Ropporin-1-like protein

Overview
NameRopporin-1-like protein
Smed IDSMED30000566
Length (bp)850
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ropporin-1-like protein (SMED30000566) t-SNE clustered cells

Violin plots show distribution of expression levels for Ropporin-1-like protein (SMED30000566) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ropporin-1-like protein (SMED30000566) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ropporin-1-like protein (SMED30000566) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000566

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000566SMESG000079804.1 SmedASXL_006544SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000566SMESG000079804.1 dd_Smed_v4_4888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000566SMESG000079804.1 dd_Smed_v4_4888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000566SMESG000079804.1 dd_Smed_v4_4888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000566SMESG000079804.1 dd_Smed_v4_4888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30000566SMESG000079804.1 dd_Smed_v4_4888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000566SMESG000079804.1 dd_Smed_v6_4888_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30000566SMESG000012940.1 SMESG000079804.1 SMESG000003706.1 OX_Smed_1.0.15415ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000566SMESG000079804.1 dd_Smed_v4_4888_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ropporin-1-like protein vs. Ensembl Human
Match: ROPN1L (rhophilin associated tail protein 1 like [Source:HGNC Symbol;Acc:HGNC:24060])

HSP 1 Score: 202.601 bits (514), Expect = 3.362e-64
Identity = 98/215 (45.58%), Postives = 145/215 (67.44%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVE-RQGGLVQPSNFFHP 712
            MPL +   +C +QIHIPP+ PDILKQFTKAAIRTQP DVL WS  YF A++ G+  PVK+R+EMP +TQKTDTGLT  LLK L++Q   K+ ++L ++E +WK+L +P E F  + ++      ++W+ FL++  + +  ++  +LK LCEILT DPE GP+RI F+ +  +Y YL  +D  +S    ES +  L  +++ R+ G++  S+FF P
Sbjct:    1 MPLPDT-MFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFP 214          
BLAST of Ropporin-1-like protein vs. Ensembl Human
Match: ROPN1L (rhophilin associated tail protein 1 like [Source:HGNC Symbol;Acc:HGNC:24060])

HSP 1 Score: 202.601 bits (514), Expect = 3.362e-64
Identity = 98/215 (45.58%), Postives = 145/215 (67.44%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVE-RQGGLVQPSNFFHP 712
            MPL +   +C +QIHIPP+ PDILKQFTKAAIRTQP DVL WS  YF A++ G+  PVK+R+EMP +TQKTDTGLT  LLK L++Q   K+ ++L ++E +WK+L +P E F  + ++      ++W+ FL++  + +  ++  +LK LCEILT DPE GP+RI F+ +  +Y YL  +D  +S    ES +  L  +++ R+ G++  S+FF P
Sbjct:    1 MPLPDT-MFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFP 214          
BLAST of Ropporin-1-like protein vs. Ensembl Human
Match: ROPN1 (rhophilin associated tail protein 1 [Source:HGNC Symbol;Acc:HGNC:17692])

HSP 1 Score: 174.096 bits (440), Expect = 2.560e-53
Identity = 83/205 (40.49%), Postives = 131/205 (63.90%), Query Frame = 2
Query:  116 IPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQ 730
            IPP+ P +LK+F KAAIR QP+D++ W+  YF A++ GE PPV+ER E      + +  LTPELLK L+ Q+  + +I+ EE+   WK + +P +LF+ V  +G F  ++EWLKFL++  + +   IT++LK++CE+L+ D   G  RI F  ++ LYTY+  +DG ISA HV  ++ Y+  +V    G++  ++F     P+VQ
Sbjct:   10 IPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAE--LTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQN--PRVQ 210          
BLAST of Ropporin-1-like protein vs. Ensembl Human
Match: ROPN1 (rhophilin associated tail protein 1 [Source:HGNC Symbol;Acc:HGNC:17692])

HSP 1 Score: 174.096 bits (440), Expect = 2.560e-53
Identity = 83/205 (40.49%), Postives = 131/205 (63.90%), Query Frame = 2
Query:  116 IPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQ 730
            IPP+ P +LK+F KAAIR QP+D++ W+  YF A++ GE PPV+ER E      + +  LTPELLK L+ Q+  + +I+ EE+   WK + +P +LF+ V  +G F  ++EWLKFL++  + +   IT++LK++CE+L+ D   G  RI F  ++ LYTY+  +DG ISA HV  ++ Y+  +V    G++  ++F     P+VQ
Sbjct:   10 IPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAE--LTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQN--PRVQ 210          
BLAST of Ropporin-1-like protein vs. Ensembl Human
Match: ROPN1 (rhophilin associated tail protein 1 [Source:HGNC Symbol;Acc:HGNC:17692])

HSP 1 Score: 174.096 bits (440), Expect = 2.560e-53
Identity = 83/205 (40.49%), Postives = 131/205 (63.90%), Query Frame = 2
Query:  116 IPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQ 730
            IPP+ P +LK+F KAAIR QP+D++ W+  YF A++ GE PPV+ER E      + +  LTPELLK L+ Q+  + +I+ EE+   WK + +P +LF+ V  +G F  ++EWLKFL++  + +   IT++LK++CE+L+ D   G  RI F  ++ LYTY+  +DG ISA HV  ++ Y+  +V    G++  ++F     P+VQ
Sbjct:   10 IPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAE--LTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQN--PRVQ 210          
BLAST of Ropporin-1-like protein vs. Ensembl Zebrafish
Match: ropn1l (rhophilin associated tail protein 1-like [Source:NCBI gene;Acc:798354])

HSP 1 Score: 226.483 bits (576), Expect = 6.284e-74
Identity = 104/211 (49.29%), Postives = 149/211 (70.62%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNF 703
            MPL E   YC +QI+IPP  P++LKQFTKAAIRTQP+DVL W+  YF A++ G+  PVK+RLE+P++TQKTDTGLTP LLK L++QL  K+ +  +E+  +WK L +P+E    +  +GNF  ++ W++F ++  + +  +IT +LK  CEILT DPE GP++I F +++ LYTYL  +DG I  E ++S +  L    + QGG+VQPSNF
Sbjct:    1 MPLSET-MYCAQQINIPPALPNMLKQFTKAAIRTQPRDVLQWAADYFSALSKGQDLPVKKRLELPVATQKTDTGLTPGLLKILHQQLTSKETVTKDELLPKWKALHLPVEQLDTILALGNFSENINWMQFFALACSALGGSITSALKHACEILTEDPEGGPAQIPFHMFRSLYTYLAHLDGEIPEEQIDSFLHSLEGQAQSQGGMVQPSNF 210          
BLAST of Ropporin-1-like protein vs. Ensembl Zebrafish
Match: ropn1l (rhophilin associated tail protein 1-like [Source:NCBI gene;Acc:798354])

HSP 1 Score: 226.483 bits (576), Expect = 6.284e-74
Identity = 104/211 (49.29%), Postives = 149/211 (70.62%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNF 703
            MPL E   YC +QI+IPP  P++LKQFTKAAIRTQP+DVL W+  YF A++ G+  PVK+RLE+P++TQKTDTGLTP LLK L++QL  K+ +  +E+  +WK L +P+E    +  +GNF  ++ W++F ++  + +  +IT +LK  CEILT DPE GP++I F +++ LYTYL  +DG I  E ++S +  L    + QGG+VQPSNF
Sbjct:    1 MPLSET-MYCAQQINIPPALPNMLKQFTKAAIRTQPRDVLQWAADYFSALSKGQDLPVKKRLELPVATQKTDTGLTPGLLKILHQQLTSKETVTKDELLPKWKALHLPVEQLDTILALGNFSENINWMQFFALACSALGGSITSALKHACEILTEDPEGGPAQIPFHMFRSLYTYLAHLDGEIPEEQIDSFLHSLEGQAQSQGGMVQPSNF 210          
BLAST of Ropporin-1-like protein vs. Ensembl Zebrafish
Match: ropn1l (rhophilin associated tail protein 1-like [Source:NCBI gene;Acc:798354])

HSP 1 Score: 223.402 bits (568), Expect = 7.281e-73
Identity = 100/203 (49.26%), Postives = 145/203 (71.43%), Query Frame = 2
Query:   95 YCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNF 703
            YC +QI+IPP  P++LKQFTKAAIRTQP+DVL W+  YF A++ G+  PVK+RLE+P++TQKTDTGLTP LLK L++QL  K+ +  +E+  +WK L +P+E    +  +GNF  ++ W++F ++  + +  +IT +LK  CEILT DPE GP++I F +++ LYTYL  +DG I  E ++S +  L    + QGG+VQPSNF
Sbjct:    2 YCAQQINIPPALPNMLKQFTKAAIRTQPRDVLQWAADYFSALSKGQDLPVKKRLELPVATQKTDTGLTPGLLKILHQQLTSKETVTKDELLPKWKALHLPVEQLDTILALGNFSENINWMQFFALACSALGGSITSALKHACEILTEDPEGGPAQIPFHMFRSLYTYLAHLDGEIPEEQIDSFLHSLEGQAQSQGGMVQPSNF 204          
BLAST of Ropporin-1-like protein vs. Ensembl Xenopus
Match: ropn1l (rhophilin associated tail protein 1-like [Source:NCBI gene;Acc:100158532])

HSP 1 Score: 236.498 bits (602), Expect = 1.199e-77
Identity = 107/212 (50.47%), Postives = 149/212 (70.28%), Query Frame = 2
Query:   86 EPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCP 721
            E  +C +QI+IPP+ PDILKQFTKAAIRTQP D+L WS AYF +++ GE  PVK+R+E+ ++TQKTDTGLTP LLK LN+QL     I++ +++ +W +L +P E  H +  + NF  D+EWLKFLS+  + +  +I+ +LK  CEILT DPE G +RISF+ +  +Y YL  IDG IS   +E V++ L ++ ERQ G++QP NF    CP
Sbjct:    5 ETMFCSQQINIPPELPDILKQFTKAAIRTQPHDLLQWSAAYFDSLSKGEPLPVKDRIELQVATQKTDTGLTPGLLKVLNKQLSSNMSIKIADLKQKWTNLCLPEEQLHSILGLDNFQDDIEWLKFLSLGCSALGGSISSALKYACEILTEDPEGGAARISFDTFTYIYKYLAHIDGDISNMQIEDVLSVLQSEAERQNGMIQPRNFLTSQCP 216          
BLAST of Ropporin-1-like protein vs. Ensembl Mouse
Match: Ropn1l (ropporin 1-like [Source:MGI Symbol;Acc:MGI:2182357])

HSP 1 Score: 200.675 bits (509), Expect = 1.013e-63
Identity = 98/213 (46.01%), Postives = 146/213 (68.54%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVE-RQGGLVQPSNFF 706
            MPL +   +C +QIHIPP+ PDILKQFTKAAIRTQP DVL WS  YF A++ G+  PVK+R+EMP++TQKTDTGLT  LLK L++Q   K+ ++L ++E +WK+L +P+E    + ++      +EW+KFL++  +++   +  ++K +CEILT+DPE GP+RI FE +  +Y YL  +D  + A   E+ +T L    E R+ G++  S+FF
Sbjct:    1 MPLPDT-MFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDRIEMPVATQKTDTGLTQGLLKVLHKQCSHKQYVELADLEKKWKNLCLPVEKLRTILELDPCEDKIEWIKFLALGCSSLGRTLNTAMKNVCEILTSDPEGGPARIPFETFAYVYQYLSGLDPELPAVETENYLTSLRLMSESRKNGMIGLSDFF 212          
BLAST of Ropporin-1-like protein vs. Ensembl Mouse
Match: Ropn1 (ropporin, rhophilin associated protein 1 [Source:MGI Symbol;Acc:MGI:1923628])

HSP 1 Score: 181.8 bits (460), Expect = 1.924e-56
Identity = 85/201 (42.29%), Postives = 137/201 (68.16%), Query Frame = 2
Query:  104 EQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLE-MPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNF 703
            +Q+ IPP+ P++LKQFTK AIRTQP D++ W+  YF AM+ GE+PPV+ER E +P+S       LTPELLK L+ ++  + +I  +E+   WK L +P +LF+ V  +G F  ++EWLKFL++  +++   I ++LK++CE+L++D + GP RI F  ++ LYTY+  +DG IS+ HV  ++ Y+  +V    GL++ ++F
Sbjct:    6 KQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQIPLSNWAE---LTPELLKVLHSRVAGRLIIHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDGGPPRIPFSTFQFLYTYIAEVDGEISSSHVSRMLNYIEQEVIGPDGLIKVNDF 203          
BLAST of Ropporin-1-like protein vs. Ensembl Mouse
Match: Ropn1 (ropporin, rhophilin associated protein 1 [Source:MGI Symbol;Acc:MGI:1923628])

HSP 1 Score: 142.895 bits (359), Expect = 4.440e-42
Identity = 67/151 (44.37%), Postives = 106/151 (70.20%), Query Frame = 2
Query:  104 EQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLE-MPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGP 553
            +Q+ IPP+ P++LKQFTK AIRTQP D++ W+  YF AM+ GE+PPV+ER E +P+S       LTPELLK L+ ++  + +I  +E+   WK L +P +LF+ V  +G F  ++EWLKFL++  +++   I ++LK++CE+L++D + GP
Sbjct:    6 KQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQIPLSNWAE---LTPELLKVLHSRVAGRLIIHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDGGP 153          
BLAST of Ropporin-1-like protein vs. UniProt/SwissProt
Match: sp|Q4V7T8|ROP1L_XENLA (Ropporin-1-like protein OS=Xenopus laevis OX=8355 GN=ropn1l PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 3.516e-74
Identity = 104/212 (49.06%), Postives = 146/212 (68.87%), Query Frame = 2
Query:   86 EPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCP 721
            E  +C +QI+IPP+ PDILKQFTKAAIRTQP D+L WS AYF +++ GE  PVK+R+E+ ++TQKTD+GLTP LLK LN+QL  K  +++ +++ +W DL +P E    +  + NF  D++WLKFLS+  + +  +I+ +LK  CEILT DPE G + I F+ +  +Y YL  IDG IS   +E V+  L ++ ERQ GL+QP NF    CP
Sbjct:    5 ETMFCAQQINIPPELPDILKQFTKAAIRTQPHDLLQWSAAYFDSLSKGEPLPVKDRVELQVATQKTDSGLTPGLLKVLNKQLSSKMSVKIADLKQKWTDLCLPEEQLQNILGLDNFQDDIDWLKFLSLGCSALGGSISSALKYACEILTEDPEGGAAHIPFDTFTYIYKYLAHIDGDISEMQIEDVLNVLQSEAERQNGLIQPRNFLSSQCP 216          
BLAST of Ropporin-1-like protein vs. UniProt/SwissProt
Match: sp|Q66IC9|ROP1L_DANRE (Ropporin-1-like protein OS=Danio rerio OX=7955 GN=ropn1l PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 4.743e-73
Identity = 104/211 (49.29%), Postives = 149/211 (70.62%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNF 703
            MPL E   YC +QI+IPP  P++LKQFTKAAIRTQP+DVL W+  YF A++ G+  PVK+RLE+P++TQKTDTGLTP LLK L++QL  K+ +  +E+  +WK L +P+E    +  +GNF  ++ W++F ++  + +  +IT +LK  CEILT DPE GP++I F +++ LYTYL  +DG I  E ++S +  L    + QGG+VQPSNF
Sbjct:    1 MPLSET-MYCAQQINIPPALPNMLKQFTKAAIRTQPRDVLQWAADYFSALSKGQDLPVKKRLELPVATQKTDTGLTPGLLKILHQQLTSKETVTKDELLPKWKALHLPVEQLDTILALGNFSENINWMQFFALACSALGGSITSALKHACEILTEDPEGGPAQIPFHMFRSLYTYLAHLDGEIPEEQIDSFLHSLEGQAQSQGGMVQPSNF 210          
BLAST of Ropporin-1-like protein vs. UniProt/SwissProt
Match: sp|Q4R760|ROP1L_MACFA (Ropporin-1-like protein OS=Macaca fascicularis OX=9541 GN=ROPN1L PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.026e-65
Identity = 99/215 (46.05%), Postives = 148/215 (68.84%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVE-RQGGLVQPSNFFHP 712
            MPL +   +C +QIHIPP+ PDILKQFTKAAIRTQP DVL WS  YF A++ G+  PVK+R+EMP +TQKTDTGLTP LLK L++Q   K+ ++L ++E +WK+L +P E F  + ++      ++W+ FL++  + +  ++  +LK LCEILT DPE GP+RI F+ +  +Y YL ++D  +S+   ES +  L  +++ R+ G++  S+FF P
Sbjct:    1 MPLPDT-MFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTPGLLKVLHKQCHHKQYVELTDLEQKWKNLCLPKEKFKALLQLDPCENRIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLANLDSDVSSSETESYLASLKENIDTRRNGMIGLSDFFFP 214          
BLAST of Ropporin-1-like protein vs. UniProt/SwissProt
Match: sp|Q96C74|ROP1L_HUMAN (Ropporin-1-like protein OS=Homo sapiens OX=9606 GN=ROPN1L PE=1 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 1.614e-63
Identity = 98/215 (45.58%), Postives = 145/215 (67.44%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVE-RQGGLVQPSNFFHP 712
            MPL +   +C +QIHIPP+ PDILKQFTKAAIRTQP DVL WS  YF A++ G+  PVK+R+EMP +TQKTDTGLT  LLK L++Q   K+ ++L ++E +WK+L +P E F  + ++      ++W+ FL++  + +  ++  +LK LCEILT DPE GP+RI F+ +  +Y YL  +D  +S    ES +  L  +++ R+ G++  S+FF P
Sbjct:    1 MPLPDT-MFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFP 214          
BLAST of Ropporin-1-like protein vs. UniProt/SwissProt
Match: sp|Q9EQ00|ROP1L_MOUSE (Ropporin-1-like protein OS=Mus musculus OX=10090 GN=Ropn1l PE=1 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 7.087e-63
Identity = 98/213 (46.01%), Postives = 146/213 (68.54%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVE-RQGGLVQPSNFF 706
            MPL +   +C +QIHIPP+ PDILKQFTKAAIRTQP DVL WS  YF A++ G+  PVK+R+EMP++TQKTDTGLT  LLK L++Q   K+ ++L ++E +WK+L +P+E    + ++      +EW+KFL++  +++   +  ++K +CEILT+DPE GP+RI FE +  +Y YL  +D  + A   E+ +T L    E R+ G++  S+FF
Sbjct:    1 MPLPDT-MFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDRIEMPVATQKTDTGLTQGLLKVLHKQCSHKQYVELADLEKKWKNLCLPVEKLRTILELDPCEDKIEWIKFLALGCSSLGRTLNTAMKNVCEILTSDPEGGPARIPFETFAYVYQYLSGLDPELPAVETENYLTSLRLMSESRKNGMIGLSDFF 212          
BLAST of Ropporin-1-like protein vs. TrEMBL
Match: A0A1S3IZK8 (ropporin-1-like protein OS=Lingula unguis OX=7574 GN=LOC106168805 PE=4 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 2.961e-103
Identity = 141/219 (64.38%), Postives = 175/219 (79.91%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKV 727
            MP  +EPYYC +QI+IPP+ PDILKQFTKAAIRTQPKDVL+W+ AYFRAM+ GE PPVKERLEMP++TQKTDTGLTP LL+ LN+QLGP+K + L +IE +WKDL +P E F E+ +IG+F  D EWLKF S+ A+T+  NIT ++K +CEILTADPE GP RI F+L+K LY YL  IDG IS EH++ VI++L  DV++Q G VQP NF  PDCPK+
Sbjct:    1 MPAPDEPYYCSQQINIPPELPDILKQFTKAAIRTQPKDVLAWAAAYFRAMSKGETPPVKERLEMPVATQKTDTGLTPGLLRILNKQLGPRKTVPLSQIEEKWKDLSLPKEQFDELVRIGSFGGDTEWLKFFSLAASTLGENITNAMKTICEILTADPEGGPCRIPFQLFKDLYKYLAQIDGEISKEHIDEVISHLQYDVDKQDGFVQPRNFLSPDCPKL 219          
BLAST of Ropporin-1-like protein vs. TrEMBL
Match: A0A210QPC1 (Ropporin-1-like protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18301 PE=4 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 1.305e-97
Identity = 133/215 (61.86%), Postives = 170/215 (79.07%), Query Frame = 2
Query:   83 EEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKV 727
            +EPYYC +QI+IPP  PDILKQFTKAAIRTQPKDVL+WS AYFRAM+ GE PPVKERLEMP++TQKTDTGLTP LL+ LN+QLGPKK++ L  +E +W+D+ +P E F E+ +IG+F  DVEW KF ++  + +  N+T++LKL+CEILTADPE GP+RI F L+K LYTYL  IDG IS  H++  I++L  DV++Q G +QP NF  PD PK+
Sbjct:    6 DEPYYCSQQINIPPSLPDILKQFTKAAIRTQPKDVLAWSAAYFRAMSKGETPPVKERLEMPVATQKTDTGLTPGLLRVLNKQLGPKKMVPLSVVEEKWQDVALPKEQFDEIVRIGSFGGDVEWNKFFTLACSALGENLTDALKLVCEILTADPEGGPARIPFPLFKELYTYLAQIDGDISQGHIDDTISHLKYDVDKQDGYIQPRNFLSPDGPKL 220          
BLAST of Ropporin-1-like protein vs. TrEMBL
Match: A0A4S2LPL4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005775 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.206e-96
Identity = 140/221 (63.35%), Postives = 166/221 (75.11%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQP 733
            MPL  +PYYCHEQI IPP FPDILKQFTKAAIRTQPKDVL WSHAYFRA+AN E PPVK+RLE+PISTQK DTGLTP LL+ LN QL   K I +  IE +WKDL +PME F E+C+IGNFV   EW  FL+I A+ + A + E+LKL+CE+LT+DPE GP+RISFE W   Y YL  +D  IS  H+  VITYL  D+  Q G++ P NF HP+CPK+ P
Sbjct:    1 MPLVNDPYYCHEQIPIPPAFPDILKQFTKAAIRTQPKDVLKWSHAYFRALANSEPPPVKDRLEVPISTQKIDTGLTPGLLRVLNNQLAALKTIPVTVIEEKWKDLSLPMERFQELCRIGNFVGTCEWRHFLAIAASDLCATLAETLKLICELLTSDPEGGPARISFETWLDFYRYLGKLDD-ISDAHINHVITYLTFDIASQEGMIMPRNFMHPECPKLNP 220          
BLAST of Ropporin-1-like protein vs. TrEMBL
Match: R7UE06 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_173464 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 3.401e-96
Identity = 135/219 (61.64%), Postives = 166/219 (75.80%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKV 727
            MP   EP YC EQI IPP+ PDILKQFTKAAIRTQPKDVL WS AYFRAMAN E PPVKERLE+PI+TQ TDTGLTP LLK LN QLGPK+ + +  IE +W DL +P++ FH++ +IGNF   VEW+KF S+ ++++  NIT+++K++CEILTADPE G +RISF+ ++ LY YL  IDG IS EHV +VI YL   VE+Q   VQP NF   DCP +
Sbjct:    1 MPQSNEPLYCSEQIKIPPELPDILKQFTKAAIRTQPKDVLGWSAAYFRAMANHETPPVKERLELPIATQCTDTGLTPGLLKVLNNQLGPKQKVAVSVIEKKWTDLSLPIDTFHDLVRIGNFTGTVEWVKFFSLASSSLGENITDAMKMICEILTADPEGGAARISFKQFQYLYKYLAQIDGEISDEHVNTVINYLQYQVEKQDNFVQPRNFLSNDCPSL 219          
BLAST of Ropporin-1-like protein vs. TrEMBL
Match: A0A194ALT8 (Putative ropporin-1-like protein isoform X2 OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 5.208e-96
Identity = 133/215 (61.86%), Postives = 167/215 (77.67%), Query Frame = 2
Query:   83 EEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKV 727
            +EPYYC +QI+IPP  PDILKQFTKAAIRTQPKDVL+WS AYFRAM+ GE PPVKERLEMP++TQKTDTGLT  LL+ LN+QLGPKK + L  IE +W DL +P E F ++ +IG+F  ++EW KF ++CA+ +  N+T+++K +CEILTADPE GPSRI F+L+K LYTYL  IDG IS + +  V  YL   VE+Q G VQP NF  P+CPK+
Sbjct:    6 DEPYYCSQQINIPPALPDILKQFTKAAIRTQPKDVLAWSAAYFRAMSKGETPPVKERLEMPVATQKTDTGLTSGLLRVLNKQLGPKKTVPLSLIEEKWVDLALPKEQFDDLVRIGSFGGEIEWNKFFALCASALGENVTDAMKTVCEILTADPEGGPSRIPFQLFKDLYTYLAQIDGEISQQQINDVTGYLKYHVEKQDGYVQPRNFLSPECPKL 220          
BLAST of Ropporin-1-like protein vs. Ensembl Cavefish
Match: ropn1l (rhophilin associated tail protein 1 like [Source:NCBI gene;Acc:103044596])

HSP 1 Score: 225.713 bits (574), Expect = 1.794e-73
Identity = 104/203 (51.23%), Postives = 143/203 (70.44%), Query Frame = 2
Query:   95 YCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNF 703
            YC +QI+IPP+ PDILKQFTKAAIRTQP DVL W+  YF A++ GE  PVK+RLEMP++TQKTDTGLTP LLK L++QL PK+ +  EE+  +WK L +P+E  + +  +GNF   ++W+ F ++  + +   I  +LK  CEILT DPE G +RI F+ +  LYTYL  +D  I  + ++S +  L   V+RQGG+VQP+NF
Sbjct:   24 YCSQQINIPPELPDILKQFTKAAIRTQPPDVLQWAATYFSALSKGETLPVKDRLEMPVATQKTDTGLTPGLLKVLHKQLSPKEPVMKEELLKKWKGLCLPVEQLNTLLDLGNFDEQIDWMGFFALSCSALGGTIISALKHACEILTEDPEGGAARIPFDTFVTLYTYLAKLDEDIPQDQIDSFLLSLQEPVQRQGGMVQPTNF 226          
BLAST of Ropporin-1-like protein vs. Ensembl Cavefish
Match: ropn1l (rhophilin associated tail protein 1 like [Source:NCBI gene;Acc:103044596])

HSP 1 Score: 215.312 bits (547), Expect = 1.211e-69
Identity = 99/204 (48.53%), Postives = 140/204 (68.63%), Query Frame = 2
Query:   95 YCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFF 706
            YC +QI+IPP+ PDILKQFTKAAIRTQP DVL W+  YF A++ GE  PVK+RLEMP++TQKTDTGLTP LLK L++QL PK+ +  EE+  +WK L +P+E  + +  +GNF   ++W+ F ++  + +   I  +LK  CEILT DPE G +RI F+ +  LYTYL  +D  I  + ++S +  L   V  Q G+++ +NF+
Sbjct:    8 YCSQQINIPPELPDILKQFTKAAIRTQPPDVLQWAATYFSALSKGETLPVKDRLEMPVATQKTDTGLTPGLLKVLHKQLSPKEPVMKEELLKKWKGLCLPVEQLNTLLDLGNFDEQIDWMGFFALSCSALGGTIISALKHACEILTEDPEGGAARIPFDTFVTLYTYLAKLDEDIPQDQIDSFLLSLQEPVANQNGMIKVANFY 211          
BLAST of Ropporin-1-like protein vs. Ensembl Sea Lamprey
Match: ropn1l (rhophilin associated tail protein 1-like [Source:NCBI gene;Acc:798354])

HSP 1 Score: 205.297 bits (521), Expect = 1.287e-66
Identity = 95/197 (48.22%), Postives = 138/197 (70.05%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGA 661
            MP  EE  YC +QIH+PP+ PDILKQFTKAAIRTQP+DVL+W+ AYF A   GE  PVKERLEMP++TQ+ DTGLTP LL+TL+ Q+   + +  E +E RW  L +P+E    +  +G+F  +VEW+KF ++  +++   +  +L+  CE+L+ DPE G +R+  ++++ LY+YL  +DG I   HV++V+ YL A
Sbjct:    1 MPPPEE-MYCAQQIHVPPELPDILKQFTKAAIRTQPRDVLTWASAYFHAKVRGEPLPVKERLEMPVATQRDDTGLTPGLLRTLHTQMDSNEWVAREVLEERWVALCLPVEQLSSLLALGSFGPNVEWIKFFALACSSLGGTLARALQHACELLSTDPEGGAARVPVKVFEQLYSYLAEVDGDIPHAHVDAVLLYLQA 196          
BLAST of Ropporin-1-like protein vs. Ensembl Nematostella
Match: EDO46582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ8])

HSP 1 Score: 241.121 bits (614), Expect = 3.262e-80
Identity = 115/221 (52.04%), Postives = 155/221 (70.14%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQP 733
            MP  +EP YC +QI+IPP+ PDILKQFTKAAIRTQP DVL W++AYF A+A GE PPVKERLE  +  Q  +  LT   L  L+RQLG K +I+L  +E +W+ L +P +   E+ ++G+F  +++WL FLS+  + I  N+T ++K +CEILT D E GP+RI F L+K LYTYL ++DG I  EHV++VI +LG DVE+Q G+V P NF    CP + P
Sbjct:    1 MPQADEPIYCSQQINIPPELPDILKQFTKAAIRTQPTDVLQWAYAYFDALAKGETPPVKERLEFQLG-QPLEKPLTEGQLGILHRQLGSKPIIELSSLEEKWRHLCLPKDTLEELLRLGSFAEELKWLHFLSLACSAISENLTLAMKTICEILTTDLEGGPARIPFSLFKELYTYLANVDGEIPKEHVDTVINHLGYDVEKQDGMVSPRNFMSDSCPPLSP 220          
BLAST of Ropporin-1-like protein vs. Ensembl Nematostella
Match: EDO28657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5V3])

HSP 1 Score: 149.058 bits (375), Expect = 3.320e-45
Identity = 71/138 (51.45%), Postives = 97/138 (70.29%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTI 484
            MP  +EP YC +QI+IPP+ PDILKQFTKAAIRTQP DVL W++AYF A+A GE PPVKERLE  +  Q  +  LT   L  L+RQLG K +I+L  +E +W+ L +P +   E+ ++G+F  +++WL FLS+  + I
Sbjct:    1 MPQADEPIYCSQQINIPPELPDILKQFTKAAIRTQPTDVLQWAYAYFDALAKGETPPVKERLEFQLG-QPLEKPLTEGQLGILHRQLGSKPIIELSSLEEKWRHLCLPKDTLEELLRLGSFAEELKWLHFLSLACSAI 137          
BLAST of Ropporin-1-like protein vs. Ensembl Medaka
Match: ropn1l (ropporin-1-like protein [Source:NCBI gene;Acc:101164761])

HSP 1 Score: 198.749 bits (504), Expect = 4.624e-63
Identity = 94/213 (44.13%), Postives = 138/213 (64.79%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFH 709
            MPL +   YC EQI+IPP+ PDILK F KAAIRTQP D+L+WS AYF  ++ GE  PVK+RLE+  +TQK D  LTP LLKTL++QL  +K    EE++A+WK L +       +  +G F  +++W++F ++  + +   +  S+K  CEILT D E G +RI F+ +  +YT+L  +DG +  EH++  +  L   VE Q G+++P+NF H
Sbjct:    1 MPLPDT-LYCAEQINIPPELPDILKNFAKAAIRTQPMDLLAWSAAYFNDLSKGECLPVKDRLEIDATTQKMDPSLTPGLLKTLHKQLSSRKTCSKEELQAKWKGLCLSPNQLDTLLSLGGFDSEIDWIEFFALGCSALGGTLLSSMKFACEILTNDEEGGAARIPFDTFVQIYTFLAHLDGDVLQEHIDIFLNSLKPQVELQHGMIKPANFSH 212          
BLAST of Ropporin-1-like protein vs. Planmine SMEST
Match: SMESG000079804.1 (SMESG000079804.1)

HSP 1 Score: 456.447 bits (1173), Expect = 6.369e-165
Identity = 220/221 (99.55%), Postives = 220/221 (99.55%), Query Frame = 2
Query:   71 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQP 733
            MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVD EWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQP
Sbjct:    1 MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAMANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEARWKDLLIPMELFHEVCKIGNFVVDAEWLKFLSICATTIRANITESLKLLCEILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVERQGGLVQPSNFFHPDCPKVQP 221          
The following BLAST results are available for this feature:
BLAST of Ropporin-1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ROPN1L3.362e-6445.58rhophilin associated tail protein 1 like [Source:H... [more]
ROPN1L3.362e-6445.58rhophilin associated tail protein 1 like [Source:H... [more]
ROPN12.560e-5340.49rhophilin associated tail protein 1 [Source:HGNC S... [more]
ROPN12.560e-5340.49rhophilin associated tail protein 1 [Source:HGNC S... [more]
ROPN12.560e-5340.49rhophilin associated tail protein 1 [Source:HGNC S... [more]
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ropn1l6.284e-7449.29rhophilin associated tail protein 1-like [Source:N... [more]
ropn1l6.284e-7449.29rhophilin associated tail protein 1-like [Source:N... [more]
ropn1l7.281e-7349.26rhophilin associated tail protein 1-like [Source:N... [more]
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ropn1l1.199e-7750.47rhophilin associated tail protein 1-like [Source:N... [more]
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ropn1l1.013e-6346.01ropporin 1-like [Source:MGI Symbol;Acc:MGI:2182357... [more]
Ropn11.924e-5642.29ropporin, rhophilin associated protein 1 [Source:M... [more]
Ropn14.440e-4244.37ropporin, rhophilin associated protein 1 [Source:M... [more]
back to top
BLAST of Ropporin-1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4V7T8|ROP1L_XENLA3.516e-7449.06Ropporin-1-like protein OS=Xenopus laevis OX=8355 ... [more]
sp|Q66IC9|ROP1L_DANRE4.743e-7349.29Ropporin-1-like protein OS=Danio rerio OX=7955 GN=... [more]
sp|Q4R760|ROP1L_MACFA1.026e-6546.05Ropporin-1-like protein OS=Macaca fascicularis OX=... [more]
sp|Q96C74|ROP1L_HUMAN1.614e-6345.58Ropporin-1-like protein OS=Homo sapiens OX=9606 GN... [more]
sp|Q9EQ00|ROP1L_MOUSE7.087e-6346.01Ropporin-1-like protein OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of Ropporin-1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IZK82.961e-10364.38ropporin-1-like protein OS=Lingula unguis OX=7574 ... [more]
A0A210QPC11.305e-9761.86Ropporin-1-like protein OS=Mizuhopecten yessoensis... [more]
A0A4S2LPL41.206e-9663.35Uncharacterized protein OS=Opisthorchis felineus O... [more]
R7UE063.401e-9661.64Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A194ALT85.208e-9661.86Putative ropporin-1-like protein isoform X2 OS=Pin... [more]
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ropn1l1.794e-7351.23rhophilin associated tail protein 1 like [Source:N... [more]
ropn1l1.211e-6948.53rhophilin associated tail protein 1 like [Source:N... [more]
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ropn1l1.287e-6648.22rhophilin associated tail protein 1-like [Source:N... [more]
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO465823.262e-8052.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286573.320e-4551.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ropporin-1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ropn1l4.624e-6344.13ropporin-1-like protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ropporin-1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079804.16.369e-16599.55SMESG000079804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000566 ID=SMED30000566|Name=Ropporin-1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=850bp
TAGTTACCATAGGAGCGTTTTGTGATATTTTAAAAAACTCAAATTCATTA
ATTCAAATATTGAATTTGAAATGCCTTTAGAAGAAGAACCGTATTATTGC
CACGAACAAATACATATTCCGCCTCAGTTTCCAGATATTCTAAAACAATT
TACAAAAGCTGCCATTCGTACCCAGCCAAAAGATGTGTTGTCTTGGTCTC
ATGCGTACTTTAGAGCCATGGCAAACGGCGAACTGCCGCCTGTTAAAGAA
AGACTAGAAATGCCTATATCAACTCAGAAAACTGATACTGGATTGACTCC
GGAATTATTAAAAACCCTTAATCGACAACTTGGGCCGAAAAAAGTTATAC
AATTAGAAGAAATTGAAGCACGTTGGAAAGACCTATTAATTCCTATGGAG
TTATTTCATGAAGTGTGTAAAATCGGTAACTTCGTTGTGGATGTTGAATG
GCTAAAGTTTTTGTCGATTTGTGCAACAACTATTAGAGCTAATATTACTG
AATCTCTTAAATTACTCTGTGAGATTCTCACAGCTGATCCGGAATGTGGT
CCGTCTCGAATTTCATTTGAATTGTGGAAGATGCTCTACACTTATCTCGT
GTCGATCGACGGTTGCATTTCCGCTGAGCACGTTGAAAGCGTTATCACTT
ATTTGGGAGCGGATGTTGAACGACAAGGTGGCCTCGTTCAACCAAGCAAT
TTCTTTCATCCGGATTGTCCTAAAGTTCAACCGTAGTTTCTGGTAATGGG
ATCAATTGACTTCTATCGTGTTTTAATGTTTTGAGATGAAATAGGAGATG
AAATTTGAATGTCCTTGTGTTTTTTAAAACAATATAAATAAACAGATCGG
back to top

protein sequence of SMED30000566-orf-1

>SMED30000566-orf-1 ID=SMED30000566-orf-1|Name=SMED30000566-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=222bp
MPLEEEPYYCHEQIHIPPQFPDILKQFTKAAIRTQPKDVLSWSHAYFRAM
ANGELPPVKERLEMPISTQKTDTGLTPELLKTLNRQLGPKKVIQLEEIEA
RWKDLLIPMELFHEVCKIGNFVVDVEWLKFLSICATTIRANITESLKLLC
EILTADPECGPSRISFELWKMLYTYLVSIDGCISAEHVESVITYLGADVE
RQGGLVQPSNFFHPDCPKVQP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005929cilium
GO:0031514motile cilium
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
Vocabulary: biological process
TermDefinition
GO:0007286spermatid development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 12..53
e-value: 6.8E-11
score: 43.4
NoneNo IPR availablePANTHERPTHR14952FAMILY NOT NAMEDcoord: 1..215
NoneNo IPR availablePANTHERPTHR14952:SF14ROPPORIN-1-LIKE PROTEINcoord: 1..215
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 11..52