASLIRGMAKYLQCERAYALLQEAGEKQVQLD----TNTFNSVI-EIVSFLKDTAEQRWQLCTELLNEMSQQKLRPNLGTLNAVLQCISTFGNLKLARTAAL--QALPEFKQLGVSPSLGTYYYLLIIFCRE-RGPVSHVIVDILNDISGKE----FQIQHPK-DTYFFATAMDVCRNHLHDKSLAKKVDELLHTGKNYDLIGDSFKESIYYRNYLAL-LCQTELIDDFMMSYDRLVPNIYIPEPGIMEEILRAIEINGGVEYVPRIWSDMVVFDHTHRES 495          
BLAST of SMED30000573 vs. Ensembl Cavefish
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:NCBI gene;Acc:107196966])

HSP 1 Score: 97.8265 bits (242), Expect = 1.077e-20
Identity = 123/512 (24.02%), Postives = 228/512 (44.53%), Query Frame = -1
Query:  728 RKHLGKFLSTCHYSLS-VSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSK--FSPEITQELLDLLCF------GIRLNNNYLETQPEEFYFSNDV------YSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIENLYTEMRYLNIEPTLGTFCLI----FQCRNFRKNHAAM---VIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRING 2179
            R+++G   + C  S + VS     +EI IP K   +  ++L+ L+  V  + ++  Y L DD  L  +      + + LSK SGR +A+  F +    + +    EP I  LMP     EI E         E AL   I L K   A   Y + + S    S ++T +LLDL+C            ++Y+    E+      +       S W  +N AE +F  +  +++ +Y ++I G  K    ++A +++ +M         N  T +      L+  + E      + +  ++++ +L  M+   V P++ TF+  +  +  RSR    + +++ EM+ L I P+L T+ LI    ++  +F K H  +   V+D I+  S   +D         DD+  F  AM+   E++  ELA KL+ +   G    ++G ++    Y+   F++ +   +++D ++K  K ++P+L+  T       L  +       L+P+I   I+  G
Sbjct:   29 RRYVGLGSAACQQSAAEVSGS--AEEIVIPRKKTWNKETVLQALAATVNRDPTASNYVLQDDSYLIPNSYAQF-KLFTLSKESGRNTAKY-FINTYPKYFQKDFAEPHIPCLMPETLELEIEEV-------SEAALIERIQLRKVKAAVDMYDQLQQSGTPLSVDLTNDLLDLICLYGDQDPAPEQGSDYMGEDQEDVKKKEGIPQRDSGISRWRENNNAERIFHIMPERTRRSYGALIRGMVKYGAYSKAFDMYTDM-------LNNRLTADVHIFNALITAAPEVREQIQEKW--ELVLNLLKQMAKQDVKPNLLTFHAVLRCLR-RSRHLAKVFSVFNEMKALGIAPSLATYNLILGIVYKQASFAKGHTEILEKVLDEISGKSFTPQD--------PDDVKFFINAMRICQEAKDIELAYKLHSVVGVGENWKLLGESYFQNIYYWRFFSL-LCMMENIDVVLKWYKELIPSLYYPTAQGMRDFLQALDTDNRLDLIPQIWKDIKQMG 510          
BLAST of SMED30000573 vs. Ensembl Medaka
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:NCBI gene;Acc:101157067])

HSP 1 Score: 88.1965 bits (217), Expect = 1.068e-17
Identity = 115/490 (23.47%), Postives = 214/490 (43.67%), Query Frame = -1
Query:  728 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQE--YESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVY---------------SEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIENLYT--EMRYLNIEPTLGTF----CLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRING 2110
            + I IP K   + +++L+ L++ V  + ++  Y   DDP LS   S+   + + LS+ SGR++A+  F D    F      EP I  LMP    E +  +++  +   E+ALR  I+L K T A   Y +     +  S E T +LLDL+C      N   E  P+                        + W  +N AE +F  L  +    Y ++I G  K     +A        S+Y D   +  T +      L+L + E     ++ +  +++ ++L  MS  +V PD+ TFN+ + A+  R       + L T  EM+ + I P+L T+       ++  +   ++  ++++++T L   R           DD+L F  AM+   + +  EL  K+  +   G    ++G+++    Y+   FN+ +   + +D +++  ++++P+ +   P     LL  +       +LP I   I+  G
Sbjct:   51 ESIVIPRKKTWNKIAVLEALASTVDRDPTAYPYQFQDDPYLSPRTSSEF-KLFSLSQESGRSAAKF-FVDSNPKFFTKDFAEPHIPCLMP----ESVSLRLEEVS---EEALRERISLRKVTAAVDMYDQLLQAGTAVSMETTHDLLDLICLYCD-RNPVQEGGPQAEEAEEAGEETKGRRGRTRRDIPKTPWKENNNAERIFNLLPERDSRCYSALIRGMVKHGAYAKAF-------SLYTDLLNDRLTGDVHLFNALILAAPELREKYNEKW--ELISELLNQMSQQKVHPDLLTFNSVLKALR-RCGYVAKTKALSTLNEMKAVGISPSLATYDHILAAFYKSASSGPSNTEILLEVLTELEGTRL-----TCQDPDDVLFFSSAMRICLDGKDLELGYKVQNLLEVGDNWRLLGDSYQQSIYYGRFFNL-LCMMEHIDVVLEWYRKIIPSRYYPNPQGMKDLLQALDTDSRLDMLPTIWKDIKSLG 514          
BLAST of SMED30000573 vs. Ensembl Medaka
Match: ptcd3 (pentatricopeptide repeat domain 3 [Source:NCBI gene;Acc:101157067])

HSP 1 Score: 88.1965 bits (217), Expect = 1.171e-17
Identity = 115/490 (23.47%), Postives = 214/490 (43.67%), Query Frame = -1
Query:  728 KEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQE--YESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVY---------------SEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCN------LLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIENLYT--EMRYLNIEPTLGTF----CLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRING 2110
            + I IP K   + +++L+ L++ V  + ++  Y   DDP LS   S+   + + LS+ SGR++A+  F D    F      EP I  LMP    E +  +++  +   E+ALR  I+L K T A   Y +     +  S E T +LLDL+C      N   E  P+                        + W  +N AE +F  L  +    Y ++I G  K     +A        S+Y D   +  T +      L+L + E     ++ +  +++ ++L  MS  +V PD+ TFN+ + A+  R       + L T  EM+ + I P+L T+       ++  +   ++  ++++++T L   R           DD+L F  AM+   + +  EL  K+  +   G    ++G+++    Y+   FN+ +   + +D +++  ++++P+ +   P     LL  +       +LP I   I+  G
Sbjct:   51 ESIVIPRKKTWNKIAVLEALASTVDRDPTAYPYQFQDDPYLSPRTSSEF-KLFSLSQESGRSAAKF-FVDSNPKFFTKDFAEPHIPCLMP----ESVSLRLEEVS---EEALRERISLRKVTAAVDMYDQLLQAGTAVSMETTHDLLDLICLYCD-RNPVQEGGPQAEEAEEAGEETKGRRGRTRRDIPKTPWKENNNAERIFNLLPERDSRCYSALIRGMVKHGAYAKAF-------SLYTDLLNDRLTGDVHLFNALILAAPELREKYNEKW--ELISELLNQMSQQKVHPDLLTFNSVLKALR-RCGYVAKTKALSTLNEMKAVGISPSLATYDHILAAFYKSASSGPSNTEILLEVLTELEGTRL-----TCQDPDDVLFFSSAMRICLDGKDLELGYKVQNLLEVGDNWRLLGDSYQQSIYYGRFFNL-LCMMEHIDVVLEWYRKIIPSRYYPNPQGMKDLLQALDTDSRLDMLPTIWKDIKSLG 514          
BLAST of SMED30000573 vs. Planmine SMEST
Match: SMESG000050316.1 (SMESG000050316.1)

HSP 1 Score: 1318.91 bits (3412), Expect = 0.000e+0
Identity = 676/679 (99.56%), Postives = 677/679 (99.71%), Query Frame = -1
Query:  149 MFRKHLGKFLSTCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLXXXXXXXXSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINTRSRTAGLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDELALKLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKESNIISNIIQATAMVFDQSLTTPVAKEESDHELRPKMIKSINRIFNTVFYEEPENLTNPKFISNLLNLIDKLRDLELKWKFIRFYGGFGKLFPSSIRVLIESFYRENXXXXXXXXXXXXXXXETAIGSIIDLPDEQSEFESVMKFTRNVAQSVLIENGVSIDHFSRILNQVEYSVTRGQKERLQIESIV 2185
            MFRKHLGKFLSTCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLSHSVSNSSSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAIN RSRTAGLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNE RSDELALKLNEITLGGGFTH+IGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKESNIISNIIQATAMVFDQSLTTPVAKEESDHELRPKMIKSINRIFNTVFYEEPENLTNPKFISNLLNLIDKLRDLELKWKFIRFYGGFGKLFPSSIRVLIESFYRENELDSLLELIEYLLENETAIGSIIDLPDEQSEFESVMKFTRNVAQSVLIENGVSIDHFSRILNQVEYSVTRGQKERLQIESIV
Sbjct:    1 MFRKHLGKFLSTCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNIVKVESSSPFYPLIDDPNLSHSVSNSSSRKYLLSKASGRTSAQLAFEDKKYDFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTEAWLFYQEYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVYSEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSIYPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVFTFNNAIYAINKRSRTAGLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKNHAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNECRSDELALKLNEITLGGGFTHMIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVVPNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKESNIISNIIQATAMVFDQSLTTPVAKEESDHELRPKMIKSINRIFNTVFYEEPENLTNPKFISNLLNLIDKLRDLELKWKFIRFYGGFGKLFPSSIRVLIESFYRENELDSLLELIEYLLENETAIGSIIDLPDEQSEFESVMKFTRNVAQSVLIENGVSIDHFSRILNQVEYSVTRGQKERLQIESIV 679          
The following BLAST results are available for this feature:
BLAST of SMED30000573 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PTCD38.448e-1624.75pentatricopeptide repeat domain 3 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30000573 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
let-6307.981e-924.38pep chromosome:WBcel235:I:5162599:5164884:-1 gene:... [more]
back to top
BLAST of SMED30000573 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG46791.035e-2424.95gene:FBgn0033816 transcript:FBtr0087759[more]
back to top
BLAST of SMED30000573 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ptcd33.912e-823.35pentatricopeptide repeat domain 3 [Source:NCBI gen... [more]
back to top
BLAST of SMED30000573 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ptcd32.101e-1623.37pentatricopeptide repeat domain 3 [Source:NCBI gen... [more]
ptcd32.401e-1623.37pentatricopeptide repeat domain 3 [Source:NCBI gen... [more]
ptcd35.707e-1222.52pentatricopeptide repeat domain 3 [Source:NCBI gen... [more]
back to top
BLAST of SMED30000573 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ptcd31.850e-1725.61pentatricopeptide repeat domain 3 [Source:MGI Symb... [more]
Ptcd31.148e-728.82pentatricopeptide repeat domain 3 [Source:MGI Symb... [more]
back to top
BLAST of SMED30000573 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1Z9A8|PTCD3_DROME1.037e-2324.95Protein PTCD3 homolog, mitochondrial OS=Drosophila... [more]
sp|Q32N55|PTCD3_XENLA6.369e-1924.44Pentatricopeptide repeat domain-containing protein... [more]
sp|Q14C51|PTCD3_MOUSE1.294e-1625.61Pentatricopeptide repeat domain-containing protein... [more]
sp|Q0IHP3|PTCD3_XENTR1.173e-1523.37Pentatricopeptide repeat-containing protein 3, mit... [more]
sp|Q96EY7|PTCD3_HUMAN4.057e-1524.75Pentatricopeptide repeat domain-containing protein... [more]
back to top
BLAST of SMED30000573 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2L2YIN66.424e-3224.91PPR_long domain-containing protein (Fragment) OS=P... [more]
A0A4Y2BPM71.501e-2927.03Protein PTCD3, mitochondrial OS=Araneus ventricosu... [more]
A0A3R7M0A72.213e-2727.00PTCD3-like protein, mitochondrial OS=Penaeus vanna... [more]
T1J0Z35.692e-2725.98AA_kinase domain-containing protein OS=Strigamia m... [more]
B3NRN52.747e-2626.11Uncharacterized protein OS=Drosophila erecta OX=72... [more]
back to top
BLAST of SMED30000573 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ptcd31.077e-2024.02pentatricopeptide repeat domain 3 [Source:NCBI gen... [more]
back to top
BLAST of SMED30000573 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000573 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000573 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000573 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptcd31.068e-1723.47pentatricopeptide repeat domain 3 [Source:NCBI gen... [more]
ptcd31.171e-1723.47pentatricopeptide repeat domain 3 [Source:NCBI gen... [more]
back to top
BLAST of SMED30000573 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000050316.10.000e+099.56SMESG000050316.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000573 ID=SMED30000573|Name=SMED30000573|organism=Schmidtea mediterranea sexual|type=transcript|length=2191bp
TTTTATTAGAAAAAAAGATTTATTTATCTTCTCCCGTTTTGTCATCTTTA
TCTTCTTTATCTTTATCTTCATCTTCTTTACCTTCCTCGTCACTATCGGA
GTCGTCATCACTGGCGCTGCTGTCGGACATCAAGTCGTCGTCATCATCCA
CAATTGATTCGATTTGCAACCTCTCCTTCTGTCCTCTGGTAACGGAATAC
TCGACCTGATTCAAAATTCGACTGAAGTGATCAATCGATACGCCGTTCTC
AATTAAAACCGACTGAGCGACATTCCTTGTGAACTTCATCACCGATTCGA
ATTCCGACTGCTCGTCCGGCAAATCGATAATACTACCGATTGCCGTTTCA
TTTTCCAACAGATACTCAATCAATTCCAGCAGGGAATCGAGCTCGTTCTC
TCGGTAAAACGACTCAATCAGAACTCGAATCGATGACGGAAACAACTTCC
CAAAGCCGCCATAGAACCGAATAAATTTCCATTTCAGTTCAAGATCTCGC
AATTTATCGATCAAATTCAAAAGATTCGAAATGAATTTCGGATTAGTCAA
ATTTTCCGGCTCCTCATAAAAAACGGTATTGAAAATCCGATTGATCGATT
TGATCATTTTCGGTCGCAACTCGTGATCGGATTCCTCCTTAGCAACGGGG
GTTGTTAAGGACTGATCAAATACCATCGCTGTCGCCTGGATGATATTGGA
GATTATATTGGATTCCTTGAACGCTTTTCCATTGATCCGGATCAAATCCA
GGATCTCCGGCAATAATCTGTATGTTTTCTTTAGCATGACCAGATTGAGC
AGCGAGGTCGCCAGAAACGGAGTGAACGTAAACAAGTTCGGCACGACACG
TTTGATTGTTTTCATCAAATAATCGAGATCCTGCGTTTCATTGATGGCTA
TGTTGAATAAAGACTGGAAATATTTGTAGGTATCGAAATTATTTCCAATG
ATATGAGTGAAGCCGCCACCTAACGTGATCTCGTTCAGTTTCAATGCCAA
TTCGTCAGATCGAGATTCATTTAACGATTGCATTGCGTATCGAAACAGCA
ATAAATCGTCTTTGGTATGGACTTCTTCGAATATGTTGTCTTTACGGCGT
TGCGAAAGAATCGTGATCAAATCGATCACCATGGCAGCGTGGTTTTTCCG
GAAATTTCTGCACTGGAAAATTAAGCAAAACGTACCCAGTGTTGGCTCAA
TATTCAAATAGCGCATTTCAGTGTAGAGATTTTCAATCAGTCCCGCTGTT
CTGCTTCGTGTATTGATCGCATATATCGCGTTGTTGAATGTGAAAACGTC
CGGAGCAACTTGGTAAAAACTCATTCCGGTTAGAATTTTCATTAAAATTT
TTATTAGAAAAGAATCATCATTGCAGGAAAACGATTCGAGACTTCTCAAC
AATAAATTGCATGTTTTCGTGTTGGGGAAGCTGTCGGGATATATAGAACG
CATCTCGTTGAATAATTCTATTGCTCGTGTTGGATTTCTAGCTTTGCTGG
ATCCCATAATCATCGATTCGTATGCGCATTTGGATTTGGATTTTAGTGAT
TGAAATAGCATTTCCGCTTCATTATCGAGATTCCATTCACTGTATACATC
ATTGCTGAAATAAAATTCCTCCGGCTGTGTTTCCAGATAATTGTTATTCA
ATCTAATGCCGAAACATAACAAGTCTAAAAGCTCTTGAGTGATTTCCGGA
GAAAATTTAGAAGATTCGTATTCCTGATAAAACAACCAAGCTTCAGTCGG
CTTCAATAAATTAATAATTAATCTCAGAGCTTTTTCTGGGTGGAAGGCGC
CAGACTTTACTTTTTCAACAATTTCTTCGTGCGAGATCATTGGCATTAGA
ATTTTAATTTTTGGCTCTTCTTTGGCTATTTTTAAAAAATCATATTTTTT
ATCTTCGAATGCTAACTGAGCACTAGTTCTTCCGGAAGCCTTACTGAGTA
AATACTTTCTACTACTAGAATTGGAAACTGAATGACTAAGATTCGGATCA
TCAATTAAAGGATAGAATGGTGAAGAAGATTCAACTTTAACAATATTTGA
TAAAGTTTTTAGTATAGATAGATTATCACGGTATATTTTGTTTGGTATTT
TAATTTCTTTTGGAATATGAAAATTTGAGACACTTAAACTATAATGACAA
GTAGATAGGAATTTTCCCAAATGTTTTCGGAACATTGTCAT
back to top

protein sequence of SMED30000573-orf-1

>SMED30000573-orf-1 ID=SMED30000573-orf-1|Name=SMED30000573-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=724bp
MTMFRKHLGKFLSTCHYSLSVSNFHIPKEIKIPNKIYRDNLSILKTLSNI
VKVESSSPFYPLIDDPNLSHSVSNSSSRKYLLSKASGRTSAQLAFEDKKY
DFLKIAKEEPKIKILMPMISHEEIVEKVKSGAFHPEKALRLIINLLKPTE
AWLFYQEYESSKFSPEITQELLDLLCFGIRLNNNYLETQPEEFYFSNDVY
SEWNLDNEAEMLFQSLKSKSKCAYESMIMGSSKARNPTRAIELFNEMRSI
YPDSFPNTKTCNLLLRSLESFSCNDDSFLIKILMKILTGMSFYQVAPDVF
TFNNAIYAINTRSRTAGLIENLYTEMRYLNIEPTLGTFCLIFQCRNFRKN
HAAMVIDLITILSQRRKDNIFEEVHTKDDLLLFRYAMQSLNESRSDELAL
KLNEITLGGGFTHIIGNNFDTYKYFQSLFNIAINETQDLDYLMKTIKRVV
PNLFTFTPFLATSLLNLVMLKKTYRLLPEILDLIRINGKAFKESNIISNI
IQATAMVFDQSLTTPVAKEESDHELRPKMIKSINRIFNTVFYEEPENLTN
PKFISNLLNLIDKLRDLELKWKFIRFYGGFGKLFPSSIRVLIESFYRENE
LDSLLELIEYLLENETAIGSIIDLPDEQSEFESVMKFTRNVAQSVLIENG
VSIDHFSRILNQVEYSVTRGQKERLQIESIVDDDDDLMSDSSASDDDSDS
DEEGKEDEDKDKEDKDDKTGEDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
IPR037387PTCD3
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0043024ribosomal small subunit binding
GO:0019843rRNA binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0032543mitochondrial translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 170..375
e-value: 3.1E-11
score: 45.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 681..706
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 677..722
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 707..722
IPR037387Pentatricopeptide repeat domain-containing protein 3PANTHERPTHR16276UNCHARACTERIZEDcoord: 24..555