Dynein heavy chain

Overview
NameDynein heavy chain
Smed IDSMED30000565
Length (bp)11985
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain (SMED30000565) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain (SMED30000565) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain (SMED30000565) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain (SMED30000565) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000565

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000565SMESG000065732.1 SmedASXL_018493SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000565SMESG000065732.1 dd_Smed_v6_6941_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000565SMESG000033128.1 SMESG000065732.1 dd_Smed_v6_6941_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30000565SMESG000033128.1 SMESG000065732.1 dd_Smed_v6_6941_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal midlineSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30000565SMESG000065732.1 dd_Smed_v4_6941_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 4897.41 bits (12702), Expect = 0.000e+0
Identity = 2409/3964 (60.77%), Postives = 3043/3964 (76.77%), Query Frame = 2
Query:   74 LPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAV-NVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKE--MDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGK-NIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQ-LSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            LPPI           P  +KLLK +R S E ++K+++L+ID A  N+++ +  +   +PP    P YP  M SE +    NY ++K CV++SP+ P+Q++WL ++   I   LK+G+++E  ++ ++ EV  +F +SMKR LVQ  L KP V  LE D+  P PE P+GLD+S  WH S+V+ R ++   L I++P M+ LL L  TTF +T++ D   +  +G +D E+L+T + +     ++ +M  WYPKVIN+F +++++  ++ +  ++FY+C + L+SNQ+K+LL RTVE +V +F+  + + LPI K+ L FD ++M+FYP + DLE+ +  ++  I +++Q + TI S ++    PV +   L  H+L +A + L+++  R  E  +++++   E  Y++L++G    NI  F  E+H+FDEY E+IEKF  +A +I  LP   ++ ++RL+CEDLK GL  +    + ILLN +A  +RKEN  I  +FE I++HA  VPET++E+ DLI+Y+E+AR  G+  L  +I+ SK ++ Y LD   F  EDL LN+ V  W RKI PIFD ND++ E+ K K E  L+ +REKLI E++K   R++EF EF E+  E M+QYV DVR LQ +++E+ + + +IN EEELFK   + +PE++++K   +P+ + F  V+K+Q+SE++W+ G F DL  + +EA+V+E  RE+FK  K F  + KK L EK           +      L   + ++ PK  A + +CS  + QI  FKE IP ++ LC PG++ RHW ++S I   D+TP+SGT+L KVL + L  Y+E+F  ISA AS+EF+LE  M  M   WE + F +++YR++G+ IL+SVD+IQ +LDDQI+KTQTMRGSPFIKPFE EIK WE++L+   ETID+WLKVQAQWLYLEPIF SEDIMQQMPEEGR FQ VDR+W+DIM+   +DP V+ A   +G+LE+L+  N LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+SSE E++++  +ISTS ARGAVE+WL+QV+D+ML S+ DVIAA+R AY   AR +WV EW GQVVLC+SQ++WT E  E +  G EGL  Y+++   Q++EIV+LVRGKL+ Q R TLGALVTIDVHARDVV DM +  V  + DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  +  F+FEGTEL+LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++AR L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLKYP+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP+ADY  FL+   E C  HNLQ V FF EKIIQ+YEMMIVRHGFMLVGEPF  KT+VLHVLA+ ++ +NE G+ E EKVIYRT+NPKSITMGQLFGQFD VSHEWTDGI ANTFREFA ++TPDRKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+PS +GW P+  SWL S    L +     ++  LF W +   L    K CK +IPT + ++V +L  L ++++   +E +  +  +++++W  + ++F++ WSIGG  D D R+ FD F R +I+GK++  P+P  + ++E    E GLVYDY YE K +G W HWN+L KN + G+ +  I++ +VPTMDT RY F++D+ + + + L+FVGPTGTGKSVY +DKLMN L  D+Y P ++N SA+TSANQ Q IIM++LD+RRKGVFGPP+GK  +IF+DDMNMPA E YGAQPPIELLRQ+FD G+WYDLKDT+KI L DI L+ AMGPPGGGRN VTPR +RHFN+ S+ +FSD+TM+RIFS++++ Y++  EF  +Y  +G  +V  T+E+YK ++ NLLPTP KSHY FNLRDFSRVI G  LI+++ V +K T  RL+VHEVLRVFYDRLI D DR WL++L K  IK HFKE+F  +F HL    N PV EE LR+LMFGDYMNPD   +DRVY E+ NI+ F  +V+QC+DEYN THK +M+LVIFRYVLEHLSRICR+L   GGNALLVG+GGSGRQSLTRLA +MA   +FQPEISK+YG  EWRED+K LL+  G +G+ TVFL+TD+QIK+E+FLEDID++LNTGEVPN+F A+EK EV+E VR  AQAGNK  + SPLALFAFFVNRC++ LHVV+AFSPIG AFR RLRQFP+LINCCTIDWFQ+WPEDALERVA+K LE +++ +  + + V I KHFHTS+++LSE F   LGR NYVT TSYLELI SFR LL  K+   M  K+RY+NGLDKLAFA  QV +MQ++L ELQP+L +AK  N  +M  I  ES+  E +R  VK +EEI + KA+ ++AL +EC +DLAEAIPALEAALSALDTL+PADITIVK+M+NPP+GVKLVM  +C+M++IKPE+++DP+  G K+LDYWGPSKKLLGDM FL  L+EYDKDNI   +M KIR E++ NPEFDP KV++ASSAAEGLC+WI+AME YDRVAKVVAPKK +L++A+  L E M  LN+ + +L  VE  L NL+    +  +EK  L+++VELCAKKLERA +LIGGLGGEK RWAQAA +LQ  Y+NL GDVL+SAGVIAYLG FTS +R  C  DWS LCK  KIPCS +F L+  LG+PVKI+AWNI GLP D+FSIDN VIV N RRWPLMIDPQ QANKWIKN EKE  L+VIKL+D+D+MRTLEN IQFG P+LLENVGEELDPSLEPLLL+Q FKQ G+D +RLGE IIEYS +F+ YITTKLRNPHY+PE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LK+ E +IL TLS SEGNILE+E+AI++LDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS++LFFSI DL NIDPMYQYSL+WFVNLYINSIHDSNKSK+L+KRLRYL+DHFTY+LY N+CRSLFEKDKLLFSFLLC+ +L+++ ++E  E +FLLTGGV L++   NP  +WL DKSW+EICR ++   F+G ++ F  ++  WR  YDSK+P +AK P P    L+  + +++LRC+RPDKI PAITNYV +KLGKKF+EPPPFDL +S+ DS C  PLIFVLSPGADP  +LLKFA DK   G+KF +ISLGQGQGPIAA+MI  A  EGTWV LQNCHLAVSWM  +EKICE+ T E  N+ FRLWLTSYPS KFPVT+LQNGVKMTNEPPTGLR NL QS++ D +S+PEFF GC GKE  +EKLLFG+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+NEY+ +PF+AI YLTGECNYGGRVTDDWDRR L+T+L DFYN +++ +  YKFSPSG Y  PPK  Y +YIEFIK LP  Q+PE+FG+HENVDI+++LQ ++ L +S+L+T G    +G   S +Q L EI  DIL K+P+ FD+E A   YPV Y ESMNTVLVQEMERFN L   IR +L++L KAIKG+VVM   LEA++ SLLVGK+P +W+K SYPSLKPLGSYI D + RLNFLQ W+N GKP  FW+SGF+FTQAFLTG MQN+ARKYT PIDLLG++FEV+ +   +  P DG YI GL+LDGARW+ E+  L EQ PK+L++ +P+IW+KP ++  I  + + Y CP+YKTSERKG LSTTGHSTNFV+ + L T++P  HW+KRG ALLCQLDD
Sbjct:   20 LPPIVHLPENIGVDTPTQSKLLK-YRRSKEQQQKINQLVIDGAKRNLDRTLGKRTPLLPP----PDYPQTMTSEMKKKGFNYIYMKQCVESSPLVPIQQEWLDHMLRLIPESLKEGKEREELLESLINEVSSDFENSMKRYLVQSVLVKPPVKSLE-DEGGPLPESPVGLDYSNPWHSSYVQARNQIFSNLHIIHPTMKMLLDLGYTTFADTVLLDFTGIRAKGPIDCESLKTDLSIQTRNAEEKIMNTWYPKVINLFTKKEALEGVKPEKLDAFYSCVSTLMSNQLKDLLRRTVEGFVKLFDPKDQQRLPIFKIELTFDDDKMEFYPTFQDLEDNVLSLVERIAEALQNVQTIPSWLSGTSTPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVE-KYNWLLDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKRQMSYFLDVFLFPQEDLALNATVLMWPRKINPIFDENDELIENAKHKKENELMAKREKLILEIEKESRRMEEFTEFAEL--ERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEK----------RKAARKRSLEEEKIEEEPKDNATITMCSTVMEQIKAFKEYIPTVSILCNPGMRARHWKQISEIVGYDLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDTGVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSETQEVISGGTEGLKKYYKELQNQLNEIVELVRGKLSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYHEFLECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNEHGYGEEEKVIYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVSSWLNSLKGPLCEPEYQALLRGLFAWLIPPSLNQRKKKCKELIPTSNSNVVVSLTRLFEVLLCNVVENDPTS--KHIRVWIMACFIFSLIWSIGGSCDTDGRRVFDTFIRLIILGKDDENPVPDSVGKWECPFDEKGLVYDYMYELKNKGRWVHWNELIKNTNLGDKQIKIQDIIVPTMDTIRYTFLMDLSITYAKPLLFVGPTGTGKSVYVKDKLMNHLEKDQYFPFYINLSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLVDIELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYLRTHEFPPEYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVANKHTMIRLFVHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFHSIFSHLRKQ-NAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPNIHHFSDVVDQCLDEYNQTHKTRMNLVIFRYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMKGLLRNVGMKGQKTVFLITDTQIKEEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVRPVAQAGNKHDELSPLALFAFFVNRCKDNLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQSWPEDALERVAVKFLETLELTEVEQQEIVPICKHFHTSIMDLSERFLHELGRHNYVTATSYLELIGSFRQLLTQKRQAVMEAKQRYMNGLDKLAFAESQVGEMQMELVELQPKLEEAKIENANMMQVIEIESVQVEAKRQFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPSGVKLVMAAVCVMKDIKPEKISDPSGTGGKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVTVMQKIRSEYLMNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLSEAQKSLAETMELLNQKRAELAEVEHHLENLQMTFLEKTEEKAALEDQVELCAKKLERASQLIGGLGGEKSRWAQAADDLQITYENLTGDVLVSAGVIAYLGAFTSGFRQTCTKDWSMLCKKKKIPCSEEFLLSKTLGDPVKIRAWNIAGLPTDTFSIDNGVIVNNCRRWPLMIDPQGQANKWIKNSEKENQLSVIKLSDSDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIEKKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQIAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNKSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPIAAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICEDFTSETCNSSFRLWLTSYPSSKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDWYNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTSDTSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKS-DAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVALLCQLDD 3960          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 4047.66 bits (10496), Expect = 0.000e+0
Identity = 2076/4003 (51.86%), Postives = 2786/4003 (69.60%), Query Frame = 2
Query:   56 SKMPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESD-DLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEG----NAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----NSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLP-NVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFD-HNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSW---LASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIW--FQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFE--------------VMLPETGLVYDYFYEHKVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMK-GQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGN--KDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
             K+P  +     G + S+ K    +K  + FR +      L  +++ Q  +++  + D   +  PKP A          E+ I   YY++   +    + PM++ WL+++ D +  HLK   D  +  +  E+++++  S+++S+V   LK P   G +   D +P     + +   + W  SF+     +   L  + P M  +L L +T F +  + D+   HN + A++  + +  +    +   + ++K+W+P+V NI+   N++K +P  +   K ESF+NC   L++ Q+++L   +++ + D+  +      A   P   M L  D++ ++F P   D  ++   + + + +++  +P +++ +     S  +P  +  ++ N I+   KE+++    +    P E+ + +Y+  Y +LI  + E ++  FL ENHS+++  + I K+Q + ++I+          +  + CE+L   LVK    +   LL ++ +DH++ N  + ++FE I + A + P  + EL ++ AY+++     MI L +++  SK  L +L++   FSP D++LN+ VF W  ++  IF+ H   I+E ++   E + L R E+ + EL+ +  + +EF  FG++    +++Y++  + L  KL  A  ++   N EEE F    S++P+ ++I+   +P+++L++  +++  + R W  G ++ +  D++EA++   +R L+K++K F++                                       P AL +  K  +++ +FK+ IP+I  +C PG++ RHW+ MS+I    + P+  ++++  L M L+ Y++ F  IS AAS+E++LE  M+KM  EW+ VEF +  YRE+G  ILASVD+IQ LLDD I+KTQTMRGSPFIKP+E +++ WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F AVD+ W+DIMR+ ++D +V+       +LERLK+SN LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIAK+EF   LDI  M SSE E +++ ++IST++ARG VE+WL++++ VM+ SI  V   +  AY    R  WV +W GQ VLCVSQI+WT EV  A+  G++ L  Y + CN+QI +IV LVRGKL+ Q R+TLGALV +DVHARDV+  + +K +  ++DF WLSQLRYYW+E +   ++ NA ++Y YEYLGNS RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I R I    +  MFEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS GF+ AR L+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+ENE ILLLRSI+DVNLPKFLSHD+PLF GI SDLFPGV LP+ DY   L A+ + CA  NLQ   FF+EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A++ + E+G  E  KV    +NPKS+TMGQL+GQFD+VSHEW+DG+ A +FR FAS+ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  M+LIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SW   L +   V++K    E +  LF+  V   + F+ K+ K + PT   +LV++L+NLID  M    ++  + E  + + +   +  +LF++ WS+G     D R KF+   REL+    ES    +  N F+              V  PE G +YDY +  +  G W  W   L +     +     E +VPT+DT RY  ++++   H++  +FVGPTGTGKSVY  + L+N+L  + Y P  +NFSAQT+A QTQ I+MSKLD+RRKGVFGPP+GK  V+FVDD+NMPA+E+YGAQPPIELLRQ+ DH NWYDLKD + I L DI +M AMGPPGGGRN VTPR++RHFN++++  FSD +M  IFS +++ +++   +F  ++L +   +V  T+ +YK A+ NLLPTPAKSHY+FNLRDFSRVI G+CL + E  E      RLWVHEVLRV+YDRL++++DR WL   ++E ++ +  E F  LF+ L    +  V+ + LRSLMF D+ +P    ED  Y E+ +++    IVE  ++EYNN  K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQS+TRLAA MA+  VFQ EISK Y   EW EDLK +L+K        VFL TD+QIK+ESFLED+ NLLN GE+PNLF  +EK E+ + +RQ  +  +  K  D SP+ALF  F++ CR +LHVV+A SPIG AFR RLR+FPAL+NCCTIDWFQ+WPEDAL+ VA + LE ++M +++R+  + + K FHTS I+LS+ FF  L R NYVTPTSYLELI++F+ LL  K+ E M+ KKRY  GL+KL  A+ QV+ MQ++LE L PQL  A K  + +M+ I +ES+        VKA+E I NE+A ASKA+ DEC ADLA A+P LE+AL+ALDTL   DIT+VK+M++PPAGVKLVME ICI++ IK +++ DP   GKK+ D+WGP+K+LLGDM FL  L EYDKDNI    M  IRK +I NP+F P K+  AS+AAEGLC+W++AM+SYD+VAK+VAPKKIKLA AE +LK  M  L + Q  L+ V+DKL  L+  L+  + +K  L+ +V+LC+KKLERA++LIGGLGGEK RW+  A+ L  +Y NL GD+L+S+GV+AYLG FTS YR     +W+ LCK   IPCS   SL   LG  V I+ WNI GLP DSFSIDN +I+ NARRWPLMIDPQ+QANKWIKNMEK   L VIKL++ D++RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEY+ +FR YITTKLRNPHYLPE +VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A N+R LKE ED+IL  LS SEGNILE+ETAI+IL SSKA++++I +KQE AEET+KKID  RM Y PIA HS+ILFFS+ DL NI+PMYQYSL+WF+NL+I SI +S KS++L KRL+ L DHFTYSLY NVCRSLFEKDKLLFSF L   +L+ +  +   E+ FLLTGG+GL+N  AN  T WL  KSWDEICRL+DL  FK  +  F    +GW+  YDS +P     P+ W  K + F+ +L++RC+RPDK++P +  ++  +LG+ FIEPPPFDLA++F DS CCAPLIFVLSPGADP  ALLKFA+D+G+GGSK +S+SLGQGQGPIA +M+ +A +EGTWV+LQNCHLA SWM  +EK+CEE++PE+T+ +FR+WLTSYPSP FPV+VLQNGVKMTNE P GLR N+ +S++ D IS+PEFF  C   E  F+KLL+GLCFFHALVQERRKFGP+GWNIPY FN++DLRIS +QL MF+N+YE++P++A+RY+TGECNYGGRVTDDWDRR L +IL+ F+N  ++ ++ YKF  SG Y VPP  ++  YIE+ K LP    PE+FGM+ N DIT++  +++LL D++L+T  +   +G  SS+  ++E+A+DILGK+P +FD+E A   YP TY +SMNTVLVQEM RFNKL   IR+S  N+ KAIKGL VMS +LE + SS+L  KIP MW   SYPSLKPLGSY+ND + RL FLQ+W+  G P  FW+SGF+FTQAFLTG  QN+ARKYTIPIDLLGFD+EV++       P DG +I GLFLDGA WN +  KL E  PK+LY+ VPV+WLKP KR  I    + Y  P+YKTSER+GVLSTTGHSTNFV+ + LP+++P  HW+ RG ALLCQL+
Sbjct:   94 GKLPHQVDDSYVGPSTSKSKGKSPHKERENFRST------LVNVIMQQDADLDSAVPDG--STIPKPTASAI-------EKDILRYYYYIHHGIDTDHVAPMEDSWLEHVLDLVPQHLKVFTDS-IVTLSDEMREDYLLSVRKSIVDFVLKDPREKGDDKKTDELPAHRAEMEI-LPKPWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEFHNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNKKKQLPTGDSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNEIVDAHKEKIKEVIMKESVAPTEHLR-LYD-KYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKL-RCERFVEELESYAKQSEEFYSFGDLQD--VQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDS--------------------------------------PYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPMGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQK----EFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERNDRETYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILRELM----ESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGIGKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKR--EDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYANLCT-WLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEE-FKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPS-YVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 3712.54 bits (9626), Expect = 0.000e+0
Identity = 1939/3796 (51.08%), Postives = 2583/3796 (68.05%), Query Frame = 2
Query:  764 TVQLDCEKHDDNMMKVWYPKVINIFNERKS-----VPKIEQDLK---ESFYNCTTILLSNQIKNLLGRTVEAWVDIF---EEGN---------AKFLPILKMY-LNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----------------NSNP-QPVFIPALLA-------NHILAY--AKERLRS----SATRCFEE----PKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLV-------KNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFE-VMLPETGLVYDYFYEHKVRGYWHHWND-LNKNLSK-GEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEE-MTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL-KTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
             +Q  C +    ++  W P    +F  RK       PK   D     E ++      +S Q++ L+ +++E  V +F   ++GN           F+P L M  L      + F P++D   ELI      I ++   IP +  I                  + P +P    A  A       N +L    A+E+L S       + F++    P +Y  N+Y+  Y  L++   E NI  FL ENH  D++   I   +    +I  +       +  L+   L   L +    L   L+      +R  N  I  ++ +I      VP  ++EL  LI +++++    +  L  ++R +  RL++L+D  +                 +I+ IFD++  +    + + E  L++R  +    L+ +   ++ F +   M +E MK  V+ +  L   L  A  E   IN EEEL +  KS +P ++ +     P+ QL+    ++     +W++G    L A++I  E+  ++R  +K+ K  ++                                       PA   +      +I +FK+ IP+++  C PG+K RHW ++S I   +I P   T L+ +L  G   ++E+   I AAAS+E++LE N+ +M+ +W  V FS   YR++  +IL ++DDIQ LLDD ++KTQTM GSPFIKP E E + WEEKL+   + +D WLK QA WLYLEPIFSSEDI+ QMPEEGR F  VD  WK +M   V+D  ++ AAD   + E+L+E+N LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDPLRVQPHLKKCFEGIAKLEF + L+I  M SSE E +   Q I  + A+G VE+WL QV+ +ML S+R+VI    EAY    R+ WV +W GQVV+CVS I+WT EV +AL      L  + +K N QI++IV+LVRGKL++  R+TLGAL  IDVHARDVV  +   RV   NDF W+SQLRYYW  ++  V++      Y YEYLGNS RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTETTKDLAKALA QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIE+EVLSVVAQQIL I +AI   ++TF+FEGTEL LN  C V ITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+IGEISLYS GF+D+RSLA KIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+ENE++LLLR+++DVNL KFL+ D+PLF+GIISDLFPGVVLP+ DY +FLK + +   K  LQ V +F  KIIQ YEMM+VRHG+M+VG+P GGKT    VLA A+  L+     E   V Y+ INPK+ITMGQL+G FD VSHEW DG+ AN FRE AS+ + DRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+  MSLIFE  DL QASPATVSRCGMIY++P  +GW+P+  S++ + P  L K++  E+++ +F W V  CL F   +CK V+ T  IHL         +LL+ I  + +  +E  +   ++ + +W Q  +LF++ W++ G ++ DSR+KFDVFFR LI+G +++ P PK +   +  + PE G +YD+++  +  G+W  W   + K   K   G  + E ++PTM+TAR  F +   ++H   ++FVGPTGTGKS  T + L++ LP + Y+P+ +NFSA+TSANQTQ IIMSKLDRRRKG+FGPPIGK AV+FVDD+NMPAKE+YGAQPPIELLRQ+ DHG W+D KDTT++ + D+ L+ AMGPPGGGRND+T RF RH N++S+  F DD + +IFS+++  +  G+ F   +L  G+ +VQAT  +Y+ A+ N LPTP+KSHYVFNLRDFSRVI G+ L     ++D     RLW+HEV RVFYDRLI+  DR+  + ++KE+    FK+T + +  HL  +P   + ++++RSL FGDY  P++  + ++Y+E+ ++ +   ++E  ++E+NN  K  MSLV+FR+ +EH+SRICR+L    G+ LLVG+GGSGRQS  +L+  M    ++Q EI+KNY   +WREDLK ++ + G   K+TVFL  D+QIKDESF+EDI+ LLNTG+VPN+F A+EK +++E ++ AA+   +  + +PL+++ FF+ R   K+   +A SPIG AFR RLR FP+LINCCTIDWFQ+WP DALE VA K LE V+++D++R + V + K+F  SV  LS +++  L R NYVTPTSYLELI +F+TLLNSK+ E    + RY+ GL KL FAA QV+ MQ +L  LQPQL+   +    +MV I  E+  A+ ++L V+A+E+  N  A  ++ + +EC  DLAEA+PALEAAL+ALDTL PADI++VK+MQNPP  VKLVME ICIM+ +KPER  DP+  GK + DYWG SKK+LGD+ FL  L+ YDKDNI    M +IR+ FI +PEF P  +   SSA EGLC+W+ AME YDRVAKVVAPK+ +L +AE  L   M KLN+ + +L+ V D+L  L    ++   +K  L+E +E+C++KL RA+KLI GLGGEKDRW +AA  L   Y NL GDVLLS+G +AYLG FT  YR +C   W A CK   IP    FSL+  LG+P+KI+AW I GLP DSFSIDN +IV+N+RRW LMIDP  QANKWIKNMEK   L VIK +D+++MR LENA+Q G PVL+EN+GEELD S+EP+LLK  FKQ GV+ +RLGE+IIEYS++F+LYITT+LRNPHYLPE+AVKV LLNFMIT  GL+DQLLGIV AKEKPELE+ + +LI+ SA N++ LKE ED+IL  LS S+GNILE+ETAI++L SSK +S++I +KQ+ A  T+ +ID  RM Y P+A HSA +FF I+DL NI+PMYQYSL+WF+NLY++S+  S KS+ L+ R++Y+ DHFT S+Y+NVCRSLFEKDKLLFS LL   I+  K ++    + FLLTGG+ L+N   NPA  WLS+K+W EI R + L +  G  E    NL  W+  YDS  P + ++P  W       + +++LRC+RPDK+VPA+  ++ E +GK +IE P FDL  S+ DS CCAPLIFVLSP ADP   LLKFA+D G GG++  +ISLGQGQGPIAA+MI+ A ++GTWV+LQNCHLA SWM  +EKICEE + PE+TN  FRLWLTSYPS KFPV++LQNG+KMTNEPP GLR NL +S++ND IS+P FF  C  K   ++K+LFGLCFFHA+VQERR FGP+GWNIPY FN+SDLRIS  Q+QMF+N+Y++VPFDA+ YLTGECNYGGRVTDD DRR L+++L  FY + +  D  Y  +P  TY +PP   Y  YI++++ LP   +PEVFG+HEN DIT++ Q++  L + VL+TL + +   G S +  + E+A DIL K+P  FDLE+    YPV Y ESMNTVL QE+ RFN+L+  +R SL NL +AIKG V+MS ELE + +S+LVGK+PAMW+  SYPSLKPLG Y+ DL+ RL F Q+W ++G P  FW+SGFYFTQ+FLTGV QN+ARKYTIPID +GF+FEV  + + M   P DGAYI GLFL+GARW+ +TM++GE  PK+LY+ +P+IWLKP +   +   ++ Y CPVYKTS R+G LSTTGHSTN+VL + LPT+ P  HW+ RG A LCQLD+
Sbjct:  388 VIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEMKFFIPQLIMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYL-NVYK-KYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLP--------------YQIEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLSD--------------------------------------VPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAENT--LLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDTLPSSLTKEHK-ELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRAVEEEEMELGEGLSSQQIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMGMDDNHPRPKSVKLTKNNIFPERGSIYDFYFIKQASGHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKSAITNNFLLH-LPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHF-GKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHL--SPTGKIVDDNIRSLFFGDYFKPES--DQKIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQGEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSWKFS-QGLEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSC-AKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIEEDY-YSLAPGDTYYIPPHGSYQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPQETVMENNPEDGAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGE-SAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 2976.04 bits (7714), Expect = 0.000e+0
Identity = 1602/3551 (45.11%), Postives = 2243/3551 (63.17%), Query Frame = 2
Query: 1439 LECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDY-LLDN--HEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEE---GHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKI---------WFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHK-VRGY--------------WHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIV-LQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDY----------LAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVA---LKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMG-FLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTY-IVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL--KTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            +  +++K  L K+   L+  +L+ +A++  KE   I E+F +I +     P + +EL +L  +M+    + ++GL E+I   K+  DY ++D   +  S +D         W  KI    +   +     + K   I +  +     +L+  ++ V  F+   E+      +   +VR ++ +LK+ +Q     N  E +F +P + + ++  +  +  P++ L+     + +    W++   + + A+++E  V E ++ + K  KQF +                                       PA  E+      +I EFK  IP+I  L  PG++ RHW+ +S+  N ++ P +  + A+ L M L  ++E  ++++  A +E+ +E  + KM +EW T+ F++  Y+ +   IL S D+  QLLDD IV TQ M  SP+ KPFE  I  WE KL  T E +++WL  Q  WLYLEPIFSSEDI QQ+P E + +Q ++R WK IM+N   +  V+       +L+ L++ N +L+ + KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDP  VQPHL+KCFE IA+L F   L+I  M+S+E E++++   I  S     VE WL +V+  M  S+ D+I  +  AY    R +WV  W GQV +   Q YWT+EV EALE G     ++ + C +Q+S++V LVRGKL+  QR  L AL+ I+VHA+DVV  + ++ V S NDF W+SQLRYYW   +  +R  NA   Y YEYLGNSGRLVITPLTDRCY TL GA HL   GAP GPAGTGKTETTKDL KALA+Q VVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  I +A Q  VE FMFEG E+ L  +C V ITMNPGYAGR+ELPDNLK LFRPVAMMVPDYAMI EISLYS+GF +A  LA KI TT++L SEQLSSQ HYD+GMRAVK V+SAAGNLK + P  NE ++ LR+I DVN+PKFL  D+ LF GI+SDLFP +     DY +  +A+ E C   NL+ V+ F  K IQ YE  +VRHG MLVG    GK+    VLA AM+ L  +       +E V Y  +NPKSITMGQL+G+FD ++HEWTDGI ++  R  A     ++KW +FDGP+D +WIE+MNTVLDDNKKLCL SGEII++++ M+++FE  DL+ ASPATVSRCGM+YL+PS +G  P    WL   P +LK     E    LF   + E + FV  + K VI + + +L  +LL L+D   KP L +E + +  + K+         WF    +F++ WS+G   D   R  F  + R           +  E  +  ++ PE GLV+DY  E   + G               W  W D +   +     N    +VPTMDT +   ++DM + +++ ++ +GPTGTGK++   DKL+  L  D Y+  F+ FSA+TSANQTQ  I SKLD+RRKGVFGPP+G+  + F+DD+NMPA E YGAQPPIELLRQ+ DHG WYD K       L DI  + AMGPPGGGRN VTPR +RHFN +S     + +  RIFST++  ++ G      Y              + +V+AT+ VY T  S LLPTPAKSHY FNLRD S+V  G+ +    +VED+    RLW HE  RVF DRL+ + DR W  +LLK  +     E ++V F  +   P +P+        ++GD+M+P +  + + YE + + ++   ++E+ +++YN  +  K+ LV+F   + H+ RI R L    GNALL+GVGGSGR SLTRLA+ MA    FQ E+SKNYG  EWR+D+K +L KAG +     FL +D+QIK+ESFLEDI+N+LN+G++PNL+TA+E+ +++  +R   Q   +    +   L A +  R R  +H+V+  SPIG  FR RLRQFP+L+NCCTIDWF  WP +AL+ VA   L  +  ++   +     +++  + H SV     E+   L R NYVTP SYLEL++ F  L+  K+ E    K R  +GLDKL   +E V+ MQ  LE + P L +A K   L M  I  ++ +AE+ R  V+ EE   NEKA  ++A++D+ + DL EA+PAL+AAL++L  L   D+T V+ MQ PP GVKLV+E +CIM+ IKP++V     PG K+ DYW P K LL D G FL  L ++DKDNI   ++  I+  +I N EF P  +++ S A   +C+W+ AM  Y  VAK V PK+  L +A+ DL      L+E +++L+ VED +  ++ K ++   +K  L+ + E C ++L RA KLI GL  EK RW +   NLQ + +N+ GDVL++AG +AYLGPFT  YR      W    +S+ +P + + +L   LGNPVKI++W I GLP D+ S++N VI   ++RW   IDPQ+QANKWIKNMEK+ GL+V KL+D DF+R++ENAI+FG P LLENVGEELDP+LEP+LLKQ +KQ G  +L+LG+++I Y ++FR+YITTKL NPHY PEI+ K++L+NF ++  GLEDQLLG VVA+E+P+LE+A+ +LII++A  R+ LK+ ED+IL  LS SEGN +++   I++L++SK  + +I  K   AE+T+K ID  RM+Y P+A  + ILFF ++DL N+DPMYQYSL WF+N++++ I +S ++  L KR+  ++ + TYSLYSNVCRSLFEK KL+F+FLLC +I+M++G +  +E+ +LL+GG  +     NPA  WLSD++W +I  L++L  F  F   F  +L  +R  +DS +P    +P  W   LD F+ LLVLRC+R DK+  A+ ++V   L  +FIEP   +L+  F+DS    PLIFVLSPG DP   L KFAE+  F   K ++ISLGQGQGP A  M+  +   G WV  QNCHLA SWM A+E++ E + P+  + +FRLWLTS PS KFPV++LQNG KMT EPP G+R NL +S+ +  + E +F N C  K   F+ LL  LC FH    ERRKFGP+G+NIPY F D DLRI   QL+MF++EY+ +P+  ++Y  GE NYGGRVTDDWDRRC+M IL+DFYN  V +  ++ +S SG Y  +PP  +   Y+ +IK+LP    PE+FG+H+N +IT    ++  LL +++    + +S+G    E  + ++  +IL K+P   +L+     YPV Y ESMNTVLVQE+ R+N+L   I ++LQ+LLKA+KGLVVMS +LE MA+SL    +P +WS  +YPSLKPL S++ DL++RL+FLQ W  +G P+ FW+SGF+F QAFLTG +QNFARK+ I ID + FDF+V+    S +  +P  G YI GLFL+GARW+ E  +L E +PK LY  + VIWL P   +  +  ++ Y CP+YKT  R G LSTTGHSTN+V+ V +PT +P  HW+KRG AL+C LD
Sbjct:  808 INTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMK-GIPERLVGLEERI--VKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISR--AHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKD--------------------------------------MPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVQLCFSIYPS---SNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLC-QQLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLKPYE--EHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRIVELIEPWF----IFSLIWSVGATGDSSGRTSFSHWLR-----------LKMENEQLTLLFPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALD-YISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLLKRCM-----EQWEVTFNKV--CPFQPI--------LYGDFMSPGS--DVKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQ--EQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPG-EKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQP-YIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGG-SISIMTENPAPDWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKF-SKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSS--LGE-DFLNSC-HKVMEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDV-LSPEHSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTP-NRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALICALD 4264          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 2611.64 bits (6768), Expect = 0.000e+0
Identity = 1316/2329 (56.50%), Postives = 1693/2329 (72.69%), Query Frame = 2
Query:   74 LPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAV-NVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKE--MDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCV----NECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWF---QSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGK-NIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLL 7027
            LPPI           P  +KLLK +R S E ++K+++L+ID A  N+++ +  +   +PP    P YP  M SE +    NY ++K CV++SP+ P+Q++WL ++   I   LK+G+++E  ++ ++ EV  +F +SMKR LVQ  L KP V  LE D+  P PE P+GLD+S  WH S+V+ R ++   L I++P M+ LL L  TTF +T++ D   +  +G +D E+L+T + +     ++ +M  WYPKVIN+F +++++  ++ +  ++FY+C + L+SNQ+K+LL RTVE +V +F+  + + LPI K+ L FD ++M+FYP + DLE+ +  ++  I +++Q + TI S ++    PV +   L  H+L +A + L+++  R  E  +++++   E  Y++L++G    NI  F  E+H+FDEY E+IEKF  +A +I  LP   ++ ++RL+CEDLK GL  +    + ILLN +A  +RKEN  I  +FE I++HA  VPET++E+ DLI+Y+E+AR  G+  L  +I+ SK ++ Y LD   F  EDL LN+ V  W RKI PIFD ND++ E+ K K E  L+ +REKLI E++K   R++EF EF E+  E M+QYV DVR LQ +++E+ + + +IN EEELFK   + +PE++++K   +P+ + F  V+K+Q+SE++W+ G F DL  + +EA+V+E  RE+FK  K F  + KK L EK                               AA +   +      E K+   +  C     ++ RHW ++S I   D+TP+SGT+L KVL + L  Y+E+F  ISA AS+EF+LE  M  M   WE + F +++YR++G+ IL+SVD+IQ +LDDQI+KTQTMRGSPFIKPFE EIK WE++L+   ETID+WLKVQAQWLYLEPIF SEDIMQQMPEEGR FQ VDR+W+DIM+   +DP V+ A   +G+LE+L+  N LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+SSE E++++  +ISTS ARGAVE+WL+QV+D+ML S+ DVIAA+R AY   AR +WV EW GQVVLC+SQ++WT E  E +  G EGL  Y+++   Q++EIV+LVRGKL+ Q R TLGALVTIDVHARDVV DM +  V  + DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  +  F+FEGTEL+LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++AR L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLKYP+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP+ADY  FL+   E C  HNLQ V FF EKIIQ+YEMMIVRHGFMLVGEPF  KT+VLHVLA+ ++ +NE G+ E EKVIYRT+NPKSITMGQLFGQFD VSHEWTDGI ANTFREFA ++TPDRKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+PS +GW P+  SWL S    L +     ++  LF W +    N+ +     N         I     L  LI   +  + +   +        +F   Q+ ++F++ WSIGG  D D R+ FD F R +I+GK++  P+P  + ++E    E GLVYDY YE K +G W HWN+L KN + G+ +  I++ +VPTMDT RY F++D+ + + + L+FVGPTGTGKSVY +DKLMN L  D+Y P ++N SA+TSANQ Q IIM++LD+RRKGVFGPP+GK  +IF+DDMNMPA E YGAQPPIELLRQ+FD G+WYDLKDT+KI L DI L+ AMGPPGGGRN VTPR +RHFN+ S+ +FSD+TM+RIFS++++ Y++  EF  +Y  +G  +V  T+E+YK ++ NLLPTP KSHY FNLRDFSRVI G  LI+++ V +K T  RL+VHEVLRVFYDRLI D DR WL++L K  IK HFKE+F  +F HL    N PV EE LR+LMFGDYMNPD   +DRVY E+ NI+ F  +V+QC+DEYN THK +M+LVIFRYVLEHLSRICR+L   GGNALLVG+GGSGRQSLTRLA +MA   +FQPEISK+YG  EWRED+K+ +
Sbjct:   20 LPPIVHLPENIGVDTPTQSKLLK-YRRSKEQQQKINQLVIDGAKRNLDRTLGKRTPLLPP----PDYPQTMTSEMKKKGFNYIYMKQCVESSPLVPIQQEWLDHMLRLIPESLKEGKEREELLESLINEVSSDFENSMKRYLVQSVLVKPPVKSLE-DEGGPLPESPVGLDYSNPWHSSYVQARNQIFSNLHIIHPTMKMLLDLGYTTFADTVLLDFTGIRAKGPIDCESLKTDLSIQTRNAEEKIMNTWYPKVINLFTKKEALEGVKPEKLDAFYSCVSTLMSNQLKDLLRRTVEGFVKLFDPKDQQRLPIFKIELTFDDDKMEFYPTFQDLEDNVLSLVERIAEALQNVQTIPSWLSGTSTPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVE-KYNWLLDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKRQMSYFLDVFLFPQEDLALNATVLMWPRKINPIFDENDELIENAKHKKENELMAKREKLILEIEKESRRMEEFTEFAEL--ERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEK-----------------------------RKAARKRSLEEEKIEEEPKDNATITMC----RMRARHWKQISEIVGYDLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDTGVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSETQEVISGGTEGLKKYYKELQNQLNEIVELVRGKLSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYHEFLECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNEHGYGEEEKVIYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVSSWLNSLKGPLCEPEYQALLRGLFAWLIPPSLNQRVELFQLNYLYTTIVSKI-----LKILITFRISNYFKYVPLKTQCTFIKFFLHQQACFIFSLIWSIGGSCDTDGRRVFDTFIRLIILGKDDENPVPDSVGKWECPFDEKGLVYDYMYELKNKGRWVHWNELIKNTNLGDKQIKIQDIIVPTMDTIRYTFLMDLSITYAKPLLFVGPTGTGKSVYVKDKLMNHLEKDQYFPFYINLSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLVDIELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYLRTHEFPPEYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVANKHTMIRLFVHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFHSIFSHLRKQ-NAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPNIHHFSDVVDQCLDEYNQTHKTRMNLVIFRYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMKSFI 2300          

HSP 2 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 504/789 (63.88%), Postives = 623/789 (78.96%), Query Frame = 2
Query: 9587 NSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQ-LSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            N I D NKSK+L+KRLRYL+DHFTY+LY N+CRSLFEKDKLLFSFLLC+ +L+++ ++E  E +FLLTGGV L++   NP  +WL DKSW+EICR ++   F+G ++ F  ++  WR  YDSK+P +AK P P    L+  + +++LRC+RPDKI PAITNYV +KLGKKF+EPPPFDL +S+ DS C  PLIFVLSPGADP  +LLKFA DK   G+KF +ISLGQGQGPIAA+MI  A  EGTWV LQNCHLAVSWM  +EKICE+ T E  N+ FRLWLTSYPS KFPVT+LQNGVKMTNEPPTGLR NL QS++ D +S+PEFF GC GKE  +EKLLFG+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+NEY+ +PF+AI YLTGECNYGGRVTDDWDRR L+T+L DFYN +++ +  YKFSPSG Y  PPK  Y +YIEFIK LP  Q+PE+FG+HENVDI+++LQ ++ L +S+L+T G    +G   S +Q L EI  DIL K+P+ FD+E A   YPV Y ESMNTVLVQEMERFN L   IR +L++L KAIKG+VVM   LEA++ SLLVGK+P +W+K SYPSLKPLGSYI D + RLNFLQ W+N GKP  FW+SGF+FTQAFLTG MQN+ARKYT PIDLLG++FEV+ +   +  P DG YI GL+LDGARW+ E+  L EQ PK+L++ +P+IW+KP ++  I  + + Y CP+YKTSERKG LSTTGHSTNFV+ + L T++P  HW+KRG ALLCQLDD
Sbjct: 2306 NRIVD-NKSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPIAAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICEDFTSETCNSSFRLWLTSYPSSKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDWYNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTSDTSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKS-DAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVALLCQLDD 3092          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 905/3276 (27.63%), Postives = 1576/3276 (48.11%), Query Frame = 2
Query: 2399 IHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPN---SGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFS-SEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSG---ILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNK-LDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAY------CFEARD--EWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENA------LVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQ-GHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLK---------LKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVD-------FFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKL-NEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASN---DTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLA------------------SKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEK------------------------EDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIR-------EFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSF-VNFSAQTSANQTQQIIMSKLD------RRRKGVFGPPI--GKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGG-GRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGIC-LIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKN-----INEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDM--------------------EDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDE---CRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLT--DNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLD--KRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGG----VGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESF------SANLEGWRAFYDSKDPQDAKMPDPWGT---KLD----SFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCA--PLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQG-PIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVN---------EYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDD------FYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVL-ITLGQLTXXXXXXXE------NQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMER----FNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQK--WFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGAR 11677
            +H + +   ++A L    +K+RHW +M     +++  N   S  +L +V    +  +     +I   A  E  LE  +++MRE W+  E  L  Y ++   ++   DD+   L +       M+ SP+ K FE   + W+EKL       D W+ VQ +W+YLE +FS S +I   +P E   F  +  +   +M+     P ++   +  G   +LERL +   +L KI K L  YLE++R  FPRF+F+ ++++LEI+  +KD  R+Q HLKK F GI  ++ + +   I A  S E EK+ + +++ST + R  +  WL  ++  M  ++   +AAS   +           D  EW+ ++  QV+   ++I+W  E+ + L  G +G     +   K +  +   V  +    +R  + AL+T  VH RD    +   ++ + NDF WL  +R+Y++ +        +V++ N+   Y +EYLG   RLV TPLTDRCY T+  A H  L G+P GPAGTGKTE+ K L   L    +VFNC +  D+ AMG+   GL   GAW CFDEFNR+E  +LS V+QQI  I  A++ G   +    G  L +N N  + ITMNPGY+GRS LPDNLK LFR +AM  PD  +I ++ L+S GF  A +LA KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+K             D  E  +L++S+ +  +PK ++ DI L   ++SD+FPG+           + +  VC +H L   D        + +K++Q Y++  + HG MLVG    GKT    VL +A+ +  N EG       +   I+ K+++   L+G  D  + EWTDG+  +  R+   N   +   R+W+IFDG +D  W+E++N+VLDDNK L L +GE + +   + +IFE  DL  A+ ATVSRCGM++     +    +F  +L+                  S P  L  ++      I  +      L+    +  G++P GS+   K  ++ ++ IM P  ++                        +D  E   ++ +   + L  + W+  G   + SR+    F R+                   + LP         YE ++ G W  W      LSK     I        + +VPT+DT R++ ++   +   + L+  GP G+GK++     L+  L + + +    VNFS+ T    T ++++   D      R   GV   P+   +  VIF D++N+PA + YG Q  I  LRQ  +   +Y   D + + L+ I  +GA  PP   GR+ +T RFLRH  +V +      ++ +I+ T     +K    T     +   +  A ++VY  A         + HYV++ R+ +R + GI   I   +        RLW HE +R+F DRL+ + +REW  KL+  + +++F     +         +E +K    R L++  +++ + +P  R  EE+++     +  FY   E+ +D         + LV+F  +L+H+ RI RI     G+ LL+G  G+G+ +L+R  A +    VFQ ++   Y   ++ ED++T+L++AG   +   F+M +S + D  FLE ++ LL  GEVP LF  +E   ++  +++ AQ      D S   L+ +F  +    LHVV   +P GS  R R    PAL N C ++WF  W E+AL +V  +    +D+                    +   R+  V  +   H +V   +E   K   R    TP  +L+ I  F +L + K+ +    K     GL+K++   EQV ++Q  L+    +L + K+A  L + ++  +   AE+++   K  E++  E A+  K ++++      DLA+  PA+  A +A+  ++ + +  VK+M +PP  VKL +E ICI+              G+ +   W   ++++    F+T + ++D + ++  I+ ++ K +I NP+++  KV+RAS A   + +W  A   Y  +   V P + +L + E +  +   +      ++  +E+ +   K++      +   +++++    +K+ R+ +L+  L  E+DRW+  +       D+L+GD LLS+  +AY G +  + RD+    W     +  +      +    L        W +  LP D    +N++++    R+PL+IDP  QA ++I  M++  G N+ K +  D  F + LE+A++FG  +L+++V E  DP L P+L ++V +  G  ++ +G+  I+ S  F++++ T+     + P+I  +V+ +NF +T   L  Q L  V+  E+P+++  R +L+         L+  E  +LA L+ES+G IL++ + I+ L+  K  + ++ +K    ++   ++DA    Y  ++   + ++ ++  L  I  +Y YSL + V ++ + +     S   D  KRLR ++     +++  V R +   DK+L + LL    + S     + E  F L  G    V   ++A +     L   + +    +   ++  GF+  F      SA +  W     + D  ++ +P  W     KL     +   L+V+  +RPD+++ +    V       F++        S  D++     P++   + G D +  +   A +      +  SI++G  +G   A   +  A + G WV+L+N HLA SW+  +EK    M P   + +FRL+LT+   PK P ++L+    +  EP TGL+ NL +S  +     P+     P + S   +L   +C+ HALVQER ++ P+GW+  Y F+D+DLR++   L   V+         E E++P+  +R L  +C YGG++ + +D+  L  +L++      F  +HV++    K+    +   P   +  + I +++ L + Q P   G+  N +     +    +L ++L +T  +L  +  G  E       QL E+A   L  +P        EI       E++   L +  ER     ++L   IR  L  +    +     + E  A+A+SL  G++P  W +Y+ P    +  ++ DL ERL  L +    +  K  TFW+ G +  +A++T   Q  A+  T  ++ L     + +T   +V       I+G+ + GA+
Sbjct: 1357 LHTYGKMNMLVAELKSEALKERHWHQMM----KEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADG-KGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEG-------VAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQ-THFSPDGIVP-GSL---KYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATT----------------ISLPPNQQACLIDYEVQLSGDWQPW------LSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTM----TLLAALRSQQEMEVVNVNFSSST----TPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLK---MTPAVRGLADQLTNAMVDVY-LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRL---------DEALK----RPLLYSCWLSRNYVPVTR--EELQDYVSARLKGFY---EEELD---------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILD-SHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEK---KFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILL-------------GENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEK-YIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYI--MKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWL----TNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET---NRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSS---IPPQRLTKAPTERS---RLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIP---KYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLP-------KEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDV-----FRISGIDIRGAK 4496          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 905/3276 (27.63%), Postives = 1576/3276 (48.11%), Query Frame = 2
Query: 2399 IHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPN---SGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFS-SEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSG---ILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNK-LDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAY------CFEARD--EWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENA------LVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQ-GHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLK---------LKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVD-------FFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKL-NEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASN---DTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLA------------------SKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEK------------------------EDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIR-------EFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSF-VNFSAQTSANQTQQIIMSKLD------RRRKGVFGPPI--GKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGG-GRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGIC-LIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKN-----INEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDM--------------------EDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDE---CRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLT--DNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLD--KRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGG----VGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESF------SANLEGWRAFYDSKDPQDAKMPDPWGT---KLD----SFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCA--PLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQG-PIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVN---------EYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDD------FYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVL-ITLGQLTXXXXXXXE------NQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMER----FNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQK--WFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGAR 11677
            +H + +   ++A L    +K+RHW +M     +++  N   S  +L +V    +  +     +I   A  E  LE  +++MRE W+  E  L  Y ++   ++   DD+   L +       M+ SP+ K FE   + W+EKL       D W+ VQ +W+YLE +FS S +I   +P E   F  +  +   +M+     P ++   +  G   +LERL +   +L KI K L  YLE++R  FPRF+F+ ++++LEI+  +KD  R+Q HLKK F GI  ++ + +   I A  S E EK+ + +++ST + R  +  WL  ++  M  ++   +AAS   +           D  EW+ ++  QV+   ++I+W  E+ + L  G +G     +   K +  +   V  +    +R  + AL+T  VH RD    +   ++ + NDF WL  +R+Y++ +        +V++ N+   Y +EYLG   RLV TPLTDRCY T+  A H  L G+P GPAGTGKTE+ K L   L    +VFNC +  D+ AMG+   GL   GAW CFDEFNR+E  +LS V+QQI  I  A++ G   +    G  L +N N  + ITMNPGY+GRS LPDNLK LFR +AM  PD  +I ++ L+S GF  A +LA KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+K             D  E  +L++S+ +  +PK ++ DI L   ++SD+FPG+           + +  VC +H L   D        + +K++Q Y++  + HG MLVG    GKT    VL +A+ +  N EG       +   I+ K+++   L+G  D  + EWTDG+  +  R+   N   +   R+W+IFDG +D  W+E++N+VLDDNK L L +GE + +   + +IFE  DL  A+ ATVSRCGM++     +    +F  +L+                  S P  L  ++      I  +      L+    +  G++P GS+   K  ++ ++ IM P  ++                        +D  E   ++ +   + L  + W+  G   + SR+    F R+                   + LP         YE ++ G W  W      LSK     I        + +VPT+DT R++ ++   +   + L+  GP G+GK++     L+  L + + +    VNFS+ T    T ++++   D      R   GV   P+   +  VIF D++N+PA + YG Q  I  LRQ  +   +Y   D + + L+ I  +GA  PP   GR+ +T RFLRH  +V +      ++ +I+ T     +K    T     +   +  A ++VY  A         + HYV++ R+ +R + GI   I   +        RLW HE +R+F DRL+ + +REW  KL+  + +++F     +         +E +K    R L++  +++ + +P  R  EE+++     +  FY   E+ +D         + LV+F  +L+H+ RI RI     G+ LL+G  G+G+ +L+R  A +    VFQ ++   Y   ++ ED++T+L++AG   +   F+M +S + D  FLE ++ LL  GEVP LF  +E   ++  +++ AQ      D S   L+ +F  +    LHVV   +P GS  R R    PAL N C ++WF  W E+AL +V  +    +D+                    +   R+  V  +   H +V   +E   K   R    TP  +L+ I  F +L + K+ +    K     GL+K++   EQV ++Q  L+    +L + K+A  L + ++  +   AE+++   K  E++  E A+  K ++++      DLA+  PA+  A +A+  ++ + +  VK+M +PP  VKL +E ICI+              G+ +   W   ++++    F+T + ++D + ++  I+ ++ K +I NP+++  KV+RAS A   + +W  A   Y  +   V P + +L + E +  +   +      ++  +E+ +   K++      +   +++++    +K+ R+ +L+  L  E+DRW+  +       D+L+GD LLS+  +AY G +  + RD+    W     +  +      +    L        W +  LP D    +N++++    R+PL+IDP  QA ++I  M++  G N+ K +  D  F + LE+A++FG  +L+++V E  DP L P+L ++V +  G  ++ +G+  I+ S  F++++ T+     + P+I  +V+ +NF +T   L  Q L  V+  E+P+++  R +L+         L+  E  +LA L+ES+G IL++ + I+ L+  K  + ++ +K    ++   ++DA    Y  ++   + ++ ++  L  I  +Y YSL + V ++ + +     S   D  KRLR ++     +++  V R +   DK+L + LL    + S     + E  F L  G    V   ++A +     L   + +    +   ++  GF+  F      SA +  W     + D  ++ +P  W     KL     +   L+V+  +RPD+++ +    V       F++        S  D++     P++   + G D +  +   A +      +  SI++G  +G   A   +  A + G WV+L+N HLA SW+  +EK    M P   + +FRL+LT+   PK P ++L+    +  EP TGL+ NL +S  +     P+     P + S   +L   +C+ HALVQER ++ P+GW+  Y F+D+DLR++   L   V+         E E++P+  +R L  +C YGG++ + +D+  L  +L++      F  +HV++    K+    +   P   +  + I +++ L + Q P   G+  N +     +    +L ++L +T  +L  +  G  E       QL E+A   L  +P        EI       E++   L +  ER     ++L   IR  L  +    +     + E  A+A+SL  G++P  W +Y+ P    +  ++ DL ERL  L +    +  K  TFW+ G +  +A++T   Q  A+  T  ++ L     + +T   +V       I+G+ + GA+
Sbjct: 1357 LHTYGKMNMLVAELKSEALKERHWHQMM----KEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADG-KGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEG-------VAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQ-THFSPDGIVP-GSL---KYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATT----------------ISLPPNQQACLIDYEVQLSGDWQPW------LSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTM----TLLAALRSQQEMEVVNVNFSSST----TPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLK---MTPAVRGLADQLTNAMVDVY-LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRL---------DEALK----RPLLYSCWLSRNYVPVTR--EELQDYVSARLKGFY---EEELD---------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILD-SHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEK---KFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILL-------------GENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEK-YIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYI--MKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWL----TNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET---NRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSS---IPPQRLTKAPTERS---RLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIP---KYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLP-------KEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDV-----FRISGIDIRGAK 4496          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1172.15 bits (3031), Expect = 0.000e+0
Identity = 905/3274 (27.64%), Postives = 1575/3274 (48.11%), Query Frame = 2
Query: 2399 IHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPN-SGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFS-SEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSG---ILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNK-LDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAY------CFEARD--EWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEEN------ALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQ-GHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLK---------LKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVD-------FFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKL-NEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASN---DTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLA------------------SKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEK------------------------EDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIR-------EFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSF-VNFSAQTSANQTQQIIMSKLD------RRRKGVFGPPI--GKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGG-GRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGIC-LIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKN-----INEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDM--------------------EDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDE---CRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLT--DNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLD--KRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGG----VGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESF------SANLEGWRAFYDSKDPQDAKMPDPWGT---KLD----SFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCA--PLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQG-PIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVN---------EYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDD------FYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVL-ITLGQLTXXXXXXXE------NQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMER----FNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQK--WFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGAR 11677
            +H + +   ++A L    +K+RHW +M  +    +  N S  +L +V    +  +     +I   A  E  LE  +++MRE W+  E  L  Y ++   ++   DD+   L +       M+ SP+ K FE   + W+EKL       D W+ VQ +W+YLE +FS S +I   +P E   F  +  +   +M+     P ++   +  G   +LERL +   +L KI K L  YLE++R  FPRF+F+ ++++LEI+  +KD  R+Q HLKK F GI  ++ + +   I A  S E EK+ + +++ST + R  +  WL  ++  M  ++   +AAS   +           D  EW+ ++  QV+   ++I+W  E+ + L  G +G     +   K +  +   V  +    +R  + AL+T  VH RD    +   ++ + NDF WL  +R+Y++ +        +V++ N+   Y +EYLG   RLV TPLTDRCY T+  A H  L G+P GPAGTGKTE+ K L   L    +VFNC +  D+ AMG+   GL   GAW CFDEFNR+E  +LS V+QQI  I  A++ G   +    G  L +N N  + ITMNPGY+GRS LPDNLK LFR +AM  PD  +I ++ L+S GF  A +LA KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+K             D  E  +L++S+ +  +PK ++ DI L   ++SD+FPG+           + +  VC +H L   D        + +K++Q Y++  + HG MLVG    GKT    VL +A+ +  N EG       +   I+ K+++   L+G  D  + EWTDG+  +  R+   N   +   R+W+IFDG +D  W+E++N+VLDDNK L L +GE + +   + +IFE  DL  A+ ATVSRCGM++     +    +F  +L+                  S P  L  ++      I  +      L+    +  G++P GS+   K  ++ ++ IM P  ++                        +D  E   ++ +   + L  + W+  G   + SR+    F R+                   + LP         YE ++ G W  W      LSK     I        + +VPT+DT R++ ++   +   + L+  GP G+GK++     L+  L + + +    VNFS+ T    T ++++   D      R   GV   P+   +  VIF D++N+PA + YG Q  I  LRQ  +   +Y   D + + L+ I  +GA  PP   GR+ +T RFLRH  +V +      ++ +I+ T     +K    T     +   +  A ++VY  A         + HYV++ R+ +R + GI   I   +        RLW HE +R+F DRL+ + +REW  KL+  + +++F     +         +E +K    R L++  +++ + +P  R  EE+++     +  FY   E+ +D         + LV+F  +L+H+ RI RI     G+ LL+G  G+G+ +L+R  A +    VFQ ++   Y   ++ ED++T+L++AG   +   F+M +S + D  FLE ++ LL  GEVP LF  +E   ++  +++ AQ      D S   L+ +F  +    LHVV   +P GS  R R    PAL N C ++WF  W E+AL +V  +    +D+                    +   R+  V  +   H +V   +E   K   R    TP  +L+ I  F +L + K+ +    K     GL+K++   EQV ++Q  L+    +L + K+A  L + ++  +   AE+++   K  E++  E A+  K ++++      DLA+  PA+  A +A+  ++ + +  VK+M +PP  VKL +E ICI+              G+ +   W   ++++    F+T + ++D + ++  I+ ++ K +I NP+++  KV+RAS A   + +W  A   Y  +   V P + +L + E +  +   +      ++  +E+ +   K++      +   +++++    +K+ R+ +L+  L  E+DRW+  +       D+L+GD LLS+  +AY G +  + RD+    W     +  +      +    L        W +  LP D    +N++++    R+PL+IDP  QA ++I  M++  G N+ K +  D  F + LE+A++FG  +L+++V E  DP L P+L ++V +  G  ++ +G+  I+ S  F++++ T+     + P+I  +V+ +NF +T   L  Q L  V+  E+P+++  R +L+         L+  E  +LA L+ES+G IL++ + I+ L+  K  + ++ +K    ++   ++DA    Y  ++   + ++ ++  L  I  +Y YSL + V ++ + +     S   D  KRLR ++     +++  V R +   DK+L + LL    + S     + E  F L  G    V   ++A +     L   + +    +   ++  GF+  F      SA +  W     + D  ++ +P  W     KL     +   L+V+  +RPD+++ +    V       F++        S  D++     P++   + G D +  +   A +      +  SI++G  +G   A   +  A + G WV+L+N HLA SW+  +EK    M P   + +FRL+LT+   PK P ++L+    +  EP TGL+ NL +S  +     P+     P + S   +L   +C+ HALVQER ++ P+GW+  Y F+D+DLR++   L   V+         E E++P+  +R L  +C YGG++ + +D+  L  +L++      F  +HV++    K+    +   P   +  + I +++ L + Q P   G+  N +     +    +L ++L +T  +L  +  G  E       QL E+A   L  +P        EI       E++   L +  ER     ++L   IR  L  +    +     + E  A+A+SL  G++P  W +Y+ P    +  ++ DL ERL  L +    +  K  TFW+ G +  +A++T   Q  A+  T  ++ L     + +T   +V       I+G+ + GA+
Sbjct:  425 LHTYGKMNMLVAELKSEALKERHWHQM--MKEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY-QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADG-KGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEG-------VAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQ-THFSPDGIVP-GSL---KYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLIDDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATT----------------ISLPPNQQACLIDYEVQLSGDWQPW------LSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTM----TLLAALRSQQEMEVVNVNFSSST----TPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLK---MTPAVRGLADQLTNAMVDVY-LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRL---------DEALK----RPLLYSCWLSRNYVPVTR--EELQDYVSARLKGFY---EEELD---------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILD-SHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEK---KFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILL-------------GENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEK-YIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYI--MKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQHNSAAVTSWL----TNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET---NRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSS---IPPQRLTKAPTERS---RLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIP---KYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLP-------KEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDV-----FRISGIDIRGAK 3564          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 973 bits (2514), Expect = 0.000e+0
Identity = 863/3222 (26.78%), Postives = 1525/3222 (47.33%), Query Frame = 2
Query: 2384 KTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKV-------LAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESG---ISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLD-IHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQ-QRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNP---GYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFV-SKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKG--EGKNIREFLVPTMDTARYKFIIDMCVE--HRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMS---KLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPG-GGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFST-LMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKH-------FKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRL---KVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDY-WGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNP-EFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWI-KNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLY---INSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANP-ATSWLSDKSWDEICRLNDLKEFKGFKESFSANLE-----GWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDD-FYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFI-KALPSIQNPEVFGMHENVDITRELQDSRLLLDSV-LITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLS--NAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIP----AMWSKYSYPSLKPLGSYINDLIERLNFLQKWFN-------EGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQ--PNDGAYIAGLFLDGARWNS---ETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLST 11845
            + +  +  FKE    +       +   HW +M     R +    GT++ K+       ++  +    ++  Q+++ A  E  +   ++++       EF+L  Y+ S    + I+    +    L D     Q+++ SP+   F  +  +WE +L      + Q  ++Q +W+YLEPIF        +P E   F  VD  ++ I+ +  +D  ++       + + L++    L +  K LN +LE+KR  FPRF+F+ +D++LEIL ++ +P  +Q H+KK F+GI +++F +  + I +M SSE E + +S+ +        VE WL ++ D M  +++D+ A +      +A+   + ++  QV LC+++    ++   ++E  + G +  +   ++ + ++      K++ +   + L +L+   +H  DVV+ +   + +S N + W  QLR+Y      ++R  ++  +Y YEY GN  +LV TPLTD+CY TL  A ++ L G P GPAGTGKTE+ K LA  +  Q +VFNC +G+D  +MG+ F G+   GAW CFDEFNR++  VLS V+ QI  I  AI+    +  F G  +++N N  + +T+NP   GY GR ++PDNLK LFR V M  PD  +I    LYS GF+DA +LA KIV+ ++L  + LS Q HYD+G+RA+K VL   G L+    ++NE  L++++++   L K    D   F  +I D+F  V      +   ++ +G    +  ++  D   EK+ Q YE M  R G ++VG    GK+ +  +L  ++           + +     NPK++   +L G  D  + EW+DGI     RE  + DT    W++ DG ID  W+E++N+VLDDN+ L + SGE IQ    ++ +FET  L  ASPATVSR GMIY+    +  + +  SWL    E L  D     M    E     CL++V S    G+    S  ++KN L         HL K    + + L + F        P         ++RQ+    F + ++ +  S P PK I                 Y+ ++ G   + +D+++N++K   E +++R F V T DT RY  II   ++  +R+S +  G TG GK    +    N+ P  +    +   SAQ+S++   Q+I     +       V+ P      ++F+  +N+PA + YG    + LL+Q   +  ++D  +   + +++I  +G+M P G G    ++ R       VS+ T     +  I+ T L  I  +  E  S+ +A         +++Y    SN  PT +   ++F+ RD +  +  + L++ E   D+     +   E  R+F DRL  ++D+    ++L+  I          FKE   V     T  P E      L  +   D+    A   +R   E+ N N   P+  Q              L  F       + I R+L  PGG+  L G  G GR+   RL A M N  VF P ++ N+  +++  +LK  + +A    +  V ++ D Q++   FL+ I++LL +G VP LFT +E   ++ LV +AA      A F+  AL  F  +R R  +HVV+      + F+  + + PA++  C + +      D  +R +L  +  + ME      T  I+  F+  ++NL E           + P  Y + + +F  LL  K+       +R   G+ KL  A ++V+ MQ K  +    L + +   +  +  I+     AEDQ+L   ++KA  E  N + +  KA  DE    L E  P ++ A  A+ +++   ++ +++++ PP  V+ +++ + +   I               LD  W   +K L   G    +  +D + I+  I  K+          F+     RAS+AA  L  W+ A   Y ++ + +AP + +  +   +LK+   ++    K LQ V++ +  LK+K +    E  +++ +++     +  A  L+  L GE +RW             +    L+++  I YLG  +   R   L    ++CK + +P + K    A L    +   W   GLP D  S++N  I+  +   PL+ID   Q + ++ K +EK       K    D M  +E AI+FG  ++++++  E D +L P+L K +  Q    ++  G   I+++ +F++Y  T+       P   V+++++NF  T+  L  QLL + +  EKPELE+    L+  +   +  L+  E  +L  L+ S+GN+LEN   +  L+ SK  ++ I K    +E+  K++   +  Y P++  ++ LFFS ++L   +PMY YS++  ++L+   I S  D + +     R+  L+     +++ ++ R +F +D+L+F+    +  +      +  E   L TG +  E+   +     W+S        RL  L   +    S   N +      W  F  +   ++A  P     K+  F+ +L ++ ++P+++   + ++V + L    I PP F+L   FQ+S+   P++F+L+ GADP+  L +FA         ++SIS+GQGQ   A + I E+  +G W+ L N HL +  + ++ K     TP      FRLWLT+    +FP  +LQ  +K+T EPP G+R NL +++     S       C          +F L + HAL+QERR F P GW   Y F  SD+R++   ++       +  ++ +R +     YGGR+ +D+D + L + L+  F +E +   A  +       +    ++  EYI  I K++PS+  P +FG+ EN+  + ++ ++   + S+  + LG  T +      +++S+I + +  K+  S DL K E+   +   + ++ VL   +E  N LS    +  S+ ++ K++K   + S  ++    SL+  + P    +MW+  S P+      Y+N ++++     + F           P  F  S  ++   FL  + Q  +R+  IP+D L     +L ++    Q        + GL L GA ++S   ET           Y   P+++L        + T  + + PVY +SER  ++ +
Sbjct: 1143 RLMKDVEHFKEVSSALKFCRGDVLSADHWHEMF----RFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGR----GALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGETIISMVSSEGETVPLSKAVRIVPQ---VESWLQELSDEMRRTLKDLTAQA----VADAQPS-LAKYPSQV-LCLAE---EVKFSASIENNLNGSSDLNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNGGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTK-------KPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAARE-VTKDTSVHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHAD-----MPSWIEEHFWRCLKWVRSHKISGIT---SFAILKNGLT--------HL-KASKTKTQFLVLLFNGFLPTVTP---------ENRQE----FAKGVVFQGMSVPDPKNI----------------CYDERIDGIMSYTDDVSQNVTKEEVEREDLRPF-VQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQND-PESQLASLYC--SAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFD-HNLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGERNSEIIA------NRMVDIYNKVQSNFRPTDSVV-FLFSPRDLTNWV--VSLLRHEL--DQGKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQANETVIFKE--KVYVTTGTVVPGESNTGLPLTPINMSDFNQLLAKSINRFAFEIANFN--CPLTSQ--------------LAFF------CACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAA----NQASFTG-ALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIF-----ADRFDRNSLVEIPKIQMESQGITTTDAILTGFNDVLVNLPEHL--------SIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDE---QLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGI---------------LDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLL---KSMCKMFNMPPTFKPLSFASL--ETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLEKS---ETFKAAQPDLMTQIELAIRFGKTIIIDDI-VEFDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSST-----RVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKEWE---LFTGVLVDESTDLSALRVQWISPD------RLQSLARIRTHLPSLFNNFQIQDDATWNEFSKTLQCENA-FPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNV---PYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLSLTTPHEN---FRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVIT-CQS--------IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQLT--ANKADWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQ--EYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGD-TKNALSDQSDKISQIVS-LWKKLCQSDDLPKRELPTAIRSADPISEVLC--LETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPA-----DYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSRQIKIPLDQL-----ILSSAWTPSQLPAKQCVQVQGLLLQGATFDSFLRETT-----VSSAAYSQAPIVFLAWTSESSSTITGEQIQVPVYSSSERSDLICS 4150          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 211.46 bits (537), Expect = 7.217e-54
Identity = 124/332 (37.35%), Postives = 206/332 (62.05%), Query Frame = 2
Query: 7544 TPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRW 8539
            T    L+++++   L   K++E  +   +Y  G++K+  A EQV+ MQ +L  LQPQLV+      +LM  I +E+I  E+ R  V A E   NE A  +++L  E  A+LA AIPALE+A+ AL+T+  +D++ +KTM+ PP  V+L ME +CI+  +KP ++   N  G+ + DYW   +KLL D+ FL  +R + +D +S   +  IR+++++  EFDP  V + S AAEGLCRW+LA++ Y++++K+V PK+ +L +AE  +K+++ +L   +K L  V +KL  L  +      +K  L+ ++  C  ++ERA++L+  L GEKD+W
Sbjct: 2096 TRAEKLKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKIT--NEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKW 2425          

HSP 2 Score: 136.732 bits (343), Expect = 3.392e-31
Identity = 120/517 (23.21%), Postives = 235/517 (45.45%), Query Frame = 2
Query: 2405 EFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILE-RLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARD-EWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAV 3949
            EF++ +PV+  +    +K RHW  +   +   +       ++++L M      ++F Q+ A A +E  LE +++KM+ +W T  F   V  + G  +   +      +   + ++QT+  SP        I+ W + LL+    +  + +   +W  +E +FS+EDI  QMP E R F+ +   W  I      +  +++  D    L   L E   L  ++  G +AYL KKR  FPR F LS++ +L ++ ++++P   + ++   F  +   + + K++I ++ S++ E I + + ++ + ++  VE+W+ ++   +  ++R  I    E   ++    E +     QV     +I +T ++  ++++    L I   +    I +    V  K +  +   L  L  I   +  +V  +  ++V   +D+ W SQLRYYW  EN  +R+   + +Y YE  G    ++   L D   +  I   H   NG   G       +    L K  A+
Sbjct:  687 EFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATF---VTHQGGELLTTEL---NVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILNEPIQVAAVYLKIAFTWQMENSMKQN--SLTILASELKICIRDCQHAVLHKHDRWE--FLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWHLENVFIRVGTVSTRYDYEVQGVDC-MIDNQLVDEAVKYFICMNHFGFNGFVNGMDVNLARQIAGALGKPFAI 1191          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 3559.23 bits (9228), Expect = 0.000e+0
Identity = 1915/3987 (48.03%), Postives = 2610/3987 (65.46%), Query Frame = 2
Query:  167 RKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDL---VPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDN----MMKVWYPKVINIF---NERKSVPKIEQ-DLKESFYNCTTILLSNQIKNLLGRTVEAWVD-IFEEGNAKFLPILKMYLNF-DSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSN---PQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYG----EYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFD-HNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALE--RGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQS--AWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFP--------IPKEI------NRFEVMLPETGLVYDYFYEHKVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNK--DADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLR----LQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAK-MPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVI-MDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLIT------LGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQ----PNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPT--EEPVSHWVKRGTALLCQL 11944
            R+KL +L++    + + ++  Q C VP       +P     EER I   YY++K  +    + P+ +K L+ I D +   L K +   ++E + EV+ ++  +MK+++V   L+   +  L  + +       E       +  W   + +NR  L K L  ++  +  +L L +  + +  + D   L   E      +L T V L C  H DN    + + WY ++ +     ++R  +P I +  L + F+NC   L++ Q++++  R+++ + D I + G++   P  ++ +   D + +QF P++  ++  +  +I+ I  S+Q +P I+S + ++    + +F+   +   I+   K R+ +        P+   ++    P+  LING +   +  F+  + +F++Y     EY EK   IA+++  +  + ++   R +     + L ++   L   LL R+  D +     + ++++ I + A TVP+ + EL  L AY+  A    +  +  +++ +   + +L+D+  +SP ++K NS  F W  K+  IF+ H   I E V    E +L +R E    ELQ +  +V  ++ +G  D + + +Y +    L  +L +A + +  IN EE  +    S +P  ++   Q  P+  LF     +      W+H +      D+I+ +V   YR + K+ KQ  +                                       P  +++      QI  F+E +P+I  L  PG+K RHW+ +S I    I  +   +L K++   LD Y+ +F  IS +A++E  LE  M KM  EWE VEFS++ YR+SG   LA+VDDIQ LLDDQI+KTQTM+ SP+IKPFE +I  WE KL+   E +D+WL+VQA W+YLEPIFSS DI QQMPEEGR F AVD+ WK++M+   +DP VM       + ++LK++  LLE I KGLNAYLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQ HLKKCFEGIA L F  +LD+ AM SSE E++ +  VISTS+ARG VE+WLL+++  M  S+   ++ +  +Y    R  WV  W GQ V  +S  YWTLE+ E  E     E LA Y +KC  QI++IV LVRG LN Q RITLGALV +DVHARDV+ ++   +VE   DF WL QLRYYWE+ N   R+ N ++ Y YEYLGN+ RLV+TPLTDRCYRTL  A +L+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL I R I     T +FEGT L L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYA+I EI LYSYGF+ A+ L+VKIV TYRLCSEQLS+Q HYDYGMRAVK+VL AAG LKL+Y DENE+IL+LRSI DVNLPKFL+ DIPLF+GI SDLFPG VLP+ADY LF K     C + N Q   F  EK+ Q YEM++VRHG MLVG PFGGKT    VLAEA+  + +    E  K IY  INPK+ITMGQL+GQFDAVSHEW+DGI A  +R FA +D+PDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +L+FE MDL  ASPATVSRCGMIYL+PSS+GW P+  SW  + P      +  +++ +L        L  + K+ K + PT   +L+ +L+N  +  +    +++ VA   +L    Q+   +LF+  WS+GG LD DSR+KF++ FR L+    ++FP        +P+++        F   +P+ G V+DY Y  + +G W  W +D+N          + + ++ T ++ R   ++D+   H + +M VGPTGTGKSVY  D ++ ++    Y P  ++FSAQTSANQTQ IIMSKLD+RRKGVFGPP+    VIFVDD++MP KE YGAQPPIELLR   DH  WYD K+   + L D+ ++ AMGPP  G N VTPRF R FNV+S+  F++D +  IFS ++  ++  + F+ ++      +V ATL +Y  A  NLLPTPAKSHY+FNLRDFSRVI G+ L   E  ED  +  RLWVHEVLRV+ DRL+ED+DR WL++ +  ++K  F      LF  L    ++ ++E   R L++ D+ NP A  + + Y EV+++ E   +VE  + EYNN  K  M+LV+FR+ +EHLSRICRI+  P  +ALL+GVGGSGRQSLTRLA+ + +  +FQ EI++ YG  E+ ED+K +L+K G      VFL TD QIKDESFLEDI NLLN+GEVPNLFT EEK EV E + Q  +  +K    D SP+ALF FFV  C+++LH+V+A SPIG A R R+R+FP+++NCCTIDWFQ+WPEDAL  V+ + L + D+    R   + +   FHTS   LS +FF  L R NYVTPTSYLELI +F+ LL+ K++     + RY+ G+ +L  AA+QV+ MQ +L  L+P+L +A +     +  ++ +S LAE+QR  VK +E    E+A  ++ + DEC A L EA+P LE+AL+AL+TL  ADI +VKTM++PP GV++VME +CI++++KP++V +P+  G  + DYWGPSK++L DM FL  L  +DKDNI   +M K+ +  ++N  FDP K+  AS+A EGLCRW++A+  YD VAK+VAPKK+ LA+AE+     M  LNE    L  VE  L  +++ L    DE+LR    L  E E C KKL+RA++LI GLGGE+ RW++ A  LQA + ++ GDVL+S+GV++YLGPFT  +R   +  W   C ++ + C+  F L   LG PV+I+ WNI GLP D+FSI++++++ NARRWPLMIDPQ QANKWIKN EK   L VI+L   D+ R +ENAIQFG PVLLEN+GEELDP LE +L K +FKQ G   ++LG+S+IEY+  FR Y+TTKLRNPHYLPE+AVKV+LLNFMIT +GL+DQLLGI VA+E+P+LE  +  LI+  A+N+RMLKETED+IL  LS +E NILE+ETA+QIL S+KA+++DI +KQ   E T+K+ID AR+ Y PIA HS ILFF+I +L NIDPMYQYSL WFVNLY++SI ++ K   +  RL  L +HFTYSLY N+CRSLFE+DKLLFS +L   ++     +++ E++FLLTGGVGLEN   NP T+WL  ++WDE+CRL +L  FKG +E F+ N   W+ F+DSK PQD K +P  W  ++  F+ LL+LR  RPDK+VPA+ N+V  +LG++F++PP FDL  SF DS CC PLIF+L+PG+DPT  LLKFAED+GFG ++  S+SLGQGQGPIA +MI E  + G WV+LQNCHLA S+M  +EKICE + P+ T+ +FRLWLTSYP+  FPV VLQNG+KMTNEPP GLR N+ +S ++D IS+PE++  C  +   F++L++ LCFFHA++QERR FGP+GWNIPY FN++DLRIS  QL+MF+N+YE V +DA+RYLTGECNYGGRVTDDWDRR L TILD FY   VI ++  Y    +G Y VP   E   Y+ F + LP I  P +FG H N DI ++ +++ +LL   L+T            S   + E  ++ +A DIL K+P  FD + A + YP  Y++SMNTVLVQEM RFN L N IR SL  L K IKGLVVMS  +EA+  S+L+ KIPAMW+  SYPSLKPLGSY+ D + RL FLQ WF+ G PSTFW+SGF+FTQAFLTG  QN+ARKY I IDLL FD+EVL       Q    P DG ++ G+FL+GARW+     L E +P+ L++ +P+IWLKP KR  +    N Y CP+YKT+ER+GVLSTTGHSTNFV+ + L      PVSHW+ RGTALLCQL
Sbjct:  118 RRKLVELILHMDDDQDPELAAQ-CAVP-------FPD---QEEREILRYYYYIKHGIDTIHVSPLSKKILKRITDLVPPLLYKWQ-TALNENIAEVRADYVFAMKKAVVDFVLRHTVLDRLTKEGVGGKYDTAERREVQSMTNFWRYRYDENRNVLMKTLFCIHRSVASILELWSMKYKDKSLIDSKELAKVESPF---SLFTFVYL-CGSHIDNGKTLLEESWYGEIHSSLLKASKRGQLPDIRRFTLVKRFFNCVAALMTQQLEDICIRSLKEYADFICDYGHSN--PGFEISVMLADEDTIQFNPSFSKVQSELLRVIDSIMLSIQMLPRIESKLYTDLIVSKKIFLTPTVPESIVQETKNRICAMLEEQRIGPELRLQDFD--PFIDLINGSDAERVGNFMESDATFEQYADMVYEYKEKEDRIAKEVWAVIRMGFYEFHRDKFITHLESLCRQ---LQLDLLARMVTDQQARITRLGKEYDAIAKKALTVPKDTAELMQLKAYVVHAEENLVPEMEARLKVNMSEILWLMDHTLYSPLEIKNNSNSFQWYLKLPSIFEQHRAIIAEKVIEYQE-LLKKRIELFRRELQNYYEQVQTYDTWG--DIKQLSRYKKRAGVLDQRLVQAMETIDQINEEETSYGWDLSQYPMRKKAHDQLKPYKTLFDAGQDFMDKWDLWMHSQVGSFDPDEIDGDVSNFYRIIQKLDKQMGDH--------------------------------------PITMQLIQDVKAQIEAFREHMPIINTLGNPGMKARHWELVSEIIGFPIKVSPELTLEKIIEYQLDEYVPKFEAISESATKENNLERAMAKMVNEWEGVEFSISPYRDSGTFKLAAVDDIQILLDDQIIKTQTMKSSPYIKPFEADIIKWEAKLMLLQEILDEWLRVQATWMYLEPIFSSPDIQQQMPEEGRRFSAVDKIWKELMKQVSQDPKVMVVVQIDKMNDKLKKAYSLLEVIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQIHLKKCFEGIATLNFTEELDVTAMRSSEREEVTLVDVISTSKARGQVEKWLLELEIDMKKSVHHKVSEAFYSYLKMLRHVWVLTWPGQCVQSISLTYWTLEITECFESEEPKENLAKYLQKCVLQINKIVDLVRGDLNTQNRITLGALVVLDVHARDVLAEIVANQVEDLQDFQWLCQLRYYWEDNNLDTRMINCSLPYGYEYLGNTPRLVVTPLTDRCYRTLFAALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRGINSGSPTLVFEGTTLTLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEIELYSYGFLTAKPLSVKIVATYRLCSEQLSTQCHYDYGMRAVKSVLKAAGALKLRYRDENEDILVLRSIKDVNLPKFLNQDIPLFQGITSDLFPGTVLPEADYVLFNKCTQMACERQNKQCTPFVLEKVQQLYEMIVVRHGLMLVGYPFGGKTTTYRVLAEALECMEKTDGSE-NKAIYTVINPKAITMGQLYGQFDAVSHEWSDGILAVNYRIFAISDSPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSNTTNLVFEPMDLEVASPATVSRCGMIYLEPSSLGWEPLVASWKNTLPAAFHTVSK-QLISMLISRFCPILLFILRKSLKEIAPTSDANLMVSLMNFFECFIDDFRDEKYVANVSDLDFRAQTEGIFLFSCIWSLGGSLDADSREKFNIIFRALM---EKTFPQSLYDTYGVPEDLYVESLAKPFIFPIPKQGSVFDYRYIKEGKGKWKPWQDDVNSAPPIPRDIPVNQIIIQTNESVRIGAVLDLLNRHGKPIMLVGPTGTGKSVYVIDYMLKKMDLSFYKPLLISFSAQTSANQTQDIIMSKLDKRRKGVFGPPLNSRFVIFVDDVSMPLKENYGAQPPIELLRMMLDHMMWYDRKNIVPMKLIDLQMIVAMGPPSTG-NTVTPRFQRFFNVISIDDFNNDILNTIFSKIVLWHLDTRGFSKEFDPCIDEIVGATLTIYNDAKLNLLPTPAKSHYLFNLRDFSRVIQGVLLSVPEATEDVNSMRRLWVHEVLRVYGDRLVEDADRSWLFENICSTVKSCFNTDPSRLFGRLVEK-DKSLQESDFRQLIYCDFTNPKA--DTKNYVEVQDLEELRRVVEAYLVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQPRSHALLIGVGGSGRQSLTRLASHICDYELFQVEITRLYGPYEYHEDIKAILRKIGASEMHGVFLFTDVQIKDESFLEDISNLLNSGEVPNLFTNEEKIEVQEKMAQIDKQRDKAVQTDGSPVALFNFFVTTCKDQLHIVLAMSPIGDALRNRIRKFPSIVNCCTIDWFQSWPEDALLAVSTRFLASEDLTALERRTAIDMCMEFHTSTQELSAKFFSRLHRYNYVTPTSYLELIQTFKALLSQKRNNITNNRNRYLTGISQLDIAAQQVAVMQEQLIALEPKLKEASEIVAEQVAKVTADSKLAEEQREIVKLDESAAKEQAAVAQEIKDECDAKLGEALPILESALAALNTLTTADIAVVKTMKSPPIGVRIVMEAVCILKDVKPDKVPNPSGLG-TVEDYWGPSKRVLSDMKFLDSLLNFDKDNIPVEVMKKLAQRILSNEAFDPDKIKSASTACEGLCRWVIALTKYDVVAKIVAPKKLALAEAEATYNAAMKTLNEKLAMLAKVEANLAAIQKIL----DEQLRQYGILLAEHEACTKKLQRAQELISGLGGERTRWSETAKMLQASFKSVTGDVLISSGVVSYLGPFTIDFRVDQIRKWVTKCLNFGVTCTADFQLAVVLGEPVEIRFWNICGLPTDAFSIESAIMMKNARRWPLMIDPQGQANKWIKNYEKNNKLCVIRLNQADYTRVMENAIQFGLPVLLENIGEELDPVLESVLQKTLFKQGGALCIKLGDSVIEYNHSFRFYMTTKLRNPHYLPEVAVKVTLLNFMITTQGLQDQLLGITVARERPDLEAEKNNLIVQGADNKRMLKETEDQILEVLSSAE-NILEDETAVQILSSAKALANDISEKQVITEATEKQIDIARLSYVPIAEHSTILFFTIVELANIDPMYQYSLVWFVNLYMSSIDNTEKVDDIAARLLDLRNHFTYSLYVNICRSLFERDKLLFSLILNINMMKHDNRIDNAEWMFLLTGGVGLENPYKNP-TTWLGVQNWDELCRLTNLTNFKGLREDFNENSAQWKPFFDSKSPQDNKDIPKSWDNRVSVFQKLLLLRVFRPDKLVPAVLNFVSGELGERFVDPPQFDLMASFADSHCCVPLIFILTPGSDPTATLLKFAEDQGFGTNRLFSLSLGQGQGPIAMKMIDEGVKMGNWVVLQNCHLAASFMPLLEKICENLLPDATHPDFRLWLTSYPADHFPVVVLQNGIKMTNEPPKGLRSNILRSMISDPISDPEWYESC-TQPRIFKQLIYSLCFFHAVIQERRYFGPIGWNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGRVTDDWDRRTLKTILDKFYCPAVIDLETPYYLDETGLYYVPVFKEVDLYLNFTRDLPQISAPAIFGFHANADIMKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILDKLPKLFDRDAALLKYPTLYHQSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGLVVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHWFDHGAPSTFWLSGFFFTQAFLTGAQQNYARKYVISIDLLAFDYEVLTVEEPQRQGLSGPEDGVFVYGIFLEGARWDRTGKYLAESRPRELFDTMPLIWLKPLKRVDLPERHN-YLCPMYKTAERRGVLSTTGHSTNFVVAMLLLCNPNTPVSHWIIRGTALLCQL 4022          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 3526.49 bits (9143), Expect = 0.000e+0
Identity = 1845/4000 (46.12%), Postives = 2607/4000 (65.18%), Query Frame = 2
Query:  110 DKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYY--FLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDL-VPFPEEPIGLDFSQEWHPSFVKNREELSKKLMIL-----------YPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFD--SNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAK------------------ERLRSSATRCFEEPKEY---FKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEG----LAIYHEKCNKQISEIVKLVRG-KLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLN---EEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFE-HLTTTPNEPV-KEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDM-EDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFI-KALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQL---TXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKR-DVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            D +P     L KFR+S+ + ++ ++ L  +A +V+ ++  Q     P+P           + RL+  ++Y   L+  V+   +PPM  +    I    S  LK    + +   + +V + F   MK   ++  L+ P     +     +P P+         + + +F++NR  +++KL+IL              + KL  + N       +     L    A+ ++     +Q   +K +  +   WYPK++ +  +      +     +  +N    L++ ++ N+  RT E    +    + + +P+++M L +   S+ +   PN              I ++  +I T  S++    +P+         + AYAK                  +++++   R ++E  +Y   F++ Y   YS+    +E   + +FL+E H F+EY   I+ +    Q ++  P  EYF +  +  E    GL      L   +   + ++H K  ++I ++FE I+  A  +P++++EL +   YM   +   +  L+++I+        +++  E S     L  +   WI+ I  I D+N   QE  K   E  L +  +KL S++ +   ++   ++    D +    Y+  ++    +LK     ++WIN EE+LFK+  + +P+++ IK    PF +L +  +++Q+    W  G F  L+   +E   D+  +E  K QK +  + K+ L++      + + +       P               L +C+  +  I +F   + ++  +C P ++KRHW +MS IA  D+TP++GT+L K+L  GLD  +++F  IS  A++E  L   ++ M +EWET  F    Y+E+G+ IL+S+DDIQ LLDD I+KT  MRGS F+KP E E++ W EK++   ET+DQW KVQA +LYL PIFSS+DI+ QMPEEGRLF  V++ +   M   +R P VM+ A  SG+LE L+++N LLE I  G++ YLEKKRL+FPRFFFL+NDEMLEILSETKDPLRV PHL KCFEGI  LEFD   ++ AM SS+ E I+  + +ST+ A G+VE+WL+ V+D ML ++R     S   Y    R EWV EW    VL +SQ+YW   VH  L R   G    +  + ++ +K++++IV LVR  K++   RIT+ +L+ IDVHA+DV ED+ + +V SE DF WL+Q+RYYWE++   VR+ NATV +A EYLGNS RLVITPLTDRCYRTL+GAY L+LNGAPEGPAGTGKTETTKDLAKALAVQC VFNCSDGLDY AMGKFFKGLAS GAWACFDEFNRIELEVLSVVAQQIL II+A++ +   FMFEGTEL LN  CYVCITMNPGYAGRSELPDNLKVLFR VAMMVPDYAMIGEISLYSYGF+DAR LAVKIVTTYRLCSEQLSSQ+HYDYGMRAVK VLSA GN+K +YPDE E+ILLLRS++DVNLPKFLS D+PLF GIISD+FPG+ LP  DY+L       VC +  L+    F  K+IQ+YEM+IVRHGFMLVGEP  GK++ L VLA+ +S L     +  + F+ V    +NPKSITM QL+G FD +S+EWTDG+ A  FR+FA   TPDRKWVIFDGP+D +WIE+MNTVLDDNKKLCL SGE+I MS  MS++FE MDL+QASPATVSRCGMIY++PS++GWR    SWL         + G+  +  L +W +  C  FV + C   I  G  + +    +L DM +   +E+      + L+ +FQ+A LFA+ W +GG+LD  SR+KFDVF ++L    +   P P+ + + E+  P  GL+ DY + +K RG W +W DL K +   E K     +VPT+DTARY  ++ M VEH++ ++ VGPTGTGK+VY Q+ LMN+L  + +   F+ F+   SANQ Q +++SKL + ++G++GPP G  +V+FVDDMNMP KE+YGAQPP+ELLRQ+FD+G+ YDLKD++K+ + ++ +M A G PGG R DV  RFL HFNV S+ TFSDD+M RIF  +     +      D   V   +V AT  +YK+  S +  TP+KSHY+FNLRD SRV+ G  L++KE V DK+ + R+W HE +RVFYDRL++D DR+W++  L E +K +FK+  + +FE +    P+E V   E   +++FG Y + D++P++R YEEV ++  F  +    +D+YN+T +NKM + +F + L+HL+RICRI+   G +AL++G+GGSGRQSLT+LA  M     FQPEI+KNYG  +W +D+K +LK+AGG  K T FL+T++QIK E FL+DID LLN GEVPN+F  +EK EV+E+VR AAQ GN++ D S L +F+FFV+RC++KLH++++FSPIG A RTR+R +P+L+NCCTIDW+ +WPE+AL+ +A  +L  V++  +D++   +   ++FHT+    +  F +  GR  Y T  S++ELI SF+TL+  KQ ETM  K RY+ GLD LA AA  +S MQ  L  LQP+LV   +++  +M++I++E++ A     +VK +EE+ + +A+A++ L  +C  DLA+AIP LE AL+AL+TL+PADIT+VK+M+NPP  +KLVM  +C+++ I PER+ DP + GK + DYWGPSK+LLG+M FL  L+E+DKDNI T I+ +I KEFI N +FDP  V++ASSAA+GLC+WI+AM  YD VAKVVAPKK KLA AE +  + M  L + +     +E+K+  L  +L     E  + +E  E C  KL RA+ LIGGLGGEK RW +AA +LQ +YD+L GDVL+S G+IAYL      YR +C+ DW       KIPCS  +S+T  LG  V IQ W + GLP D FS +N++I AN+ R+ L IDPQ QAN W+KNME++  LN +K   +++M+ +  A+++G PV++ENV EEL+  L+P+L++Q F Q G+  + LGES++  +  FRLY+T  LRNPH+LPE   KV+++NF +T   L DQLL IVVAKE+P+L++ R  L   +A N+  L++ E+ IL TLS + G+ILENE AIQIL  SK +S DI++KQE A+ET  KI+A R++Y P+A HS+IL++SITDLPNIDPMYQ+SL+W++NLY+ SI  +NKSK L +R+++L D FT +LY+NVCRS+FEKDKLL+SF+L ++IL+  G +E   +  L+T      N   NP  +W+++  W  + RL +LKE +G  + F ++L  W+A YD   P+   +P PW  K  +F+ ++VL+ +RPD +  A+  ++ E +G +++ PP FD+++S+ DS    PL+F+LSPGADP  +LL FAE  G     F SISLGQGQGPIA  +I  A+  G WV LQNCHLA SWM  +E + E M   NT   FR+WLT+YP+P+FPVT+LQNGVKMTNEPPTGL++NL +S+ ++ I++ EF+ GC  ++  F +LL+G+CFFHA+VQERRK+GP+GWNI YGFN+SDL+IS  QL M +N+Y+ VP+DAI YLT ECNYGGRVTD+WDRR ++TIL DF N   + D +Y+F+    YI+P K E+ E + ++ + LPS+  PEV+G+H N  ITR+LQ ++ LLDS+++ LG     ++  G S E  + +    I  +MPA  D+E A   YPV YNESMNTV+VQEMERF KL   IR + ++L   IKG++VM+ +LE + +++   +IP  W   SYP LKPLGSY+ DL +RLN+L  W + GKP TFW+SGF+FTQAFLTG MQNFARKY IPID L FD++VLK       P+DG Y  GL+L+GARW      L EQ PKVL  A+PVI+ +P    DV+  +  RY+CP+YKT+ERKG LSTTGHSTN+V+P+ L T    SHWVKR  AL+CQ  D
Sbjct:   20 DNEPYMKNPLLKFRISEVHERRHYQFLKQKAADVKVRVARQ--QWQPEP-----------DMRLLPQSHYEDNLRREVRKIVVPPMLRRTEAKILSFASERLKNKYPELVQAYMHDVHEEFNRLMKVYSMKNILRHPEFSDEDPAQFELPRPDIGFRRPGRTQNYSNFLENRRRIAQKLLILQLPLRAILNISVGELPKLACIFNYVLATGAMQQQLGLGGREALSYKFYHKYIQNQLDKVNTFLRWTWYPKIVQVLRKLMRKRVMPMSTWKRSWNAMEALMNREMTNMKIRTFEEMYRMC--SHPRTMPMMRMSLEWSEFSSDLDTRPN-----------AWSILRTFAEIATEISMVGYRMEPLQPQVQTLTSMAAYAKVNDYLKIEMNDNFLKDVIDKVQNIILRTYQEVIQYVEGFRDKYYALYSW----QERDALNQFLSEPHEFEEYFARIDMYYGFIQMLRSEPATEYFVMAVIHNEPAIFGLRTLAENLIHEITTIIIREHIKAEVDICDEFEKIKYRALEIPKSTEELLESAEYMIHVKKDKIAELTDRIQYCLQVGTNIVELTEMSKYHFDLTIKTINWIKDINDICDYNASQQEQFKFTFEEHLQEVIKKLNSDIDELLPKLTVIDDMSRPD-KFRDSYII-LQNFIDQLKTFDDYVAWINKEEKLFKVALTEYPKLDIIKTFVYPFAELMKCCIEWQRYLSVWNDGPFEYLEPQFVERTTDDYLKEFQKNQKYYRVKIKQDLIDNPVCKFKGQTEDPDPAKHP-------------VPLRLCTSMIQSIKDFTTGVFIVNTMCNPALRKRHWKEMSEIAGFDVTPDAGTTLRKILNSGLDPILDQFEIISIGANKELQLWNALQAMIKEWETRVFPYGPYKETGVQILSSLDDIQALLDDHILKTLVMRGSAFMKPCEEEVRAWYEKIMRVNETLDQWGKVQANYLYLLPIFSSKDIVAQMPEEGRLFVIVEQTYTRNMGLVLRQPLVMETAPVSGLLESLQKANELLEDIATGVSNYLEKKRLYFPRFFFLANDEMLEILSETKDPLRVLPHLSKCFEGINSLEFDAAKNVLAMISSDKETIEFIEQVSTAAAGGSVEKWLIGVEDEMLKAVRYQNELSFAHYPKVKRHEWVLEWPQMTVLAISQVYWASRVHGCLRRTFGGNMTIMMNFFQELSKELNDIVTLVRSPKISNLNRITIKSLIVIDVHAKDVSEDLIKNKVSSEFDFQWLAQMRYYWEDDKTWVRIINATVPFANEYLGNSDRLVITPLTDRCYRTLVGAYQLHLNGAPEGPAGTGKTETTKDLAKALAVQCKVFNCSDGLDYKAMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILLIIQAVRSNATKFMFEGTELTLNPACYVCITMNPGYAGRSELPDNLKVLFRSVAMMVPDYAMIGEISLYSYGFVDARKLAVKIVTTYRLCSEQLSSQNHYDYGMRAVKTVLSACGNIKKQYPDEVEDILLLRSLIDVNLPKFLSFDVPLFEGIISDIFPGIKLPHIDYSLVESEFKRVCLEEVLEPAPSFLLKVIQTYEMIIVRHGFMLVGEPLAGKSKTLQVLAKVLSALKIKAPQKSNYFQHVQMGIMNPKSITMNQLYGSFDPISYEWTDGLVAKIFRDFAMTPTPDRKWVIFDGPVDAVWIENMNTVLDDNKKLCLTSGEVITMSNEMSMVFEVMDLAQASPATVSRCGMIYMEPSTLGWRAFAKSWLKKADPRWADEEGVPYVMALMQWLLPPCQTFVRRFCSQFIKPGEFNCMLTTFDLFDMQIAEAIEENPEDYQKYLQTYFQAAILFALIWGVGGVLDTASREKFDVFLKKLW---DTDPPPPEPLGKMEITPPTEGLLVDYVFLYKQRGAWRYWPDLAKRMDVEETKT--GVIVPTVDTARYIHLLKMHVEHKKRMLLVGPTGTGKTVYVQNYLMNKLDKEVFETGFITFTVMISANQCQDLLISKLQKWKRGIYGPPKGMQSVLFVDDMNMPVKEVYGAQPPLELLRQFFDYGHVYDLKDSSKVYIHNVLIMAACGLPGGSRQDVYARFLNHFNVYSINTFSDDSMFRIFLNVALNGFRRAGHGQDVFVVTNQIVSATQSIYKSVQSEIRATPSKSHYIFNLRDISRVVTGCTLVRKESVSDKKIFVRVWYHEAMRVFYDRLVDDVDRKWMFDKLNECLKANFKDKVETVFERYCVQGPDEAVFTMEAASNILFGVYFDEDSVPDERRYEEVPSVEVFLNLALTSLDDYNSTRRNKMDITLFTFALQHLNRICRIISIQGASALIIGLGGSGRQSLTKLATNMVQTSFFQPEITKNYGANDWHDDIKAILKEAGGMNKHTTFLITENQIKMELFLQDIDCLLNQGEVPNIFPIDEKQEVLEMVRLAAQGGNRNIDVSALQVFSFFVDRCKQKLHMILSFSPIGDALRTRVRLYPSLVNCCTIDWYDSWPEEALQMIAKMSLVDVNVPSEDIKLAIMDTCQYFHTTAARSTRAFCQMTGRHIYQTNASFIELIRSFQTLIERKQSETMLAKMRYIGGLDTLAQAAAAISIMQRDLNALQPKLVALAESSRKMMLEINKETLAASAAAEQVKRDEEVASVQAEAAQVLKQDCERDLAKAIPVLEDALAALNTLKPADITLVKSMKNPPPVIKLVMAAVCVIKGIPPERIPDPAS-GKMVQDYWGPSKRLLGEMNFLPGLKEFDKDNIPTEIVKRIHKEFIPNKDFDPKVVAKASSAAKGLCQWIIAMMMYDEVAKVVAPKKAKLAGAEKEYADTMEFLAQKRALALALEEKVALLNIELDKANAEMQKTEEHAESCRNKLLRAEALIGGLGGEKSRWNKAAEDLQELYDHLPGDVLISCGIIAYLSAVNLQYRSECVKDWFKKVTDLKIPCSSHYSITDVLGLEVTIQNWQLDGLPNDEFSSENAIISANSSRYSLFIDPQAQANNWLKNMERKNRLNCVKFNQSNYMKVIAEALEYGTPVIIENVQEELEVPLDPILMRQTFVQGGIKHISLGESVVPVNPNFRLYMTCNLRNPHFLPETFNKVTVINFALTQNALMDQLLSIVVAKERPDLQELRITLTTEAAANKGALRDAENMILKTLS-AGGDILENEAAIQILADSKGLSKDIVEKQEAAKETVAKIEAFRLNYKPVAVHSSILYYSITDLPNIDPMYQFSLNWYINLYMYSIETANKSKDLPRRIKFLVDGFTRNLYNNVCRSIFEKDKLLYSFILTARILLGTGQVEMRHFAHLVTNAKESTNIPPNPDPTWITETVWLNVLRLEELKELRGIVDHFKSHLHAWQAIYDHSSPEKQPLPPPWQDKTTAFEKIIVLKALRPDSVFLAVRLFIAESIGDQYVTPPEFDISKSYADSTALTPLVFILSPGADPLGSLLAFAEKMG-QEETFQSISLGQGQGPIATALIKNAQEMGYWVCLQNCHLAASWMPYLEYLWENMDTFNTTPNFRIWLTAYPTPQFPVTILQNGVKMTNEPPTGLKENLMRSYNSEPINDYEFYTGCAKQDRAFTRLLYGICFFHAVVQERRKYGPLGWNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWDRRLIVTILADFCNAQAVTDNRYRFASDDRYILPRKTEHREILRYLDENLPSLAPPEVYGLHANSGITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEKYPVDYNESMNTVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNRIPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDWHHHGKPPTFWLSGFFFTQAFLTGAMQNFARKYKIPIDTLTFDYDVLKVETKTSPPDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIFFRPVGLVDVVEGS--RYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKASHWVKRSVALICQTSD 3964          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 3075.03 bits (7971), Expect = 0.000e+0
Identity = 1725/4006 (43.06%), Postives = 2451/4006 (61.18%), Query Frame = 2
Query:  443 LIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPI-GLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDV-YALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESF-------YNCTTILLSNQIKNLLGRTVEAWVDI---FEEGNA-----------KFLPILKMYL-----NFDSNQMQFYPN---------YDDLEELIYFIINCITQSMQKIPTIDSII-----NSNPQPVF-----IPALLANH---ILAYAKERLRSSATRCFEEPKE----------------------------------YFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYG---EYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRR---EKLISELQK--HKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQ--FNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWE-----EENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKL--NEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGL-----EMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPK--EINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKG----EGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIP----EDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDM---------------------EDDMRNDTVKI--------------VKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMT-PENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGC----PGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSE-----IANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTS-HMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKP---AKRDVISTT-----ENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            LI+++++F   +KRS +   L   N+           PE PI  +     W  + ++ +  + + LM  +P +Q L  L +  + + +V D+   L  +  +D + ++  ++  C    D ++  W P+  ++ NE +   K    +   +       + C    +S  + +L+ +++     +   F+ GN            K +P++ +       +FD   +   P          YD+ ++   F    + Q ++ +P ID +      +SN   ++     +P +   H   ILA   E  R        EP+                                   Y K +Y+  Y  L        + K   EN+   E G   E ++K Q ++     L +    +L  L+   +K  L      +   +++     +  EN  I E+ E +   A   PE + E+  L  Y+ + R   +  + ++I+    R+ +LL +   S ++L LNS  F    +++ + D +      V+   E  L +RR   EKL+++ ++     R+ E  +   +  E +K+ V  V  L + ++   +E   IN EE L +I  S FP + EI  + +P  +L++   +++K    W+   F  L AD +  +V+ +++ ++K+ +Q  +N   K+A                                          +   +I +F+  +PV+  +C+ G++KRHWD++S I  R + P    +L  ++ + + S + +  +I+ AA +E+ L   ++ M+ +W  V F +  YR+S   ILAS+DDIQ LLDD I++TQ M+ SPFI    ++   WE +LL     ID W +VQ  W+YLEPIFSSEDIM+QMP EGR F+AVD+ W+ IM++T++D +VM A ++  +LE   ++   LE + KGLN YLE+KRLFF RFFFLSNDE+LEILSETKDP+RVQPHL+KCFEGI  L FD+ ++I  M S E E++ + + I+   A G VE WL +V+ VML S+++ +  + E Y    R  WV  W GQVV  +S + WT EV EA+E   + L  Y EK N QI+++V+LVR  L A  RI + AL+ +DVH RDVV+ +   R+ +  DF+W+SQLRYYW+     E+   V +    V+Y  EYLGN  RLV+TPLTDRCYRTL+GA  L L GAPEGPAGTGKTET KDLAKA+A +CVVFNCSDGLDY A+GKFFKGLA SGAWACFDEFNRIELEVLSVVAQQIL I RAI   V  F FE T L+L+  C + ITMNPGYAGR+ELPDNLKVLFR VAMMVPDYAMIGEI+LYS GF  AR+L+ KIV  Y+LCSEQLSSQSHYDYGMRAVK+VL A+ +L+  Y D  E  ++LR+I+DVNLPKFL  DI LF GI  DLFPGV LP       LK +    A  NLQ   ++ EKI+Q YEM++VRHG M+VG   GGKT    VLA+ +  +  +EE   +   V +R INPK+ITMGQL+G+FD VSHEW DG+ A TFRE       +R WV+FDGP+D +WIE++NTVLDDNKKLCLMSGEI+QM+K+M+++FE  DL QASPATVSRCGMIY++PS +GWR +  S++     VL    GL      + + + EW V   L F+ + CK ++    I+  +         ++ H +          + WFQ  +LF   W+    L    ++ FD   R++I G NE+FP PK   +NR + M PE  L  DY ++      W  W   + + S      E   I E +VPT +T    +  + C+    +++ VGPTGTGKS      L+  +P    + + +NFSA+TSA   Q  IMSKLDRRRKGVFGP +GK   +F DD+ MP+K+ YG+Q P+ELLR + DHG W DL DTTKI L D+ LM AMG  GG  N + PR  RH  VV++ +F D T++RIF+T+   +   + +      + + + +A + VY+ AI + LPTPAKSHY F+LRD +RV  GI ++  +++ D     RLW HE  RVFYDRL++  DR+ L  +  ++ K + +   +  F      P E + +  LR+L +G+YM PDA P    E   YE+++ + ++Y      + EYN+     M LV+FR+ +EH+SR+ R+L  P GN L+VG+GGSGR+S  RLAA +A+  +   ++SK+Y   +WR+DLK +L  A      TVFL +D+Q  DE ++EDI+ +LNTG++PNL+  E+K  ++E +   A+   K  D  P  ++A++++R RE+LH+ +AFSPIG +F+ R+R +P+LINCCTIDW+  WPE+AL RV +  + ++++                     E+++R +TV +              V +FH SV++ SE+ +  L R+NYVTP++YLEL+ +FRT    K DE  R + RY  GL+KL FAA QV +MQ  L +LQP+L    +  + +MV+I RE+  AE ++  V A+E   NE A A++A+ D+C  DLAEAIPA+EAAL AL+TL+PADI IVK+M+NPP GVKL ME +C++R IKP+R  DP+  G  + DYWGPS ++L DM FL  L+ +DKDNI  PI+ +IR+++I + +F P K+  AS A EG+CRW+ AM+ YD+VA++V PKK  LA+AE +L + M KLN  + +LQ + DKL  L     +   EK RL++E++ C KKL RA+KL+GGLGGEK RW++AA NL     N++GDVLL+ G  AYLG FT+ YR   L DW+ALCK   IP S  FSL   LG+P+ I+AW++ GLP D+FS++N +IV N+ R+ L+IDPQ QANKWIKNMEK   L VIK +D ++M+ LE AI FG PVL+ENVGE+LD +L P+L K V K  G   ++ G+ +IEY+  FRLYITT LRNP Y PE+ V V++LNFMIT +GL +QLL IVVA E+P+L++ +++LII SA NR  L   E +IL  LS SEGN+LE+E AI IL SSK +S+DI +KQ  A  T+ +IDAAR  Y P+++HSAILFF I++L N+DPMYQYSLSWF+NL++N+I  + KS  L +RL+ L+D+FT S+Y+NVCRSLFEKDKL+ S ++C  IL+S+G +E    LF LTGG+G +    NP  +WL DKSW  +C+  DL+  K   +      + W  FYD+ +P   ++P P  T  D +  L+V++ +RPDK+VPA+  ++   L + F+EPPPFDLA SF DS    PL+F+LS G+DP  +L  FA+ +     K  +ISLGQGQGP A +MI EA R G WV+LQNCH+A+SWM  +E+IC + T  +  N ++RLW TSYPS  FPV+VLQN VKMTNEPP GLR N+ +SF +D +   +FF             + + +F L FFHA+VQERR+FGP+GWNIPY FN+SDL+IS  QL+MF+N+ + +PF    YLTGECNYGGRVTDD DRR ++++L+  YN + I +  Y  S SGTY VP        IE++ + P   +PEV+G+HEN DI R ++++  L+  VL+T   L +S   SS     E     I   +L ++P  F++++    YPV Y  SMNTVL QE+ RFN+L + IR+SL N+ KA+ G + M  ELE   +S+++GK+PA W K SYPSLKPLGSY++DL+ RL F Q+W + G+P  +W+SGFYFTQ+F+TGV+QN++RK    ID++  +F V K    +   P+ GAYI G+F++GARWN +T ++ E   KVL++ +PVI+L+P   A  D+  +T     E  Y CPVYKTSER+GVLSTTGHSTNFV+ + L       HW+ RGTA LCQLDD
Sbjct:  458 LIDLQEDFRHYVKRSFLNYLLSS-NMERRRLQLEREPPEFPILTISPPVSWRSNLLRGKARIGEVLMTTHPTVQALNRLWHDLYEDLVVVDLGQLLLAQRPLDADTVQVFIEKSCADVRDLLLNDWLPRCADLMNEMRGTWKDLVPMSGKYGGRAAMLFRCIHSAMSRHLNSLISKSINYLFKVLCAFKGGNRIEKYSMFDAKLKRIPLMTLIASVVGAHFDHEPINMGPGVRPASNIYVYDE-DDADPFQQPQVNQFVENVPDIDDVAQFELDHSNKLYIYPYMQELPRIFTEHFKSILAVGYEIPRLEFVMSGGEPETKGFLHFIDEDHVDFLELCEKVEQIVKVNWQGVHVYLKPVYKY-YFGLFQKLILPMVQKVWTENN-LPELGAVQELLKKLQAVSDTTYYLRDFIPLNLFMLDNRHVKLSLRMYVREIYDFIIDFYKALNWNENRAICEELEEMSMKAGERPEETPEVVALQNYINDCREMRIFAIKDEIKNVLKRVVFLLTHTYLSSDELHLNSRTFILPGELEEVLDLSAARLAVVRDNLELALRERRMEFEKLLAQEKRTMDGFRIREIRDV--LTLEELKERVDTVDLLFTTIENLSREAKAINTEETLLQIDVSAFPLLAEIIEKMEPIEKLWKTSYEFEKDYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYNPVAKRA----------------------------------------AEQMRMKIEKFRVYLPVLDSICRHGLEKRHWDQISKILGRKVNPKLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGLRIMQADWRDVMFEVLQYRDSDTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARLLLIQNIIDAWTQVQITWMYLEPIFSSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAATEYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQPHLRKCFEGIGSLTFDDNMEIVEMVSDEEERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKEQMREAWEDYAMVERISWVVSWPGQVVQGISCMAWTYEVEEAIE--TKELPAYLEKSNLQIADLVQLVRTDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYWKVNEKNEDWVCVSMVVTDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDLAKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGRKVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGFDMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEPEIVLRAIVDVNLPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLVRHGLMIVGGSMGGKTTAYQVLAQTLRNVSTDEEATLKEFPVTFRIINPKAITMGQLYGRFDPVSHEWYDGVLAKTFREQVQGPKGERAWVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTKLMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFI----NVLVNKVGLGDIYMTLFEDMTEWLVPAALEFLPQ-CKQMLELSPIYQYQTFSRFFLHFLEKHKQFN--------QAWFQQMFLFCFAWAYCSALTGQGQKTFDALLRKVIYGSNENFPKPKYFSLNRGQ-MFPEKLLFLDYRFDEAEN--WWTWQKSDDSASTTSNFPENAQISELIVPTKETGYISYWQEFCISKSYAMLVVGPTGTGKSAIITSNLL-AMPKFANLVNVINFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAPLELLRTWLDHGYWSDLVDTTKIELVDMTLMCAMGTLGGS-NFIFPRLYRHMFVVAVDSFEDSTIVRIFTTIGDWHF-SKGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQGIVMVPPKRMPDPEKLGRLWAHETYRVFYDRLVDQQDRDRLLVMAVDACKSNLRFPLEQAFGE-RIEPGEKLTDNDLRNLFYGNYMEPDAEPKFYDEGDTYEKLEKLMKYY------LREYNSFSSTPMDLVMFRFAIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKILMSASFNLNHTVFLFSDAQATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVAKQLGKILDTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVYFVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDASEKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLYDLQPKLKVLSEETDRIMVNIERETAEAEKKKEVVGADEAAANEAAAAAQAIKDDCETDLAEAIPAMEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDRKPDPS--GHMVEDYWGPSMRMLSDMKFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWVRAMDVYDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEIDNCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDDWNALCKRKHIPSSETFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQVQANKWIKNMEKNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHKGGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERPDLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIAVATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPKSDQLSERLKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGILVSQGRVEKAALLFFLTGGIGYKTIPPNPLGAWLPDKSWASVCKAADLEGLKNLPQMMETYSDEWHNFYDASNPDQLQLPAPHNTVNDMY-FLIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLFMFAKQRNM-YDKLKTISLGQGQGPRAEKMIMEAARHGQWVVLQNCHVAISWMGDLERICNDTTLTDGANHDYRLWCTSYPSAVFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPLMRDKFFTNAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQSIPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPTRLNSIEYVSSFPLSPHPEVYGLHENADINRNVKETNALISGVLLTQTDLMASVKASSSGGAKEDPAIAICKQVLKQLPEEFNIDEVSKTYPVIYTNSMNTVLRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELERTHASMVIGKLPADWLKKSYPSLKPLGSYVSDLLARLAFFQEWIDNGEPMVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAVTKFEVQVPGTPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGGEPETIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTACLCQLDD 4385          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 2107.03 bits (5458), Expect = 0.000e+0
Identity = 1215/3341 (36.37%), Postives = 1901/3341 (56.90%), Query Frame = 2
Query: 2099 LFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGT-SLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSG---ILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFD------NKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAY--CFEARDEWVCEWAGQVVLCVSQIYWTLE-----VHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENAL--VRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMI------MKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNN-THKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVI-ELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEA--------------------VDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQL-VQAKKANELL-MVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLE--NKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQL-TXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNES-MNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPST-FWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL----KTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPT-EEPVSHWVKRGTALLCQL 11944
            +++L+ ++Q +   W  G F  +  +++E     +Y+E   + K+F ++H                                         E+   T   +  F+  +P+I  L  P +++RHW+++  + + +   NS   +L  ++ +   ++ E+   IS  A+ E  +E ++K +   W+   F +  Y + GI  + +V+D  QLL++ +V+   M+ + F++PF T +  WE+ L +  ET+++ L VQ QWLYLE IF  +DI +Q+PEE + F  +   ++ I     +    +KA +      +L R    +  LE I + L  YLE KR  FPRF+F+SND++LEIL  +K P  VQ HLKK F+ + KLE        ++     M S + E ++   VI      G  ERWL QV++ ML+ +++++  +R +       R++W+  W GQ+VL  +QI WT E     +H ++    + L    +K  K +S++ ++ R  L    R+ +  L+T+++H RDV+E M +   +    F W SQLR+YW  E+ L  +R TN    Y YEY GNSGRLVITPLTDRCY TL  A HL+  G+P+GPAGTGKTET KDL KAL +  +V NCS+GLDY ++GK F GLA SG W CFDEFNRI +EVLSVVAQQI+ I+ A+       MFEG  ++L     + ITMNPGYAGR+ELPDNLK +FRP++MMVPD  +I E  L+S GF + R+LA K+ T Y L  +QLS Q HYD+G+R++ A+L  AG  + + P+  E  ++  ++ D+N+ +  ++D+PLF GI+SD+FPGV LP  DY+ F  A+ E   +  LQ +    +K+I+ +E    RH  M++G+    K+     L     ++N +    +E V    +NPK++ + +L+G+++  + EW DG+ ++  R    ++ P +KW++FDGP+D +WIE+MN+V+DDNK L L++ E I M   +SL+FE  DL+ ASPATVSRCGM+Y   +  GW+P  +SWL    + L+     + + I F++ V + L F    CK  + T  ++ V +L  L+++       + P +  E + E    ++WF    +F + WSI   +D DSRQ+ D F REL                 E   P    V+DYF +   R +    + L  +          + +VPT DT RY++++   +     +M VG  GTGK+  T   +M     +++    VN SAQT+A   Q+ I ++ ++R K  F P  GK  + F+DD NMPAK+IYG+QPP+EL+RQ+ D+  W++ K   KI +Q+  LM AMGPPGGGR  ++ R    F ++++T  S +T+IRIF T++    K + + ++   +   +   T+ +Y + IS +LPTP KSHY+FNLRD S+V  G+   +KE    K  + RLWVHE  RVF DRL++DSD+ W    + + + KH    F+V F  L  +   P          FGD+ +P    ED        ++     ++  ++EYNN     +M+LV FR  +EH+ RI R++  P G+ L +G+GGSGRQ LT+LAA +    VFQ E++K Y   ++REDLK L K  G + + T+F+ +  QI + SFLE  +N+L+TGE+ NLF ++E  E+  EL R A + G      +  AL+++F+   R+ LHV + FSPIG  FR+ +RQ+PAL++  T +WF+ WP++AL  VA   L                      +  E  ++ D   +    H+SV  +SE  +  + R NYVT  +YL+L++ F+ LL  K+ E      R  NGL K++   E+VS M  +L+    Q+ + A++  + + M++I +    A +Q+ KV AE  ++         L+   RADL   +P ++AA+ ALD L   DI+ VK+   PP  ++ VME + I+   +P                W  +KK+L +  FL  L+ +D+D+IS   + +I   +  NPE +P KV+  S A + L +WI+A+E+Y +V ++VAPK+ KL  A   L+E    L   +K+L+ ++  +  L ++L++  +    L+ + E   K+LERA  L+  L GE++RW +    L   ++ L GD LLS   ++YLG F + YR++ L+ WS L K   IP +++  +T  L + V I+ WNI GLP D  S +N VIV    RWPL+IDPQ QAN WIKNME+   L  +     D++R LE A++ G PVLL+NVGE LD ++ P+L +    Q+G  +L+  +  I Y+  FR YITTK+ NPHY PEI+ K +++NF +  +GLE QLLGI+V KEKP LE+ + EL++T A N+R L + ++ IL  L+ES G++L+++     L  S+  S  + +    AE T+ +IDAAR +Y P +  ++ILFF + D+  IDPMY +SL+ ++ L+  SI  S +++L+ +R++ ++++ +Y++Y N CR LFE+ KLLFS  + +KIL + G L   EY F+L GG+ L+   +A NPA  W+S+++WD I  L+ +  F G  +SF  + + W  +Y +  P+   +   W  KL  F+ + VLR +RPD+I   +T ++  KLG ++++PP  DL  +F +S    PLIFVLSPG DP  +L+  +E       +  S+SLGQGQ PIA ++I +  ++G WV L NCHL++SWM  ++K+   M     + +FRLWL+S P P FP+++LQ  +KMT EPP G++ N+++ + N  I+E    N C  + S ++KLLF LCFFH ++ ER+KF  +GWN+ Y FNDSD  +S   L +++NEYE  P+ A++YL    NYGG +TDDWDRR L+T ++ F+ +  +   K++ S    Y +P   +   Y++ I+  P+   P+ FG H N DI   + ++R+L +++L    Q  ++S   + E ++ ++A +IL   P   + E+   A  +  N + +  VL+QE+ER+NKL   +   L++L + I+GLVVMS +LE +  ++  G++P  W K +Y SLKPL ++  DLI R+     W    +P   FW++ + F   F+T V+Q  AR    PID L +DF V       +   ++   G YI  LFL+G  W  +   L +  P  L   +PVI  KP + ++       Y+CP Y    R G         +FV+ V L +  E   +W+KRGTALL  L
Sbjct: 1251 IWELIFEWQTNWEGWKKGYFWKMNINEMEDTALNLYKEFTTLNKKFYDRH----------------------------------------WEMLEATTKNVDSFRRTLPLITALKNPCMRERHWNRVRDVIHVNFDENSKNFTLELIINLDFQAFSEDIQDISNPATMELQIENSIKNIATIWKKQSFEMAFYHD-GIYRIKNVEDCFQLLEEHMVQISAMKATRFVEPFITIVDYWEKTLSYISETLEKGLTVQRQWLYLENIFQGDDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAVKATNLRPPPFLLNRFSRMDERLELIQRALEIYLEAKRQLFPRFYFISNDDLLEILGNSKRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMHSDDGEYVEFMMVIYID---GPSERWLKQVEEYMLVVMKEMLKLTRGSLKKLVGNREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQKKPLRKLKKKQIKVLSKLSEMSRKDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEWFSQLRFYWHRESELCVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVAQQIMSIMAALSTKALELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNIIIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTEEEIVYLAMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAVKKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQRFSGWEAVTVYPVNPKALNLAELYGEYNLSTGEWLDGVLSSIMRIICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVNSERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWL----QRLRIKEFADFLRIHFDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLEIFGTKVNGINP-INLELLEEMT--RLWF----MFCLVWSICSSVDEDSRQRLDSFIREL-----------------ESCFPIKDTVFDYFVDPNERTFLPWDSKLLSSWKCDFESPFYKIIVPTGDTVRYEYVVSKLLAEEYPVMLVGNVGTGKTS-TAISVMEACDKNKFCILAVNMSAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKYWFNRKTQQKIYVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLC--QKLESYPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISKVFQGLLRSEKELQNKKNFFLRLWVHECFRVFSDRLVDDSDQFWFVNTINDILGKH----FEVTFHSLCPSKVPP---------FFGDFAHPQGFYEDL------QVDFLRTFMKNQLEEYNNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNMGIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAEVSFLEITNNMLSTGEI-NLFKSDEFDELKPELERPAKKNG---VLLTTEALYSYFILNVRDFLHVALCFSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVASHFLIGFPLNVVVSGKEDEKHRESLVISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTASNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSE--ATEQKEKVDAEAVLIRRDEIICLELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPT---------------WENAKKVLSESTFLNDLKNFDRDHISDKTLKRI-AIYTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQLEEKTNLLNELRAKEERLRKQLERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELLVKWSLLIKDLLIPATLELKVTYFLVDAVSIREWNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNMEERNQLMTLDFGMADYLRQLERALKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPPEISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNESRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSKIDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMTAKILSNAGKLLEEEYDFILKGGIVLDKLGQAPNPAPWWISEQNWDNITELDKVSGFHGIIDSFEQHYKAWNGWYATTFPEQEDLVGEWNDKLTDFQKICVLRSLRPDRISFCLTQFIITKLGPRYVDPPVLDLKATFDESISQTPLIFVLSPGVDPAQSLISLSESVKM-AQRMYSLSLGQGQAPIATKLIMDGIKDGNWVFLANCHLSLSWMPTLDKMIATMQSMKLHKKFRLWLSSSPHPDFPISILQTSIKMTTEPPRGIKSNMKRLYNN--INEANMEN-C-SEPSKYKKLLFALCFFHTVLLERKKFLELGWNVIYSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQALQTRKFRLSTLPNYFIPDDGDVQSYLDQIQMFPNFDKPDAFGQHSNADIASLIGETRMLFEALLSMQVQTNSTSSNENGETKVFDLAKEILMNTPDEINYEQT--AKIIGINRTPLEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQWLK-AYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDELSWDFYVFVEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFKPVE-NLKKRCRGVYQCPAYYYPVRSG---------SFVIAVDLKSGNEKADYWIKRGTALLLSL 4457          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301302)

HSP 1 Score: 1817.36 bits (4706), Expect = 0.000e+0
Identity = 1123/3284 (34.20%), Postives = 1784/3284 (54.32%), Query Frame = 2
Query: 2396 QIH--EFKEKIPVIACLCKPGIKKRHWDKMSSIANR--DITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGIS---ILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGL---LEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF---DNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFE---ARDEWVCEWAGQVVLCVSQIYWTLEVHEALERG-----VEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEE--ENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASN-DTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKG---------VIPTGSIHLVKNLLNLIDMIMKPHL-----EKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPI-------PKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDL-KDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFD-------------VLFEHLTTTPNEP------------------------VKEEHLRS-LMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVA-LKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLD-WSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLN-DLKE-FKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNE--YEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAK-YKFSPSGT--YIVPPK--MEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXX--XXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPID---LLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            +IH  +FK  +P++  L    +++RHW ++     +  D++P   T L  + AM L  Y E   QI   A +E  +E  ++ + E W ++ F    + +       +L  VD+I Q+L+D  +  Q+M  S FI PF   +  WE  L    E ID+WL VQ +WLYLE IF   DI  Q+PEE R F  +D++++ IM +  ++P V+    F  +  RL E  GL   LE   K LN YL+ KR  FPRF+F+S DE+L IL  + +P  VQ H+ K ++ I  L      ++  +  M SSE E ++      ++ A G VE W+  V D M  S R +   +   +  +   +R +W+  + G V L  SQ++WT EV EA ++      +  +  +  K N QI E+V  VR  L+   R+   A  T+DVHARD++++  R  V   ++F+W SQLR+YW +  +N  V   + +  + YEY+G +GRLVITPLTDR Y T+  A  +NL GAP GPAGTGKTET KDLAKA+ + CVV NC +G+DY A+G    GL   GAW CFDEFNRI++ VLSV++ Q+  I   +   ++ F+FEG E+ L+  C V +TMNPGYAGR+ELP+++K LFRPV  + PD  +I  ISL+S GF+ A+ LA K+   Y L   QLS Q HYD+G+R++ +VL  AG +K +  D  E ++L+R + D+N PKF+  D+PLF G+I DLFPG+  P+  Y  F  AV  V        +    +K++Q YE M+ RH  MLVG   GGKT V++ L +A + +         K +   +NPK+ ++ +L+G  D  + +W DG+ +N FRE     +  +R++  FDG +D LWIE+MN+V+DDNK L L +GE I++    +L+FE  +L+ ASPATVSR GM+Y+ P ++ + P +  W+ ++PE  +     E+++  FE  + + + F+ +   G         VI    +++V    NL D ++  ++       E V +N N     +  +L A+  S+G  L    +  FD + + +       FP+       P    +F    P    +YDYF++ K    W  W  + +  +        E LVPT+D  R    + +  E ++ ++ VG  GT K+      L N  P+   + + +NFS++TS+   Q  + + +++R K  +GPP+GK    F+DDMNMP  + YG Q PI LL+ +F+ G  YD  KD      +D+    AMG  GGGRN+V PRF+  F+  ++   +D+++I+I+S++   +M   +F  +Y+ +   +V  TL+++K  I +L PTP+K HY+FNL+D SR+  G+ LI+    +  R   R+W +E  R+  DRLI D+D   + + L   + + F  TF+                  L   P++                         +K+  LR  L+FGD+ N     E R+YE++ + N  Y +  + ++EY    K KM+LV+F   LEHL+R+ R L    G+ LL+GVGGSG++ +TRLAA  A   VF+  IS+ Y +  +REDLK L   AG + K  VFL T +Q+ +E FLE I+N+L  G+VP LF  E+K  ++  VR+ A+     A  S  A++ +F+  C E LHVV+  SP G A R R R FP LI    IDW   WP  AL  VA L   E   +    R   V+ V H HTS+   S+++   L R N+VTP  YL+ IN++R LL  K     + + R   G+ K+  A+ Q+ +++I + E +  +  A +  E ++V I   +  A  ++ +   +   V  K        DE    LAEA+PALE A  AL  L  A IT +++   PPA V++V E + I++             G K ++ W  +K ++ D+ FL  L E D + ++   +T+ R+   T    D  K+S A +   GL R++ A+  +  V K V PKK +L     + +  +  LN    ++Q +E+KL  L +    +  +   L E ++   ++L  + KLI GL  E  RW++   +L     + +G  L+SA  +AY G FT  +R   + D W     S  IP  + F +   L   V+I  W+  GLP D  SI N ++   A R+PL IDPQ QA +WI+  E +  L V+  +D+DF++ LE AI +G PVL E+V + +DP ++ +L K +  Q G   + LG+  +++   FR+Y+TTK  NP + P +  K  ++N+ +T  GLEDQLL +VV  E+P+LE  R+ LI  ++ N+++L++ ED +L  LS S GN+L+N   I+ L+++K  +  ++++ + A +T   I+  R  Y P A+  A+LFF+++D+  ++ MYQY+L+ ++++++ S+  +     L+KRL  +    T ++Y   C  +FE+ KLLFSF + +K+    G L  +E  F + G + L     +    WLS+KSW+++ +L  D  + F    + F   L  W+ ++D ++P++   P  +  K ++F+ L+ LRC R D+I  +I  Y+ E + + +I PP    +  ++ +    P+ FVLS G+DPT  L+K A D   G S F  ISLGQGQ   A +++  A ++G W+MLQN HL + ++  +EK  + +  EN + +FRLW+T+ P+P FP+ +LQ  +K+  EPP GL+ NL+ ++        E    C      F  L++ L FFHA+VQERRK+  +GWNI Y FND+D  +    L+ ++      ++P+++++YL GE  YGGRV DD+DRR     ++++  + +  + K + F       Y +P +  +   +YI  I  LP +  P+VFG+H N +I      +R + +S LI L   T  G    S ++ +  +A  IL K+P +F+  +      ++ + +   VL+QE++RFN L   I+++L+ L KAI G + M   L+ +A+SL  G +PA WSK +  + K L S++  L  R    + W   G+P   W+SG +  Q++LT ++Q   R+   P+D   L  +  +      +  +P  G  + GL+++G R++  T +L    PKVL E + ++ ++P +   +   +N Y  PVY TS R+  +         V    L T E +SHW+ +G  L    D
Sbjct: 1863 EIHMKQFKGTVPLMVSLKHEALRERHWLQLMEKTGQYFDMSPARFT-LENMFAMQLHKYQEIAEQILTNAIKELQIERGVQAVIETWASMAFKTFKHFKGSDDRGWVLGPVDEIMQILEDNAMNLQSMGASQFIGPFLETVNKWERTLALISEIIDEWLVVQRKWLYLEGIFIGGDIRTQLPEEARKFDDIDKSYRRIMVDCAKNPLVVP---FCTVPGRLVEIQGLGIGLENCQKSLNEYLDSKRRIFPRFYFISTDELLSILG-SSEPSAVQNHIIKMYDNIKSLRLVKEGSQTIVTGMISSEGEVMEFRH---SARAAGRVEYWMNDVLDEMRRSNRFINKTAIYDFGTDLQISRPDWLMNYQGMVGLAASQVWWTAEVEEAFDQAQNHGNMRAMKDFLGKNNYQIEELVLKVRSNLSRNDRLKFKAQCTVDVHARDIIDNFVRDNVLDASEFSWESQLRFYWIKFYDNLHVLQCSGSFDFGYEYMGLNGRLVITPLTDRIYLTITQALLMNLGGAPAGPAGTGKTETVKDLAKAMGLLCVVTNCGEGMDYRAVGTILSGLVQCGAWGCFDEFNRIDISVLSVISTQLQTIRNGLIRKLDRFVFEGVEIHLDPKCGVFVTMNPGYAGRTELPESVKALFRPVTCIKPDLELICLISLFSDGFLTAKVLAKKMTVLYSLAQAQLSKQCHYDWGLRSLNSVLRMAGVMKRQSEDLPEAVVLMRVLRDMNFPKFVFEDVPLFLGLIKDLFPGIDCPRIGYPDFNAAVRHVLVNDGYILLPDQEDKVVQMYETMMTRHSTMLVGPTGGGKTVVINALVKAQTHMGLP-----TKCL--VLNPKACSVIELYGFLDMETRDWIDGLFSNIFREMNKPIEREERRYACFDGDVDALWIENMNSVMDDNKLLTLANGERIRLENYCALLFEVGNLNYASPATVSRAGMVYVDPKNLRYSPFWQRWVLTRPEPQR-----ELLNDFFEKIITQSIAFILEGLDGTTQGNPLKLVIMQTDLNMVTQFCNLYDALLPNYVMDSKNYDEPVQQNYNTDS-LECCFLQAVYGSMGACLVEKHQPVFDEYMKRI-----SGFPLVQDTPENPASGGQFPQSKPT---LYDYFWDVK-DNVWKAWEWVVQPYTHDPQVKFSEILVPTVDNTRTNRTLSLMSEIKRPVLLVGEAGTSKTATIMQYLRNLNPSVNVILN-INFSSRTSSLDVQHTLEAAVEKRTKDTYGPPMGKRIACFIDDMNMPQVDDYGTQQPIALLKLFFERGGMYDRDKDLNWKKFKDLTFYAAMGTAGGGRNEVDPRFISMFSTYNIIFPNDESLIQIYSSIFKGHMVFVKFQPEYMLIADMIVHMTLKLFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCE-RKQKMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSA--SKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFLTEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILK-------------GYKEIN-WKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTGNLEDMAKISVAGA---GLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFKNNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLA-DTIVGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRI--ENPHPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFK---VRQERLESC--SHVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRCGTGKIPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCLPEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNS-LIELQPQTGEGTGGISRDDFIDSVAAGILKKLPPAFETWRIRKQIQMSLSPT-GVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGEPLVMWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFADPDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLK-LQNTYLAPVYTTSLRRNAM-----GVGLVFEANLATSEDLSHWILQGVCLTLNTD 5079          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 4841.56 bits (12557), Expect = 0.000e+0
Identity = 2382/3964 (60.09%), Postives = 3037/3964 (76.61%), Query Frame = 2
Query:   80 PIEEGSTKSQDKDPKS-NKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKG--RDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPS--FVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLIT-LGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            P+++G +++  +  ++  + L + R S + +++L  +++D+A+        Q  T  P  P PQ PS M+SEE+   MNY F+K CV+ SP+ P Q++WL  +  ++S+ L++G  R++ +++I  EV +++   M +  V   LK P     +S D             SQ+W  S  FV++R E+ K L IL+P M+ +L +C +TF   L+ D+    + G +D E+L+  V ++CE+ ++ +MK W+PK+I++   + ++ K++    +SFYNC + L+SNQ+K L+ ++V A+V +F+  N   LP+ KM L FD  +M FYPN+ DLE  +  I N I+ +MQK+ TI S +      V I A L++H+  +A+  LR++     E P ++F++ Y   Y +L+NG  +A + K + E HSFDE+ + +E F+ ++++I  LP++ +F ++RL+CE+LK GL K+   LSKI++ ++   H + +++I E+FE I+  A  VPET++E+ ++I Y+ + + +G+  L+ +I  ++ R++YL+D H F+ E L LN+ V  W + I PIFD +D++ +  K K +  L  RREKL+ EL K   R++EF E  E+D  M++QY  DVRT+  +L++  + + +IN EE L++  K+ +PE+E IK   +P+ +LF LV+K+Q++ +KW+ G F DL  + IE EV+E  RE++K+ K F  + KKA ++K           +T   +     +++D  K  A + ICS  + Q+ EFKE IP+++ LC PGI+ RHW++MS IA +D+TP+SG++L K+L   L  Y+E F  ISA AS+EF LE  M+ M E W+TV F    YR++G+SIL+SVD+IQ +LDDQIVKTQTMRGSPFIKPFETEIK+WEE+L+   +TID+WLKVQ QWLYLEPIFSSEDIM+QMPEEGRLFQ V+++W+++M N V+DP ++ A    G+ E+L+ES  LLE I KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDP RVQPHLKKCFEGIAKL+F   LDI AM+SSE E+++  Q+ISTSEARGAVE+WL+QV+D+ML SIRDVI  SR AY    R +WV EW GQVVLC SQ+YWT+EVHEA+     GL  Y+E+   Q+++IV+LVRGKL  Q R TLGALVTIDVHARDV+ ++  K V SE DF WL+QLRYYW  +N  VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAI+  +E F FEGTELRLN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+PDENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP ADY LFL+     C  HN+Q V  F +KIIQ+YEMMIVRHGFMLVGEPF GKT+VLHVLA+ ++ +NE G++E EKVIY+T+NPKSITMGQLFGQFD VSHEWTDGI ANTFREFAS++TP+RKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFE MDLSQASPATVSRCGMIY++PS +GW P+  SW+ + P+ L+  +   ++  LFEW +   L  + K C+ VIP+ + + V +L  L +M++   + ++    N+N++ W  +A+ FA+ WS+GG  D DSR +FD F RE+I GK E+ PIP  ++++E    E GLVYDY YE K +G W HWN+   N   G+    +++ +VPT+DT RY +++D+C+++ + L+ VGPTGTGKSVY ++KLMN L  D ++P F+NFSA+TSANQTQ IIMS+LD+RRKGV+GPP+GK  +IFVDDMNMPAKE++GAQPP+ELLRQYFDHGNWYDLKDT+KI L D+ L+ AMGPPGGGRN VTPRFLRHFN+ S+  FSD++M+RIFS +++ Y++  EF  D   VG  +V ATLEVY+ AI NLLPTPAKSHY FNLRDFSRV+ G  L+KKE + +KRT  RL+VHE+ RVFYDRL++D DR WL+ L    +K+HFK+ FD +FEHL    N+P+ EE++R+L+FGDYM PD    +R+Y EV ++  F  +VE C+DEYN THKN+M+LVIFRYVLEHLSRI R+L  PGGNALLVGVGGSGRQS+TRLA  M+N  +FQPEISK+YG  EWREDLK L+K AG +G+ TVFL+TD+QIKDE+FLED+D++LNTGEVPN+F  +EK E++E VR  AQAGNK+ +FSPLALFA+FV RC+E LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPE+ALERVA K LE +D+ D  R + V I K FHTS I+LS  F   LGR NYVTPTSYLELI +FR LL  ++D  M  K RY NGLDKLAFA  QVS+M+ +L +LQP+L QAK  N  +M  I  ES+  E +   V+ +EE    KA+ ++AL +EC +DLAEAIPALEAALSALDTL+PAD+TIVK M+NPPAGVKLVM  +C+M++IKPER+NDP+  G+K+LDYWGPSKKLLGDM FL  L+EYDKDNI   +M KIR E++TNP+FDP KV +ASSAAEGLCRWI AME YDRVAKVVAPKK  L  A+  L   M  LN+ + +L+ VED+L  L++ L++  +EK +L+ +V+LCA+KLERA+KLIGGLGGEK+RW +AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R  C   W+ LCKS KIP S  FSL+  LG+P+KI+AWNI GLP DSFSIDN VIV+N+RRWPLMIDPQ QANKW+KN E++  LNVIKLTD D+MRTLEN IQFG P+LLENVGEELDPSLEPLLLKQVFKQ GVD +RLGES+IEYS +FR YITTKLRNPHYLPE+A KV LLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILD++K +S++I KKQ+ AE+T+ +I  +R  Y  IA+HS+ILFF+I DL NIDPMYQYSL+WFVNLY+NSI DSNKSK L+KRLRYL D+FTY+LY NVCRSLFEKDKLLFSFLLCS +L++K ++E +E++FLLTGGVGL+N   NP  +WL DKSWDEICR +DL    G KESF  + E +   YDSK+P +  +P PW  KL+  + +++ RC+RPDKI PAI+ +V +KLGK F+EPPPFDL++S+ DS C  PL+FVLSPGADP  +LLKFA DK  GGS+F SISLGQGQGPIA ++I  A ++GTWV LQNCHLAVSWM+ +EKICE+++P+  +  FRLWLTSYPSP+FPVT+LQNGVKMTNEPPTGLR NL QS+++D IS+ +FF GCP KE  +EKLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+FVNEY++VPF+AI YLTGECNYGGRVTDDWDRR LMTIL DFYN+ VI   +Y FSPSG Y  PPK  Y +Y+EFIK LP  Q+PEVFGMHENVDI+++LQ ++LL DS+L+T  G     GG   ++ L +IANDIL K+P +FD+E A + +PV Y ESMNTVLVQEM+R+N LS+ IR SLQNL+KAIKGLVVM  ELEA+A SLLVGK+P  W+K SYPSLKPLGSY+ND + RL FLQ W++  KP  FW+SGF+FTQAF+TG +QN+ARKY+IPIDLLGF++EVL     +  P DG YI GLFLDGARW+ ++  L EQ PKVL++AVP+IW+KP  +  +    + Y CP+YKTSERKG LSTTGHSTNFV+ + LPT +   HW+KRG ALLCQLDD
Sbjct:   29 PVQDGGSEALTESRRAVRRKLMRHRRSKQQQQQLQNMIVDRAMQAFLHA-KQARTASPPSPEPQLPSTMISEEKKQYMNYLFMKECVEQSPVAPFQQQWLDAMLGRVSLQLRQGPGRNELLEDICKEVSESYLKVMIKYRVSTILKNP-----QSADTA-----------SQDWKGSADFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRSTGPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTLQKVKPKKLDSFYNCASTLISNQLKALVEKSVTAFVSLFDPLNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWLAEGSISV-IDAKLSDHVQVWAQTTLRNAVRMNLEGPAKHFQS-YVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKQVEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIIVGKLVSSHHQCSLQICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMEAQQRMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELD--MIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKK----------EKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPVNED--PGNKNMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGKGRWVHWNESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDG-NKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKESFIKSPESFLPIYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYNNLSSTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPTDKKAMDQPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3958          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 4781.08 bits (12400), Expect = 0.000e+0
Identity = 2365/3919 (60.35%), Postives = 2990/3919 (76.29%), Query Frame = 2
Query:  230 QFCTVPPKPPAP-QYPSCMMSEER-------LIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKG--RDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLIT-LGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            ++  +PP P  P Q    +M   R        + MNY F+K CV+ SP+ P Q++WL  +  ++S+ L++G  R++ +++I  EV +  Y        ++                        LDFS  WH SFV++R E+ K L IL+P M+ +L +C +TF   L+ D+    + G +D E+L+  V ++CE+ ++ +MK W+PK+I++   + ++ K++    +SFYNC + L+SNQ+K L+ ++V A+V +F+  N   LP+ KM L FD  +M FYPN+ DLE  +  I N I+ +MQK+ TI S +      V I A L++H+  +A+  LR++     E P ++F++ Y   Y +L+NG  +A + K + E HSFDE+ + +E F+ ++++I  LP++ +F ++RL+CE+LK GL K+   LSKI+L+    D       I E+FE I+  A  VPET++E+ ++I Y+ + + +G+  L+ +I  S  +++YL+D H F+ E L LN+ V  W + I PIFD +D++ +  K K +  L  RREKL+ EL K   R++EF E  E+D  M++QY  DVRT+  +L++  + + +IN EE L++  K+ +PE+E IK   +P+ +LF LV+K+Q++ +KW+ G F DL  + IE EV+E  RE++K+ K F  + KKA ++K           +T   +     +++D  K  A + ICS  + Q+ EFKE IP+++ LC PGI+ RHW++MS IA +D+TP+SG++L K+L   L  Y+E F  ISA AS+EF LE  M+ M E W+TV F    YR++G+SIL+SVD+IQ +LDDQIVKTQTMRGSPFIKPFETEIK+WEE+L+   +TID+WLKVQ QWLYLEPIFSSEDIM+QMPEEGRLFQ V+++W+++M N V+DP ++ A    G+ E+L+ES  LLE I KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDP RVQPHLKKCFEGIAKL+F   LDI AM+SSE E+++  Q+ISTSEARGAVE+WL+QV+D+ML SIRDVI  SR AY    R +WV EW GQVVLC SQ+YWT+EVHEA+     GL  Y+E+   Q+++IV+LVRGKL  Q R TLGALVTIDVHARDV+ ++  K V SE DF WL+QLRYYW  +N  VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAI+  +E F FEGTELRLN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+PDENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP ADY LFL+     C  HN+Q V  F +KIIQ+YEMMIVRHGFMLVGEPF GKT+VLHVLA+ ++ +NE G++E EKVIY+T+NPKSITMGQLFGQFD VSHEWTDGI ANTFREFAS++TP+RKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFE MDLSQASPATVSRCGMIY++PS +GW P+  SW+ + P+ L+  +   ++  LFEW +   L  + K C+ VIP+ + + V +L  L +M++   + ++    N+N++ W  +A+ FA+ WS+GG  D DSR +FD F RE+I GK E+ PIP  ++++E    E GLVYDY YE K +G W HWN+   N   G+    +++ +VPT+DT RY +++D+C+++ + L+ VGPTGTGKSVY ++KLMN L  D ++P F+NFSA+TSANQTQ IIMS+LD+RRKGV+GPP+GK  +IFVDDMNMPAKE++GAQPP+ELLRQYFDHGNWYDLKDT+KI L D+ L+ AMGPPGGGRN VTPRFLRHFN+ S+  FSD++M+RIFS +++ Y++  EF  D   VG  +V ATLEVY+ AI NLLPTPAKSHY FNLRDFSRV+ G  L+KKE + +KRT  RL+VHE+ RVFYDRL++D DR WL+ L    +K+HFK+ FD +FEHL    N+P+ EE++R+L+FGDYM PD    +R+Y EV ++  F  +VE C+DEYN THKN+M+LVIFRYVLEHLSRI R+L  PGGNALLVGVGGSGRQS+TRLA  M+N  +FQPEISK+YG  EWREDLK L+K AG +G+ TVFL+TD+QIKDE+FLED+D++LNTGEVPN+F  +EK E++E VR  AQAGNK+ +FSPLALFA+FV RC+E LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPE+ALERVA K LE +D+ D  R + V I K FHTS I+LS  F   LGR NYVTPTSYLELI +FR LL  ++D  M  K RY NGLDKLAFA  QVS+M+ +L +LQP+L QAK  N  +M  I  ES+  E +   V+ +EE    KA+ ++AL +EC +DLAEAIPALEAALSALDTL+PAD+TIVK M+NPPAGVKLVM  +C+M++IKPER+NDP+  G+K+LDYWGPSKKLLGDM FL  L+EYDKDNI   +M KIR E++TNP+FDP KV +ASSAAEGLCRWI AME YDRVAKVVAPKK  L  A+  L   M  LN+ + +L+ VED+L  L++ L++  +EK +L+ +V+LCA+KLERA+KLIGGLGGEK+RW +AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R  C   W+ LCKS KIP S  FSL+  LG+P+KI+AWNI GLP DSFSIDN VIV+N+RRWPLMIDPQ QANKW+KN E++  LNVIKLTD D+MRTLEN IQFG P+LLENVGEELDPSLEPLLLKQVFKQ GVD +RLGES+IEYS +FR YITTKLRNPHYLPE+A KV LLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILD++K +S++I KKQ+ AE+T+ +I  +R  Y  IA+HS+ILFF+I DL NIDPMYQYSL+WFVNLY+NSI DSNKSK L+KRLRYL D+FTY+LY NVCRSLFEKDKLLFSFLLCS +L++K ++E +E++FLLTGGVGL+N   NP  +WL DKSWDEICR +DL    G K SF          YDSK+P +  +P PW  KL+  + +++ RC+RPDKI PAI+ +V +KLGK F+EPPPFDL++S+ DS C  PL+FVLSPGADP  +LLKFA DK  GGS+F SISLGQGQGPIA ++I  A ++GTWV LQNCHLAVSWM+ +EKICE+++P+  +  FRLWLTSYPSP+FPVT+LQNGVKMTNEPPTGLR NL QS+++D IS+ +FF GCP KE  +EKLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+FVNEY++VPF+AI YLTGECNYGGRVTDDWDRR LMTIL DFYN+ VI   +Y FSPSG Y  PPK  Y +Y+EFIK LP  Q+PEVFGMHENVDI+++LQ ++LL DS+L+T  G     GG   ++ L +IANDIL K+P +FD+E A + +PV Y ESMNTVLVQEM+R+N   N IR SLQNL+KAIKGLVVM  ELEA+A SLLVGK+P  W+K SYPSLKPLGSY+ND + RL FLQ W++  KP  FW+SGF+FTQAF+TG +QN+ARKY+IPIDLLGF++EVL     +  P DG YI GLFLDGARW+ ++  L EQ PKVL++AVP+IW+KP+    I +  + Y CP+YKTSERKG LSTTGHSTNFV+ + LPT +   HW+KRG ALLCQLDD
Sbjct:   18 RYSVLPPIPTIPVQDGGKLMRHRRKLCCRISFLLMNYLFMKECVEQSPVAPFQQQWLDAMLGRVSLQLRQGPGRNELLEDICKEVSEMKYLQSCFCFSRI------------------------LDFSCPWHDSFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRSTGPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTLQKVKPKKLDSFYNCASTLISNQLKALVEKSVTAFVSLFDPLNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWLAEGSISV-IDAKLSDHVQVWAQTTLRNAVRMNLEGPAKHFQS-YVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKVLEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIILS----DGVFLFFRICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELD--MIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKK----------EKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPVNED--PGNKNMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGKGRWVHWNESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDG-NKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSF-------LPIYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYN---NTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPS---TIISPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3878          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: CR450723.1 (dynein, axonemal, heavy chain 12 [Source:NCBI gene;Acc:799461])

HSP 1 Score: 4764.13 bits (12356), Expect = 0.000e+0
Identity = 2354/3914 (60.14%), Postives = 2981/3914 (76.16%), Query Frame = 2
Query:  230 QFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKG--RDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESIL---AEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLIT-LGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            ++  +PP P  P      +   R  +     L++ +   P+ P Q++WL  +  ++S+ L++G  R + +++I  EV +  Y        ++                        LDFS  WH SFV++R E+ K L IL+P M+ +L +C +TF   L+ D+    + G +D E+L+  V ++CE+ ++ +MK W+PK+I++   + ++ K++    +SFYNC + L+SNQ+K L+ ++V A+V +F+  N   LP+ KM L FD  +M FYPN+ DLE  +  I N I+ +MQK+ TI S +      V I A L++H+  +A+  LR++     E P ++F++ Y   Y +L+NG  +A + K + E HSFDE+ + +E F+ ++++I  LP++ +F ++RL+CE+LK GL K+   LSKI+L+    D       I E+FE I+  A  VPET++E+ ++I Y+ + + +G+  L+ +I  S  +++YL+D H F+ E L LN+ V  W + I PIFD +D++ +  K K +  L  RREKL+ EL K   R++EF E  E+D  M++QY  DVRT+  +L++  + + +IN EE L++  K+ +PE+E IK   +P+ +LF LV+K+Q++ +KW+ G F DL  + IE EV+E  RE++K+ K F  + KKA +EK           +T   +     +++D  K  A + ICS  + Q+ EFKE IP+++ LC PGI+ RHW++MS IA +D+TP+SG++L K+L   L  Y+E F  ISA AS+EF LE  M+ M E W+TV F    YR++G+SIL+SVD+IQ +LDDQIVKTQTMRGSPFIKPFETEIK+WEE+L+   +TID+WLKVQ QWLYLEPIFSSEDIM+QMPEEGRLFQ V+++W+++M N V+DP ++ A    G+ E+L+ES  LLE I KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDP RVQPHLKKCFEGIAKL+F   LDI AM+SSE E+++  Q+ISTSEARGAVE+WL+QV+D+ML S+RDVI  SR AY    R +WV EW GQVVLC SQ+YWT+EVHEA+     GL  Y+E+   Q+++IV+LVRGKL  Q R TLGALVTIDVHARDV+ ++  K V SE DF WL+QLRYYW  +N  VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAI+  +E F FEGTELRLN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+PDENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP ADY LFL+     C  HN+Q V  F +KIIQ+YEMMIVRHGFMLVGEPF GKT+VLHVLA+ ++ +NE G++E EKVIY+T+NPKSITMGQLFGQFD VSHEWTDGI ANTFREFAS++TP+RKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFE MDLSQASPATVSRCGMIY++PS +GW P+  SW+ + P+ L+  +   ++  LFEW +   L  + K C+ VIP+ + + V +L  L +M++   L ++    N+N++ W  +A+ FA+ WS+GG  D DSR +FD F RE+I GK E+ PIP  ++++E    E GLVYDY YE K +G W HWN+   N   G+    +++ +VPT+DT RY +++D+C+++ + L+ VGPTGTGKS+Y ++KLMN L  D ++P F+NFSA+TSANQTQ IIMS+LD+RRKGV+GPP+GK  +IFVDDMNMPAKE++GAQPP+ELLRQYFDHGNWYDLKDT+KI L D+ L+ AMGPPGGGRN VTPRFLRHFN+ S+  FSD++M+RIFS +++ Y++  EF  D   VG  +V ATLEVY+ AI NLLPTPAKSHY FNLRDFSRV+ G  L+KKE + +KRT  RL+VHE+ RVFYDRL++D DR WL+ L    +K+HFK+ FD +FEHL    N+P+ EE++R+L+FGDYM PD    +R+Y EV ++  F  +VE C+DEYN THKN+M+LVIFRYVLEHLSRI R+L  PGGNALLVGVGGSGRQS+TRLA  M+N  +FQPEISK+YG  EWREDLK L+K AG +G+ TVFL+TD+QIKDE+FLED+D++LNTGEVPN+F  +EK E++E VR  AQAGNK+ +FSPLALFA+FV RC+E LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPE+ALERVA K LE +D+ D  R + V I K FHTS I+LS  F   LGR NYVTPTSYLELI +FR LL  ++D  M  K RY NGLDKLAFA  QVS+M+ +L +LQP+L QAK  N  +M     +S++    E +   V+ +EE    KA+ ++AL +EC +DLAEAIPALEAALSALDTL+PAD+TIVK M+NPPAGVKLVM  +C+M++IKPER+NDP+  G+K+LDYWGPSKKLLGDM FL  L+EYDKDNI   +M KIR E++TNP+FDP KV +ASSAAEGLCRWI AME YDRVAKVVAPKK  L  A+  L   M  LN+ + +L+ VED+L  L++ L++  +EK +L+ +V+LCA+KLERA+KLIGGLGGEK+RW +AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R  C   W+ LCKS KIP S  FSL+  LG+P+KI+AWNI GLP DSFSIDN VIV+N+RRWPLMIDPQ QANKW+KN E++  LNVIKLTD D+MRTLEN IQFG P+LLENVGEELDPSLEPLLLKQVFKQ GVD +RLGES+IEYS +FR YITTKLRNPHYLPE+A KV LLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILD++K +S++I KKQ+ AE+T+ +I  +R  Y  IA+HS+ILFF+I DL NIDPMYQYSL+WFVNLY+NSI DSNKSK L+KRLRYL D+FTY+LY NVCRSLFEKDKLLFSFLLCS +L++K ++E +E++FLLTGGVGL+N   NP  +WL DKSWDEICR +DL    G K SF          YDSK+P +  +P PW  KL+  + +++ RC+RPDKI PAI+ +V +KLGK F+EPPPFDL++S+ DS C  PL+FVLSPGADP  +LLKFA DK  GGS+F SISLGQGQGPIA ++I  A ++GTWV LQNCHLAVSWM+ +EKICE+++P+  +  FRLWLTSYPSP+FPVT+LQNGVKMTNEPPTGLR NL QS+++D IS+ +FF GCP KE  +EKLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+FVNEY++VPF+AI YLTGECNYGGRVTDDWDRR LMTIL DFYN+ VI   +Y FSPSG Y  PPK  Y +Y+EFIK LP  Q+PEVFGMHENVDI+++LQ ++LL DS+L+T  G     GG   ++ L +IANDIL K+P +FD+E A + +PV Y ESMNTVLVQEM+R+N   N IR SLQNL+KAIKGLVVM  ELEA+A SLLVGK+P  W+K SYPSLKPLGSY+ND + RL FLQ W++  KP  FW+SGF+FTQAF+TG +QN+ARKY+IPIDLLGF++EVL     +  P DG YI GLFLDGARW+ ++  L EQ PKVL++AVP+IW+KP+    I +  + Y CP+YKTSERKG LSTTGHSTNFV+ + LPT +   HW+KRG ALLCQLDD
Sbjct:   18 RYSVLPPIPTIPVQDGGKLMRHRRSKQQQQQLQNMI---PVAPFQQQWLDAMLGRVSLQLRQGPGRHELLEDICKEVSEMKYLQSCFCFSRI------------------------LDFSCPWHDSFVQSRREIQKNLHILHPAMKSVLDICYSTFSHLLLIDLSDCRSTGPVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTLQKVKPKKLDSFYNCASTLISNQLKALVEKSVTAFVSLFDPVNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWLAEGSISV-IDAKLSDHVQVWAQTTLRNAVRMNLEGPAKHFQS-YVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKVLEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIILS----DGVFLFFRICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFAECSELD--MIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELEK----------EKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSVRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHMCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNELGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMKTLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPLNED--PGNKNMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWECPFDEKGLVYDYSYEFKGKGRWVHWNESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSIYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDG-NKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIMEAVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERQEVVPICKTFHTSAIDLSNRFLLELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVTFIQSMIRFSVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSF-------LPIYDSKEPFNTALPKPWCDKLNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLSPDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYN---NTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDSSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPS---TIISPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3870          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 4020.31 bits (10425), Expect = 0.000e+0
Identity = 2064/3919 (52.67%), Postives = 2718/3919 (69.35%), Query Frame = 2
Query:  287 SEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNV-PGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEG-AMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFL----PILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSN-PQP----VFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKC-LPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNS-GTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVA--ENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIG--KNESFP-------IPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSK-GEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQ-EFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKD--ADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            +E+ ++R  YY +++ +    +  M++ WL+N+   +  HLK    + ++ +  E+++++  S+K+++V   L+ P     L++ DL P  +E   +   + W  SF++ ++ +   L  +   M ++L L   +F +  + DV A H+E  +M+    +  V    E+    ++  W P+V  I+   N+R  +P      + +SFYNC   L+++Q+++L   +++ +  +  +          P   + L  D N ++F P++ D E  +  + N + +S+  IP +++ + S  P P       P +L   IL   +E++R        EP ++  ++Y+  Y+ L++ + E ++T+FL E HSF E    + ++Q +A +I+C    V    +  L   DL   LVK    L + L+N + Q H++ N ++ E+++ I   A   P  ++EL +L AY+ +   + ++ L  K++ S  RL +L+D   FSP D++LNS+ F    ++  IFD + +I +    + +  L  R E+++ +++ ++ +V+EF  FG++    + +Y++  ++L SKL+   +++  IN EEE F  P S +P+ + ++ Q  P+++L++   ++Q    +W+ G    +  DK+E +V    R L+K++K F +  K                                       L+I +    ++  FKE IP++  LC PG+++RHW+ MS++    + P+     +A  L + L++++  F  IS  AS+E  LE  M++M  EW  +EF+L  YRE+G SIL+S+D++Q LLDD IVKTQTMRGSPFIKPFE EI+ WE+KLL   E +D+WLKVQ  WLYLEPIFSS DIM QMPEEGR F AVD+ W+D M+    D +V+       +L+++K SN LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA + F + LDI  M SSE E +++  +ISTS+ARG VE+WLL++++ ML SI  VI  + EAY  + R  WV  W GQ VLCVSQ+YWT ++HEA+ +G + L  Y E+ N QI +IV LVRGKL+ Q R+TLGALV +DVHARDV+  + +K V+ E +F WLSQLRYYW E     ++ NA + Y YEYLGN+ RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGL S+GAWACFDEFNRI+LEVLSVVAQQIL I R I  H E  +FEGTEL+LN  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYA+I EI LYS GF+ AR L+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLK+P+ENE++LLLRSI+DVNLPKFL+HD+PLF GI SDLFPG+ LP+ DY++ L+A+ E  AK NLQ  DFF EKI+Q YEMMIVRHGFMLVGEPFGGKT    VLA A++ + E+   E  +V    INPKSITMGQL+GQFD VSHEW+DGI A ++R FA + +PDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  MSLIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SWL + P  L   +  +++  LF+  +  CL+ + K  K + PT +  LVK+L+NL+D +M    ++  +   + R++  W +  ++F + WS+G     + R KFD   RE+++G    E+         +     +  V LP  G +Y+Y +  +  G W  W +  K      +     E +VPT +T RY  ++ + + H++  +FVGPTGTGKSVY  D L+N L  D Y P  +NFSAQT+A QTQ IIMSKLD+RRKGVFGPP+GK  V+FVDD+NMPA+E YGAQPP+ELLRQ+ DH NWYD+KD + I L DI +M AMGPPGGGRN VTPRFLRHFN V++  F + TM  IFS ++  ++  +  F   + +V   ++ AT+ VY+ A  NLLPTPAKSHY+FNLRDFSRVI GICL + E  +D     RLWVHEVLRV+YDRL+   D  W+   L+E  K H  E F  LF+HL +  +  V E+ LRSLMF D+ +P    EDR Y EV +  +   +VE  ++EYNN  K  M+LV+FR+ +EH+ RI RIL  P G+ALLVGVGGSGRQSLTRLAA MA   +FQ EISK+YG  EWR+DLK +++K+       VFL TD+QIK ESFLED+ NLLNTGEVPNLF  +EK E+ E +R   +  ++D   D S LALF  F+ RCR +LHVV+A SPIG  FR+RLR+FPALINCCTIDWFQ+WPEDAL+ VA + LE V+M +  R   + + K FHTS I+LS  F   L R NYVTPTSYLELI+ F+ LL  K+ E M+ K RY  GL KL  AA QVS MQ +LE LQPQL  A K  E +MV I  ES         V+ +E   NE+A A+KA+ DEC ADLA A+P LEAAL+ALDTL   DIT+VK M+NPPAGVKLVME ICI++ IKP+R+ DP+  GKK+ DYWGP+KKLLGDM FL  L EY+KDNI    M+ IR ++ITNP+F P K+  AS+AAEGLC+W+ AM+SYD+VAKVVAPKK KLA AE  LK  M  L + Q  L+ V+DKL  L++ L+  +++K  L+ +VE+C+KKLERA++LIGGLGGEK RW++ A NL  +Y+NL GD+L+SA ++AYLG FTS +R +   +W  +CKS  IPCS   SL   LG PVKI++W I GLP DSFSIDN++I++NARRWPLMIDPQ QANKW+KNMEK   L+VIKL+D DF+RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEY+ +FR YITTKLRNPHYLPE++VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A N+R L+E ED+IL  LS SEGNILE+ETA+QIL SSK ++++I +KQ  AE T+ KID  R+ Y PIA HSAILFFSI DL NI+PMYQYSL+WF+NL+I SI +S KS LL++RL+ L DHFTYSLY NVCRSLFEKDKLLFSF L   +L     ++  E+ FLLTGGVGL+N  +NP T WL   SWDEICRL++++ FKG ++  +   EGW+  YDSKDP     P  W  KL  F+ +L++RC+RPDK+VP +  +V   LG++FIE PPF+LA +F DS CCAPLIF+LSPG+DP  ALLKF E++GF G++  S+SLGQGQGPIA  MI    +EGTWV+LQNCHLA SWM+ +E++CEE+  + T+ +FRLWLTSYPSP FPV VLQNGVKMTNE P GLR N+ +SF  D IS+PEFF+    K + F+KLLF LCFFHAL QERRKFGP+GWNIPY FN++DLRIS +QL MF+++YE++PFDA+RY+TGECNYGGRVTDDWDRR L TIL  FY   +I DA YKF PSG Y  PP+ +Y  YIE+ K LP   +PE+FGM+ N DIT++  +++LL DS+L+T  + +     SS++ + E+A DIL K+P  FD + A   YP +YN+SMNTVLVQEM RFNKL   IR+S  N+ KAIKGLVVMS ELE + SS+L G+IPAMW K SYPSLKPLG YI+D +ERL FLQ W+ +G P+ FW+SGF+FTQAFLTG  QN+AR+YTIPIDLL FDFEV++       P DG YI GLFLDGARW+  T +L E  PK+L++ +PVIWLKP K+  I   +  Y  PVYKTSER+G LSTTGHSTN+V+ + L ++ P  HW++RG ALLCQL+
Sbjct:  135 AEKDILRYCYY-IRNGIGTEDVAAMEDSWLKNVLALVPEHLK-SLTRTIEALSDEMREDYLLSIKKNIVDFVLQDPRENKELKARDLPPHRQEMEII--PKPWKKSFLQAQKRMRNNLFTVNHTMLEVLGLWQVSFKKLRLIDVEAFHSEEESMELSVFQQLVNKHIERATGILLNTWIPEVQKIYHRGNKRNLIPSNSSVARLQSFYNCVATLMTSQLQSLALESMQDYTHLIAQNPHSVRVYEHPGFVLRLVLDQNTIKFEPDFKDFEVTVLNVYNAMLKSLSVIPRVETKLYSEWPGPETHHTLKPIILP-EILEAQQEKVRRVIRAESAEPLKHV-HLYD-KYAPLVSQQAEEDVTQFLLEQHSFQELMMEVIRYQQLADEIQCSTVKVVRLGMFELHSHDLVRALVKRAEGLLQKLVNHMLQGHQEFNNKLCEEYDTIANKALRSPSNTEELMELRAYVAKVEEEEILQLEMKLQESNNRLCFLVDYVTFSPTDIQLNSKTFQRHARMPSIFDQHRQIIKEKTGQFQDGLKLRCERILEDIKSYEQQVEEFVNFGDLSE--LNKYLKKAQSLNSKLELVMEKIRGINQEEEAFDWPVSQYPQRKTVQDQLLPYLRLYETAAEFQSQHHQWVTGPLTAVNPDKVEVDVGNYSRGLYKLEKTFQDLPK--------------------------------------PLQIATSVKAEVEAFKEHIPIVQVLCNPGLRERHWEAMSAVVGFPLKPSEEDACVAHFLPLHLEAHLSAFESISEGASKEHGLEKAMERMVSEWAGMEFTLLPYRETGTSILSSLDEVQMLLDDHIVKTQTMRGSPFIKPFEAEIRDWEDKLLLLQEIMDEWLKVQGTWLYLEPIFSSPDIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHVLAVVAIEKMLDKMKHSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASVVFTDVLDITHMRSSEGEVVELLDIISTSKARGQVEKWLLELENGMLRSIHKVIGKACEAYLNDLRINWVRAWPGQTVLCVSQVYWTKDIHEAIAKGPKALQAYLEQNNTQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVQKGVDDETNFEWLSQLRYYWIENQLHTKMINAGLAYGYEYLGNTPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAIAKQCVVFNCSDGLDYIALGKFFKGLLSAGAWACFDEFNRIDLEVLSVVAQQILTIQRGISAHAEMLLFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPEENEDVLLLRSIIDVNLPKFLAHDLPLFEGITSDLFPGIKLPKPDYSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVRHGFMLVGEPFGGKTSAYRVLAAALNDICEKNLMEENRVQITVINPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFAISQSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPVMLSWLNTVPSTLSSMHK-DLITGLFDRMLPACLQLIRKGTKELSPTSNTSLVKSLMNLMDCMMDEFGDESQMKRMDQRDVCSWLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGGLSEETRTRHGILEHVEPPAKQLTVPLPTEGTLYEYRFLKEGPGRWELWTEELKAFPPIPKDVQFNEIIVPTENTVRYNALMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLDHWNWYDMKDCSMINLVDIQIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLTIRFPFPKPFASVTSQIISATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQGICLSRPETADDLTAIKRLWVHEVLRVYYDRLVHPDDCAWMVGFLQEVSKSHLNEDFHQLFKHLDSNSDGLVTEDDLRSLMFCDFHDPKG--EDRNYREVGDAEKLRQVVETHLEEYNNISKAPMNLVLFRFAIEHVCRISRILKQPRGHALLVGVGGSGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDLKLIMQKSTSGDTHGVFLFTDTQIKMESFLEDVSNLLNTGEVPNLFAVDEKQEICERMRVLDRQRDRDKQTDGSTLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQSWPEDALQAVASRFLEDVEMTNTAREGCISMCKSFHTSTIDLSAHFLSELQRYNYVTPTSYLELISMFKHLLQRKRTEVMKLKSRYEVGLQKLESAATQVSTMQGELEALQPQLRVATKEVEEMMVVIQHESEEVSKTEKVVRVDEAEANEQAMAAKAIKDECDADLAVAVPILEAALAALDTLTQQDITLVKAMKNPPAGVKLVMEAICILKGIKPDRIPDPSGSGKKVEDYWGPAKKLLGDMKFLQSLHEYNKDNIPVSYMSIIRNKYITNPDFVPEKIRTASAAAEGLCKWVCAMDSYDKVAKVVAPKKEKLAHAEEKLKVAMESLRKKQAALKEVQDKLAKLQETLETNKNKKADLENQVEMCSKKLERAEQLIGGLGGEKSRWSETAFNLGQLYNNLTGDILISAAIVAYLGAFTSSFRQRATEEWIDMCKSRGIPCSKNMSLMNSLGEPVKIRSWTIAGLPSDSFSIDNAIIISNARRWPLMIDPQGQANKWLKNMEKSNSLHVIKLSDADFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPEVSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGAENKRQLQEIEDKILEVLSASEGNILEDETAVQILSSSKVLANEISEKQAIAEVTELKIDQTRLGYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSQKSDLLEERLQILKDHFTYSLYCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRFLLTGGVGLDNPHSNPCT-WLPKTSWDEICRLDEMERFKGLRKDLARLREGWKEVYDSKDPHHTDFPSEWQEKLGQFQRMLIIRCLRPDKVVPMVQEFVSGNLGQQFIEVPPFNLATAFADSHCCAPLIFILSPGSDPMAALLKFGEEQGFTGNRLTSLSLGQGQGPIAMSMIETGVKEGTWVVLQNCHLATSWMSTLERVCEELNADTTHPDFRLWLTSYPSPNFPVAVLQNGVKMTNEAPKGLRSNIIRSFCMDPISDPEFFDSS-SKPAVFKKLLFSLCFFHALTQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSPPEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSRSSGGSAASSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDGMPAVFWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVMEDKEYKNPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLKPMKKQDIPERQC-YISPVYKTSERRGTLSTTGHSTNYVISMALNSDVPPEHWIRRGVALLCQLN 4000          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: dnah3 (dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB-GENE-091112-7])

HSP 1 Score: 3716.78 bits (9637), Expect = 0.000e+0
Identity = 1969/3883 (50.71%), Postives = 2625/3883 (67.60%), Query Frame = 2
Query:  440 ILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVP--FPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGET--------LVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKS-----VPK---IEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFE---EGN---AKF-------LPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTID-SIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEE----PKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHL-EKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEI-----NRFEVMLPETGLVYDYFYEHKVRGYWHHWND--LNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEE-MTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKT-SHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            +L EV++++  S+++S+V   L  P      S   VP  FP   I       W  S+ + R   ++ L  + P +  L  L  ++F           L  D+  L  E    FE L   VQ  C+   D ++  W P+  ++F   K      +PK   I  +  E  + C   L+S Q+++L+  +++  +  F+   +GN    +F        P+L + L  +  ++ F P+     ELI      I  S   IP ++  +     + + + ++ A+ +L    + + ++A   F+     P+ Y + +Y+  Y++L++ ++   I  FL   HS   + + I   Q + + I  L       L  L+  +L   L  +   L ++L   V +++R+ N  I  +++ I     + P +++EL +L  Y++      +  L  +I  +  RLD+LLD      ED+KL S V  W   I    + +     + K + E  L++R  +L   L+     VD F    ++  E +K  V+ +  +   L+ A +E+   N EE L    +S FP ++ I A+  P+ QL+   + +Q     W++G F  L A+ +  ++  ++R ++K+ K F  +                                       A   +      +I +FK+ +P++  +C PG+K RHW+ +S+    D+ P+  T L K++ +GL  Y ++  +I A+AS+E++LE +++KM  EW  + F    Y+++G S+L++VDDIQ LLDD I+KTQTMRGSPFIKP E E K WEEKL    + +D  L+ Q+ W+YLEPIFSSEDI+ QMPE GR F  VD  WK+I+  +++D +V+ A +   +L RL+ESN  LE+I +GLN+YLE KRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   L+I  M SSE E + + + I   +A+G VE+WLLQV++ MLMSIR VI    E Y    R +WV  W GQVV+C S I+WT EV +A++     L  Y E+ N QI++IV+LVRGKL+   R+TLGAL+ IDVHARDVV  + +  V S NDF W+SQLRY+WE+   ++R+    ++Y YEYLGNS RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTETTKDLAKALA QCVVFNCSDGLDY AM KFFKGLA SGAWACFDEFNRIE+EVLSVVAQQIL I +A+  +++TFMFEGTEL LN  C V ITMNPGYAGR+ELPDNLK LFR VAMMVPDY +IGEISLYS GF  +RSLA KIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+E+E +LLLR++MDVN+ KF++ D+PLF+GII+DLFPGVVL + DY L LKA+ +   K  LQ V +F  KIIQ YEMM+VRHGFM+VGEP GGKT    VLA A+  L +EG  E   V +R INPK++TMGQL+G FD VSHEW+DG+ A +FR+ A     DR+W+IFDGPID +WIE+MNTVLDDNKKLCLMSGEIIQMS  MSLIFE  DL QASPATVSRCGMIY++P  +GW P+  S++ + PE L  ++   + D LF W V  CL F+   C  ++ T  IHL  +L+ L   ++     E  +   ++ + +W QS +LFA+ WS+GG ++ +SR KFD F+R L++G     P P  +     N F    PE G VYDY++  +  G W++W +    ++     G  + + ++PT +T+R  F +   + H   ++ VGPTGTGKSV   + LM+ L  +RY P  +NFSA+TSANQTQ IIMSKLDRRRKGVFGPP+GK  +I+VDD+NMPAKEIYGAQPPIELLRQ+ DH +WYD KDT+++ ++D+  M AMGPPGGGRND+T RF RH N++S+ TF D+T+  IF+++   +     F + +  +G+ MVQAT+ VYK AI + LPTP+KSHY+FNLRDF+RVI G+ L     +++     RLW+HEV RVFYDRL+++ DR   + ++KE    +FK + D L  HLT +    V+++ +RSL FGDY  PD+   ++ Y+E+ +++    +++  + E+NN  K  M+LV+F++ +EH+SRICR+L    G+ LLVG+GGSGRQS T+LA  + +  +FQ E++KNY   +WR++LK L+ K+G EGK T FL +DSQIKDE+F+EDI+ LLNTG+VPN+F  +E+ ++IE ++  AQ   K  D +PL+++ FF++R +  LH+V+A SPIG  FR RLR FP+LINCCTIDWFQAWP+DALE VA K LE +D+EDD+R + V++ K F  SV  LSE ++  L R NYVTPTSYLELI +F+ LLNSK+ E    + RY+ GL KL FA+ QV+ MQ +L  LQP+L++  K  + +MV I +E++  + ++  V A+E++ NE A A+KA+ DEC  DLAEA+PALEAAL+ALDTL+PADIT++KTMQNPP  VKLVME IC+M+ IKPER  DP   GK + D+WGPSKK+LGDM FL  L+ ++KDNI    + KIR++FI +P+F P  +   SSA EGLC+W+ AME Y+RVAKVVAPKK KL +AE +L   M KLN  + +L+ VED+L  L    +    +K  L+  +ELC++KL RA+KLIGGLGGEKDRW +AA  L   Y+NL GDVLLS+  ++YLG FT  YR +C   W  LC   KIP S  F+L   LGN V I++W I GLP D FS DN +IV+N+RRWPLMIDPQ QANKWIKNM K   L+VIKL+D++++R+LENAIQFG PVLLENVGEELD  LEP+LLKQ FKQ GV+ ++LGE+ IEYS++FR YITT LRNPHYLPE+AVKV LLNFMIT  GLEDQLLGIV  KEKPELE+ + +LI+ SA N + LKE E++IL  LS SEGNILE+ETAI +L SSK +S++I +KQ+ A  T+ +ID  RM Y P+A HS+ILFF I+DL NIDPMYQYSL+WF+NLY+ SI  S  S  L  R+  + DHFT  +Y NVCRSLFEKDKLLFS LL   I+  KG ++   + FLLTGGV LEN   NPA  WLSDKSW E+ R + L   +G  E    N+  W+  YDS  PQD ++P  W T +   + ++VLRC RPDK+VPA+  ++ + +G+ +IEPP FDLA S+ DS CC+PLIFVLSPG+DPT  LLKFA+D G GGS+  +ISLGQGQGP+A Q+I  A   G WV+LQNCHLA SWM  +EKICEE +TPENT+T FRLWLTS PS KFPV+VLQNGVKMTNEPP GLR NL +S+++D IS+P FFN    ++  ++KLLFGLCFFHALVQERR FGP+GWNIPY FN+SDLRIS RQ+QMF++EYE+VP +A+ YLTGECNYGGRVTDD DRR LM++L  FY+  +I   +Y+      Y VP    Y  Y+++I+ LP    PEVFG+H N +IT++ Q++  LLD VL+TL + T+SG  S +  + E+A  +L K+P  FD+E     YP+ Y ESMNTVL QE+ RFN+LS  +R SL N  KA++G VVMS ELE + +SLLVGK+PAMW+  SYPSLKPLGSY++D + RL FLQ W + G PS FWVS FYFTQ+FLTGV QNFARKYTIPID +GF+FEV K  +HM  +P DGAYI GLFL+GARWN E M +GE  PKVL++++P+IWLKP +       +N Y CPVYKTS R+G LSTTGHSTN+VL + LP+++P  HWV RG A LCQLD+
Sbjct:   48 LLEEVQRDYEFSLRKSIVDYILLDPAERERLSISAVPQQFPSRVIRAPVP--WSESYQEARSWQTENLFTVNPMLLHLEDLWMSSFSSLRFVNSDSLLSADLPLLPGE----FEEL---VQRQCQNTKDELLNTWLPRCASLFVTFKDAWLPLLPKSSSIAPEKVEKLFRCVAALMSLQLRSLVIASLQDLLQFFQLHQDGNDFGERFDEMQYTQRPVLLVKLKLEDPRISFEPSLQGCWELIQQAFTQIISSAHNIPRVECKLFPEIGETLMLRSVQADEMLV---KDIINTARETFQRNTIGPQRYLE-VYK-KYTHLLDHQD---IVNFLKTKHSQQGFTKKITAVQNVWKDIASLHATVPLSLFCLDAVNLNQDLCDKAEHLIELLTTFVMEENRELNKSICHRYDEITDRITSKPSSTEELVELNKYLKHTSEVTIHKLRHEIEEAVKRLDFLLDYTTIQAEDMKLFSTVIHWPELILSSLEFSRDKLNNQKDEAEIHLMKRIGQLEETLKGLDKEVDIFKIKEKITLEEIKHNVEKLNNIGISLEAALKEIETSNKEESLLDKEQSQFPVLQTIIAKKQPYDQLWITALDFQTKSEMWMNGPFQQLNAETVSEDLGNMWRTMYKLAKSFPER--------------------------------------TAPGRVTENFKKKIDKFKQHLPILTTICNPGLKDRHWEMISNTVGFDVKPDENTPLIKMVELGLSKYSDQLEEIGASASKEYSLEKSLEKMTREWAELHFMFAPYKDTGTSVLSAVDDIQLLLDDHIIKTQTMRGSPFIKPIEAEAKAWEEKLQRMQDILDGMLQCQSMWMYLEPIFSSEDIIAQMPENGRKFAIVDSYWKNIVAESLKDTHVLVATEQPNMLGRLQESNTFLEEIQQGLNSYLETKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFTPDLEITGMISSEKEIVPLIETIYPVKAKGMVEKWLLQVENTMLMSIRAVIKQGMEQYSEMPRKKWVLLWPGQVVICASCIFWTSEVSDAIQNNT--LPSYVEQSNAQITDIVELVRGKLSGGARMTLGALIVIDVHARDVVCKLAQDGVSSLNDFQWISQLRYFWEDGEVMLRMITTAIRYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMSKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAVMRNMKTFMFEGTELSLNPTCCVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYGLIGEISLYSMGFTASRSLAQKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPEEDEIVLLLRALMDVNMAKFVAQDLPLFQGIITDLFPGVVLAKPDYELLLKALHDNIGKMKLQPVPWFISKIIQVYEMMLVRHGFMIVGEPMGGKTSAYKVLAGALGDLYKEGLIEEFAVDFRIINPKAVTMGQLYGCFDPVSHEWSDGVLATSFRQQAQCTNDDRQWIIFDGPIDAVWIENMNTVLDDNKKLCLMSGEIIQMSPKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWTPLRDSYMNTLPESLADEHRTLIAD-LFNWLVQPCLDFIYHECGFLVQTSPIHLAYSLMRLYTCLLDEIFQEGAESMTSQQMTLWLQSLFLFAVVWSLGGTVNGNSRNKFDTFYRNLLMGTITDHPRPMSVKLTKNNGF----PERGTVYDYYFHKQGPGQWNNWTESIAKEDRVIPAGAKVSDLIIPTAETSRQLFFLRTYLSHEVPVLIVGPTGTGKSVINNNFLMS-LSKERYTPICINFSARTSANQTQDIIMSKLDRRRKGVFGPPVGKKCIIYVDDLNMPAKEIYGAQPPIELLRQWIDHHHWYDKKDTSRLDIEDVLYMSAMGPPGGGRNDITGRFTRHLNILSIDTFDDETLSNIFTSITDWHFSNG-FDASFYRLGKIMVQATMAVYKDAIESFLPTPSKSHYIFNLRDFARVIRGVMLCPSTHMQEGDKVIRLWIHEVYRVFYDRLVDNDDRGKFFNIVKERTSAYFKLSLDKLLGHLTLSGK--VEDDSIRSLFFGDYSKPDS--ANKQYDEITDLSTLTEVMDFYLREFNNISKAPMNLVMFQFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFINDYELFQIELTKNYSMSDWRDNLKHLMLKSGIEGKKTTFLFSDSQIKDEAFVEDINMLLNTGDVPNIFPLDERADIIEKMQGIAQMEGKKIDVTPLSMYNFFIDRVKTNLHIVLAMSPIGEDFRNRLRMFPSLINCCTIDWFQAWPKDALEMVANKFLEDLDLEDDIRIEVVEMCKTFQESVRELSERYYSQLRRHNYVTPTSYLELILTFKALLNSKRSEVNELRNRYIVGLQKLDFASSQVAVMQQELTALQPELIETAKQTDQMMVKIEKETVEVDAKKELVSADEKVANEAAAAAKAIKDECEGDLAEAMPALEAALAALDTLKPADITVLKTMQNPPGPVKLVMESICVMKGIKPERKQDPGGSGKMIEDFWGPSKKILGDMKFLESLKTFNKDNIPPASIKKIREKFIDHPDFQPSVIKSVSSACEGLCKWVRAMEVYERVAKVVAPKKEKLKEAEEELAVQMQKLNVKRAELKEVEDRLQALNDTFEGMIQKKKDLEANIELCSQKLVRAEKLIGGLGGEKDRWTEAARLLGIKYNNLTGDVLLSSATVSYLGAFTVDYRVECQQQWLELCNRKKIPYSEDFTLGNTLGNQVLIRSWQIAGLPVDLFSTDNGIIVSNSRRWPLMIDPQGQANKWIKNMNKANKLSVIKLSDSNYVRSLENAIQFGTPVLLENVGEELDAVLEPVLLKQTFKQQGVEYMKLGENTIEYSRDFRFYITTGLRNPHYLPEVAVKVCLLNFMITPLGLEDQLLGIVATKEKPELEEKKNQLILESAANNKQLKEIENQILQVLSSSEGNILEDETAITVLSSSKLLSEEISEKQKIASVTESEIDETRMGYRPVAEHSSILFFCISDLANIDPMYQYSLTWFINLYLQSIAHSVPSDDLQIRIANILDHFTLRVYYNVCRSLFEKDKLLFSLLLTVGIMQGKGQVDDIVWRFLLTGGVALENPHPNPAPEWLSDKSWSEVVRASQLSRLEGLFEHVQENIALWKQIYDSGHPQDEELPGKWHTVV-GMERMVVLRCFRPDKLVPAVQKFIVDNIGRAYIEPPTFDLAESYSDSNCCSPLIFVLSPGSDPTAGLLKFADDLGMGGSRTQTISLGQGQGPVAEQLIKAALSVGHWVVLQNCHLATSWMPTLEKICEEVITPENTHTSFRLWLTSQPSDKFPVSVLQNGVKMTNEPPKGLRANLLRSYLSDPISDPTFFNSS-ARQEIWQKLLFGLCFFHALVQERRTFGPLGWNIPYEFNESDLRISIRQIQMFLDEYEEVPLEALTYLTGECNYGGRVTDDKDRRLLMSLLSIFYSWQLIQQDQYRVCEGDLYYVPSHAPYQSYVDYIRNLPISAEPEVFGLHSNANITKDNQETNQLLDGVLLTLPRQTNSGAKSPQEVVDELAEGMLAKLPCDFDIEMVTNKYPLLYEESMNTVLRQELIRFNRLSKVVRSSLLNTQKALRGQVVMSSELENVFNSLLVGKVPAMWAAKSYPSLKPLGSYVSDFLARLQFLQDWIDNGPPSVFWVSAFYFTQSFLTGVSQNFARKYTIPIDYIGFEFEVCKQETHMEEKPEDGAYIRGLFLEGARWNREHMVIGESVPKVLFDSLPIIWLKPGESATF-LHQNVYVCPVYKTSARRGTLSTTGHSTNYVLSIELPSDQPQKHWVNRGVACLCQLDN 3859          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: xpo7 (exportin 7 [Source:Xenbase;Acc:XB-GENE-491338])

HSP 1 Score: 4923.99 bits (12771), Expect = 0.000e+0
Identity = 2427/3905 (62.15%), Postives = 3030/3905 (77.59%), Query Frame = 2
Query:  248 PKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKE--MDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKN-IREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLI-TLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            P PP PQYPS M         NYYF+KSCV++SP+ P+Q  WL+ +   +   LK+G  KE  + E++ EV  +F  SM+R LV+  L KP V GLE ++  P  E P+GLDFS+ WH SFV+++ E+SK L IL P ++ +L L  +TF + L+ D+     +G ++ ++L+  V L C K ++ ++  WYPKVIN+F   +++  +  +  +SFY C T L+SNQ++++L RTVE++V +F+  N ++LP+ KM L FD  +M FYP+ +DLEE + F++  +++++Q I T+ S + S      I A L +H++ +A   LR +     E PK +F N Y   YS+L++G     +  FL E HSFD+Y  ++E+F  +A+ I  LP   +F +++L+C+DLK GL  +    + ILL R+  DHR+EN  I  +FE I+  A  VPET++++ + IAY+E+A+ + +  L+ +I   K R++YLLD + F PEDL LN+ V  W + I P+FD ND++ E  K K E+ LL +REKL+ EL+K   RV+EF E  E+  EMM+QYV DVRT+Q ++ E  + M++IN EE L+K   +++PE++ +KA  + + + F L+ K+Q++E++W+ G F DL  + ++AE+DEI+RE++K+ K F  + +KA  EK +  + +      + +E    P             +CS  + Q+  FKE +P+++ LC PGI+ RHW +MS I   D+TP+SG++L KVL   L  Y+EEF QIS AAS+EF+LE  M  M E W+T+ FS + YRESG+SIL++VD+IQ  LDDQIVKTQTMRGS FIKPFE EIK WEE+L+   ETID+WLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQ VDRNWK+IM++ V++  V+ A    G+LE+L++SN LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+S+E E +++ + ISTSEARGAVE+WL+QV+DVML S+RDVIA SR AY    R +WV +W GQVVLCVSQ++WT EV EA+  G +GL  Y++K   Q+++IV+LVRG L+ Q RITLGALVTIDVHARDVV DM    V  E DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AM KFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  ++ F FEGTEL+LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG  LP+ADY   L+   E C +HN+Q V  F EK+IQ+YEMMIVRHGFMLVGEPF GKT+VLH+LA+ +S +NE+  DE EKVI+RT+NPKSITMGQLFGQFD VSHEWTDG  ANTFREFA +++P+RKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+P  +GW P+  SWL + PE L+    L +++ LF+W +   LRF+ K CK ++ T + + V +L  L +M++   + +E    N+N++ W  + + F+M WSIGG  D DSR KFD F +E+++GK+   PIP  + ++E    + GLVYDY YE K RG W HWN+  K+ S G+ +  I++ +VPTMDT RY F++DMC+ + + L+FVGPTGTGKSVY +DKLMN L  +++ P F+NFSA+TSANQ Q IIM +LD+RRKGV+GPP+GK  VIFVDDMNMPA E YGAQPPIELLRQ+FDHGNWYDLKDT+KI L DI L+GAMGPPGGGRN VTPRFLRHFNV ++  FSD+TM+RIFS +++ Y++  EF  D+  VG  +V  T+EVYK A+ NLLPTPAKSHY FNLRDFSRVI G  L++KE VE+KR   RL+VHEVLRVFYDRL++D DR WL+KL+K+ +K HFKE FD +FEHL    ++P+ EE  RSL+FGDY+NPD   ++R+Y E+ ++ EF  IVE+C+DEYN THK++M+LVIFRYVLEHLSRICRIL  PGGNALLVGVGGSGRQS+TRLA AMA   +FQPEISK+YG  EWREDLK+LLK AG +G+ TVFL+TD+QIK E+FLED+D+LLNTGEVPNLF  +EK E++E VR AAQAGNK+ +  PLALFAFFVNRC+E LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPEDALERVA+K LE +++ +  + + V I K+FHTS I+LS++F + LGR NYVTPTSYLELI +FR LL+ K+D  M+ KKRY NGLDKLAFA  QV +M+ +L ELQP+L +AK  N  +M  I +ES   E +   V+ +EEI  +KA  ++AL +EC +DLAEAIPALEAALSALDTL+P+D+TIVK+M+NPP+GVKLVM  +C+M+EIKPE++NDP   G+K+LDYWGPSKKLLGDM FL  LREYDKDNI   +M KIR E+ITNP+FDP KV++ASSAAEGLC+WILAME YDRVAKVVAPKK +LA+A+  L   M  LN  + +L+ VED+L  L+   ++  +EK RL+ +V+LCAKKLERA+KLIGGLGGEK RW+ AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R +C   WS +CKS  IPCS  FSL+  LG+P++I++WNI GLP D+FSIDN VIV+N+RRWPLMIDPQ+QANKWIKN E+E  L+VIKLTD+D+MRTLEN IQFG P+LLENVGE+LDPSLEPLLLKQ FKQ GV+ +RLGE+ IEYS +FR YITTKLRNPHYLPE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS++LFFSI DL NIDPMYQYSL+WFVNLYINSI +SNKSK+L+KRLRYL+DHFTY+LY NVCRSLFEKDKLLFSFLLC  +LM+K ++E+ E++FLLTGG+GL+N   NPA SWL +KSWDEICR +DL  FKG +E F      W A YDSK+P  A  P P+  +L+  + ++VLRC+RPDKI PAITNYV EKLGKKF+EPPPFDL++S+ DS    PLIFVLSPGADP  +LLKFA DK  GG KF +ISLGQGQGP+A +MI EA  EGTWV LQNCHLAVSWM  +EKICEE + +  + +FRLWLTSYPSPKFPVT+LQNGVKMTNEPPTGLR NL QS++ D IS+P FF GCPGKE  +EKLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+N+YE VPF+AI YLTGECNYGGRVTDDWDRR L+T L DFYN  +I   +Y FSPSG Y VPPK  Y +YIEFIK LP  Q+PEVFG+HENVDI+++LQ ++ + +S+L+   G       G+S++ L EIANDIL K+P  FD+E A   YPV Y ESMNTVLVQEMERFN L+  IR +LQNL KAIKGLVVM  ELEA++ SL+VGK+P  W+K SYPSLKPLGSY++D + RL FLQ WF  GKP+ FW+SGF+FTQAFLTG MQN+ARKY IPIDL+G++F+VL +   +  P DG YI GLFLDGARW+ +   LGEQ PK+L++AVPVIW+KP KR  I  +++ Y CP+YKTSERKG LSTTGHSTNFV+ + LPT++PV HW+KRG ALLCQLDD
Sbjct:   16 PTPPEPQYPSTM---------NYYFMKSCVESSPVVPIQNHWLEAMLTLVPPALKEGTSKESLISELMQEVSHDFEKSMRRHLVRSVLVKPEVKGLEQEESGPLLESPVGLDFSKPWHKSFVQSKTEISKNLHILRPALRTMLDLGYSTFSQLLIADLSGYRAKGPVECDSLKNNVTLSCSKAEEKLLSTWYPKVINLFTTNEALQLVRPEKTDSFYGCVTTLMSNQLRDVLTRTVESFVKLFDTTNPQYLPLFKMELTFDDEKMDFYPSLEDLEESVLFMLTTMSRTLQTIQTVQSWL-SGGSIQNIEAKLPDHVMQWAHTTLREAVRHNLEGPKMHF-NTYVENYSWLVDGTASQQVDMFLAEEHSFDDYTTFVEQFLQLAKDITNLPVRAHFTMVQLDCDDLKQGLADKAKSFANILLERLVTDHRQENQMICTEFETIKARALKVPETTEDVIEEIAYVEQAKTKDLAELNARIAECKRRMNYLLDVYLFPPEDLTLNATVLLWPQNINPVFDANDELIEKAKRKGESELLAKREKLLLELEKLSRRVEEFAECSEL--EMMQQYVSDVRTVQKRITETEEVMAFINKEEVLYKWDPTVYPELDSLKASIEMYQKFFGLIYKWQRTEKRWMDGAFLDLNGETMDAELDEIFREVYKMMKFFQQKQQKAEQEKKKSSQRRMLTDEKEEEEKKENPTAL----------MCSTVMEQVKAFKEYLPLVSILCNPGIRTRHWHQMSDIVQYDLTPDSGSTLRKVLKQNLTPYLEEFEQISVAASKEFSLEKAMHTMVELWDTISFSTSPYRESGVSILSAVDEIQTTLDDQIVKTQTMRGSTFIKPFEKEIKQWEERLMRIQETIDEWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQTVDRNWKEIMKHCVKEAKVLNATSLPGLLEKLQDSNMLLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIRAMYSTEGEHVELIETISTSEARGAVEKWLVQVEDVMLRSVRDVIARSRLAYPETLRKDWVRDWPGQVVLCVSQMFWTSEVSEAIRDGPQGLRNYYDKLQLQLNDIVELVRGTLSKQTRITLGALVTIDVHARDVVMDMVETGVSHETDFQWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMDLFNFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGTALPEADYQKLLECAHECCRRHNVQPVPVFLEKMIQTYEMMIVRHGFMLVGEPFSGKTKVLHILADTLSLMNEQQCDE-EKVIFRTVNPKSITMGQLFGQFDPVSHEWTDGNVANTFREFALSESPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPLQLGWNPLVKSWLNTLPEALQAKEHLGLLEQLFDWLIQPALRFLRKQCKELVATSNSNAVVSLTRLFEMLLFDCIREEPT--NKNIRTWIMACFAFSMVWSIGGCCDTDSRLKFDAFLKEILMGKSAEHPIPAAVGKWECAFDDKGLVYDYVYELKGRGRWVHWNEFIKSTSLGDKQTKIQDIIVPTMDTVRYTFLMDMCIRYEKPLLFVGPTGTGKSVYVKDKLMNSLDKEKFFPFFINFSARTSANQIQNIIMDRLDKRRKGVYGPPMGKKCVIFVDDMNMPALEKYGAQPPIELLRQFFDHGNWYDLKDTSKISLVDIQLLGAMGPPGGGRNAVTPRFLRHFNVCTINAFSDETMVRIFSAIVAFYLRNNEFPPDFFTVGNQIVNGTMEVYKKAMENLLPTPAKSHYTFNLRDFSRVIQGCLLVQKESVENKRVLVRLFVHEVLRVFYDRLVDDKDRSWLFKLIKDVVKDHFKENFDGVFEHLKQG-SQPLSEEDFRSLLFGDYLNPDLEGDERLYAEIPSVQEFNEIVERCLDEYNQTHKSRMNLVIFRYVLEHLSRICRILKQPGGNALLVGVGGSGRQSMTRLATAMAKMFIFQPEISKSYGMNEWREDLKSLLKNAGVKGQKTVFLITDTQIKQEAFLEDVDSLLNTGEVPNLFAPDEKQEIMEGVRPAAQAGNKNVELGPLALFAFFVNRCKENLHIVVAFSPIGEAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVKFLETLELSEHEQREVVPICKYFHTSAISLSDKFLRDLGRHNYVTPTSYLELIAAFRQLLSQKRDTVMKAKKRYTNGLDKLAFAESQVGEMKKELVELQPKLEEAKVENANMMKIIEKESAEVEAKSKIVRVDEEIATQKATEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMSAVCVMKEIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLREYDKDNIPVAVMQKIRSEYITNPDFDPAKVAKASSAAEGLCKWILAMEVYDRVAKVVAPKKARLAEAQESLANTMALLNTKRAELKEVEDRLAALEATFREKTEEKARLEVQVDLCAKKLERAEKLIGGLGGEKSRWSSAADSLQNTYDNLTGDVLVSAGVIAYLGAFTAGFRQECTRAWSKMCKSKMIPCSDDFSLSKTLGDPIQIRSWNIAGLPTDNFSIDNGVIVSNSRRWPLMIDPQSQANKWIKNSERENQLSVIKLTDSDYMRTLENCIQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGVECIRLGETTIEYSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKVMSNEITKKQQNAEKTEIKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLNWFVNLYINSIQESNKSKILEKRLRYLNDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLMAKKEIETPEFMFLLTGGIGLQNNVPNPAPSWLPEKSWDEICRASDLPAFKGLREHFIGQANEWHAIYDSKEPHAAPFPSPFNNQLNELQKMIVLRCLRPDKISPAITNYVTEKLGKKFVEPPPFDLSKSYMDSSTTIPLIFVLSPGADPMASLLKFANDKAMGGDKFQAISLGQGQGPVATKMIKEALVEGTWVCLQNCHLAVSWMPTLEKICEEFSADTCHPDFRLWLTSYPSPKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPISDPGFFIGCPGKEQIWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINDYETVPFEAISYLTGECNYGGRVTDDWDRRLLLTTLADFYNNDIIEKPRYSFSPSGNYQVPPKSSYEDYIEFIKRLPFSQHPEVFGLHENVDISKDLQQTKTIFESLLLTQGGGRQGGATGASDHTLYEIANDILSKLPKDFDIEAALQKYPVRYEESMNTVLVQEMERFNNLTRTIRTTLQNLQKAIKGLVVMDSELEALSGSLIVGKVPETWAKRSYPSLKPLGSYVSDFLARLKFLQNWFECGKPNVFWLSGFFFTQAFLTGAMQNYARKYRIPIDLIGYEFQVLWSDSADSPPEDGVYINGLFLDGARWDRQRGVLGEQLPKLLFDAVPVIWIKPNKRSDIKKSKS-YLCPLYKTSERKGTLSTTGHSTNFVIGMLLPTDKPVQHWIKRGVALLCQLDD 3892          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: xpo7 (exportin 7 [Source:Xenbase;Acc:XB-GENE-491338])

HSP 1 Score: 4281.09 bits (11102), Expect = 0.000e+0
Identity = 2118/3173 (66.75%), Postives = 2545/3173 (80.21%), Query Frame = 2
Query: 2438 LCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKN-IREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLI-TLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            LC PGI+ RHW +MS I   D+TP+SG++L KVL   L  Y+EEF QIS AAS+EF+LE  M  M E W+T+ FS + YRESG+SIL++VD+IQ  LDDQIVKTQTMRGS FIKPFE EIK    +L+   ETID+WLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQ VDRNWK+IM++ V     + A    G+LE+L++SN LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+S+E E +++ + ISTSEARGAVE+WL+QV+DVML S+RDVIA SR AY    R +WV +W GQVVLCVSQ++WT EV EA+  G +GL  Y++K   Q+++IV+LVRG L+ Q RITLGALVTIDVHARDV+ ++    V  E DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AM KFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  ++ F FEGTEL+LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG  LP+ADY   L+   E C +HN+Q V  F EK+IQ+YEMMIVRHGFMLVGEPF GKT+VLH+LA+ +S +NE+  DE EKVI+RT+NPKSITMGQLFGQFD VSHEWTDG  ANTFREFA +++P+RKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+P  +GW P+  SWL + PE L+    L +  + F   +     +V    K ++ T + + V +L  L +M++   + +E    N+N++ W  + + F+M WSIGG  D DSR KFD F +E+++GK+   PIP  + ++E    + GLVYDY YE   RG W HWN+  K+ S G+ +  I++ +VPTMDT RY F++D+ +   + L+FVGPTGTGKSVY +DKLMN L  +++ P F+NFSA+TSANQ Q IIM +LD+RRKGV+GPP+GK  VIFVDDMNMPA E YGAQPPIELLRQ+FDHGNWYDLKDT+KI L DI L+GAMGPPGGGRN VTPRFLRHFNV ++  FSD+TM+RIFS +++ Y++  EF  D+  VG  +V  T+EVYK A+ NLLPTPAKSHY FNLRDFSRVI G  L++KE VE+KR   RL+VHEVLRVFYDRL++D DR WL+KL+K+ +K HFKE FD +FEHL    ++PVKE+  RSL+FGDY+NPD   ++R+Y E+ ++ EF  IVE+C+DEYN THK++M+LVIFRYVLEHLSRICRIL  PGGNALLVGVGGSGRQS+TRLA AMA   +FQPEISK+YG  EWREDLK     AG +G+ TVFL+TD+QIK E+FLED+D+LLNTGEVPNLF  +EK E++EL               PLALFAFFVNRC+E LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPEDALERVA+K LE +++ +  + + V I K+FHTS I+LS++F + LGR NYVTPTSYLELI +FR LL+ K+D  M+ KKRY NGLDKLAFA  QV +M+ +L ELQP+L +AK  N  +M  I +ES   E +   V+ +EEI  +KA  ++AL +EC +DLAEAIPALEAALSALDTL+P+D+TIVK+M+NPP+GVKLVM  +C+M+EIKPE++NDP   G+K+LDYWGPSKKLLGDM FL  LREYDKDNI   +M KIR E+ITNP+FDP KV++ASSAAEGLC+WILAME YDRVAKVVAPKK +LA+A+  L   M  LN  + +L+ VED+L  L+   ++  +EK RL+ +V+LCAKKLERA+KLIGGLGGEK RW+ AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R +C   WS +CKS  IPCS  FSL+  LG+P++I++WNI GLP D+FSIDN VIV+N+RRWPLMIDPQ+QANKWIKN E+E  L+VIKLTD+D+MRTLEN IQFG P+LLENVGE+LDPSLEPLLLKQ FKQ GV+ +RLGE+ IEYS +FR YITTKLRNPHYLPE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS++LFFSI DL NIDPMYQYSL+WFVNLYINSI +SNKSK+L+KRLRYL+DHFTY+LY NVCRSLFEKDKLLFSFLLC  +LM+K ++E+ E++FLLTGG+GL+N   NPA SWL +KSWDEICR +DL  FKG +E F      W A YDSK+P  A  P P+  +L+  + ++VLRC+RPDKI PAITNYV EKLGKKF+EPPPFDL++S+ DS    PLIFVLSPGADP  +LLKFA DK  GG KF +ISLGQGQGP+A +MI EA  EGTWV LQNCHLAVSWM  +EKICEE + +  + +FRLWLTSYPSPKFPVT+LQNGVKMTNEPPTGLR NL QS++ D IS+P FF GCPGKE   +KLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+N+YE VPF+AI YLTGECNYGGRVTDDWDRR L+T L DFYN  +I   +Y FSPSG Y VPPK  Y +YIEFIK LP  Q+PEVFG+HENVDI+++LQ ++ + +S+L+   G       G+S++ L EIANDIL K+P  FD+E A   YPV Y ESMNTVLVQEMERFN L+  IR +LQNL KAIKGLVVM  ELEA++ SL+VGK+P  W+K SYPSLKPLGSY++D + RL FLQ WF  GKP+ FW+SGF+FTQAFLTG MQN+ARKY IPIDL+G++F+VL +   +  P DG YI GLFLDGARW+ +   LGEQ PK+L++AVPVIW+KP KR  I  +++ Y CP+YKTSERKG LSTTGHSTNFV+ + LPT++PV HW+KRG ALLCQLDD
Sbjct:  202 LCNPGIRTRHWHQMSDIVQYDLTPDSGSTLRKVLKQNLTPYLEEFEQISVAASKEFSLEKAMHTMVELWDTISFSTSPYRESGVSILSAVDEIQTTLDDQIVKTQTMRGSTFIKPFEKEIK----RLMRIQETIDEWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQTVDRNWKEIMKHCV-----LNATSLPGLLEKLQDSNMLLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIRAMYSTEGEHVELIETISTSEARGAVEKWLVQVEDVMLRSVRDVIARSRLAYPETLRKDWVRDWPGQVVLCVSQMFWTSEVSEAIRDGPQGLRNYYDKLQLQLNDIVELVRGTLSKQTRITLGALVTIDVHARDVLYNLSLAGVSHETDFQWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMDLFNFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGTALPEADYQKLLECAHECCRRHNVQPVPVFLEKMIQTYEMMIVRHGFMLVGEPFSGKTKVLHILADTLSLMNEQQCDE-EKVIFRTVNPKSITMGQLFGQFDPVSHEWTDGNVANTFREFALSESPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPLQLGWNPLVKSWLNTLPEALQAKEHLGLF-MFFSSILVTISYYVL--LKELVATSNSNAVVSLTRLFEMLLFDCIREEPT--NKNIRTWIMACFAFSMVWSIGGCCDTDSRLKFDAFLKEILMGKSAEHPIPAAVGKWECAFDDKGLVYDYVYEG--RGRWVHWNEFIKSTSLGDKQTKIQDIIVPTMDTVRYTFLMDITLLSPRPLLFVGPTGTGKSVYVKDKLMNSLDKEKFFPFFINFSARTSANQIQNIIMDRLDKRRKGVYGPPMGKKCVIFVDDMNMPALEKYGAQPPIELLRQFFDHGNWYDLKDTSKISLVDIQLLGAMGPPGGGRNAVTPRFLRHFNVCTINAFSDETMVRIFSAIVAFYLRNNEFPPDFFTVGNQIVNGTMEVYKKAMENLLPTPAKSHYTFNLRDFSRVIQGCLLVQKESVENKRVLVRLFVHEVLRVFYDRLVDDKDRSWLFKLIKDVVKDHFKENFDGVFEHLKQG-SQPVKED-FRSLLFGDYLNPDLEGDERLYAEIPSVQEFNEIVERCLDEYNQTHKSRMNLVIFRYVLEHLSRICRILKQPGGNALLVGVGGSGRQSMTRLATAMAKMFIFQPEISKSYGMNEWREDLKN----AGVKGQKTVFLITDTQIKQEAFLEDVDSLLNTGEVPNLFAPDEKQEIMEL--------------GPLALFAFFVNRCKENLHIVVAFSPIGEAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVKFLETLELSEHEQREVVPICKYFHTSAISLSDKFLRDLGRHNYVTPTSYLELIAAFRQLLSQKRDTVMKAKKRYTNGLDKLAFAESQVGEMKKELVELQPKLEEAKVENANMMKIIEKESAEVEAKSKIVRVDEEIATQKATEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMSAVCVMKEIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLREYDKDNIPVAVMQKIRSEYITNPDFDPAKVAKASSAAEGLCKWILAMEVYDRVAKVVAPKKARLAEAQESLANTMALLNTKRAELKEVEDRLAALEATFREKTEEKARLEVQVDLCAKKLERAEKLIGGLGGEKSRWSSAADSLQNTYDNLTGDVLVSAGVIAYLGAFTAGFRQECTRAWSKMCKSKMIPCSDDFSLSKTLGDPIQIRSWNIAGLPTDNFSIDNGVIVSNSRRWPLMIDPQSQANKWIKNSERENQLSVIKLTDSDYMRTLENCIQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGVECIRLGETTIEYSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKVMSNEITKKQQNAEKTEIKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLNWFVNLYINSIQESNKSKILEKRLRYLNDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLMAKKEIETPEFMFLLTGGIGLQNNVPNPAPSWLPEKSWDEICRASDLPAFKGLREHFIGQANEWHAIYDSKEPHAAPFPSPFNNQLNELQKMIVLRCLRPDKISPAITNYVTEKLGKKFVEPPPFDLSKSYMDSSTTIPLIFVLSPGADPMASLLKFANDKAMGGDKFQAISLGQGQGPVATKMIKEALVEGTWVCLQNCHLAVSWMPTLEKICEEFSADTCHPDFRLWLTSYPSPKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPISDPGFFIGCPGKE---QKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINDYETVPFEAISYLTGECNYGGRVTDDWDRRLLLTTLADFYNNDIIEKPRYSFSPSGNYQVPPKSSYEDYIEFIKRLPFSQHPEVFGLHENVDISKDLQQTKTIFESLLLTQGGGRQGGATGASDHTLYEIANDILSKLPKDFDIEAALQKYPVRYEESMNTVLVQEMERFNNLTRTIRTTLQNLQKAIKGLVVMDSELEALSGSLIVGKVPETWAKRSYPSLKPLGSYVSDFLARLKFLQNWFECGKPNVFWLSGFFFTQAFLTGAMQNYARKYRIPIDLIGYEFQVLWSDSADSPPEDGVYINGLFLDGARWDRQRGVLGEQLPKLLFDAVPVIWIKPNKRSDIKKSKS-YLCPLYKTSERKGTLSTTGHSTNFVIGMLLPTDKPVQHWIKRGVALLCQLDD 3333          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: xpo7 (exportin 7 [Source:Xenbase;Acc:XB-GENE-491338])

HSP 1 Score: 4247.58 bits (11015), Expect = 0.000e+0
Identity = 2110/3197 (66.00%), Postives = 2540/3197 (79.45%), Query Frame = 2
Query: 2438 LCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQ------------------------SAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKN-IREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLI-TLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            LC PGI+ RHW +MS I   D+TP+SG++L KVL   L  Y+EEF QIS AAS+EF+LE  M  M E W+T+ FS + YRESG+SIL++VD+IQ  LDDQIVKTQTMRGS FIKPFE EIK    +L+   ETID+WLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQ VDRNWK+IM++ V++  V+ A    G+LE+L++SN LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+S+E E +++ + ISTSEARGAVE+WLL  +     SI       R AY    R +WV +W GQVVLCVSQ++WT EV EA+  G +GL  Y++K   Q+++IV+LVRG L+ Q RITLGALVTIDVHARDV+ ++    V  E DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AM KFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  ++ F FEGTEL+LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG  LP+ADY   L+   E C +HN+Q V  F EK+IQ+YEMMIVRHGFMLVGEPF GKT+VLH+LA+ +S +NE+  DE EKVI+RT+NPKSITMGQLFGQFD VSHEWTDG  ANTFREFA +++P+RKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+P  +GW P+  SWL + PE L+    L +  + F   +     +V    K ++ T + + V +L  L +M++   + +E    N+N++ W                          + + F+M WSIGG  D DSR KFD F +E+++GK+    I +               + +  + K RG W HWN+  K+ S G+ +  I++ +VPTMDT RY F++D+ +   + L+FVGPTGTGKSVY +DKLMN L  +++ P F+NFSA+TSANQ Q IIM +LD+RRKGV+GPP+GK  VIFVDDMNMPA E YGAQPPIELLRQ+FDHGNWYDLKDT+KI L DI L+GAMGPPGGGRN VTPRFLRHFNV ++  FSD+TM+RIFS +++ Y++  EF  D+  VG  +V  T+EVYK A+ NLLPTPAKSHY FNLRDFSRVI G  L++KE VE+KR   RL+VHEVLRVFYDRL++D DR WL+KL+K+ +K HFKE FD +FEHL    ++PVKE+  RSL+FGDY+NPD   ++R+Y E+ ++ EF  IVE+C+DEYN THK++M+LVIFRYVLEHLSRICRIL  PGGNALLVGVGGSGRQS+TRLA AMA   +FQPEISK+YG  EWREDLK+LLK AG +G+ TVFL+TD+QIK E+FLED+D+LLNTGEVPNLF  +EK E++E VR AAQAGNK+ +  PLALFAFFVNRC+E LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPEDALERVA+K LE +++ +  + + V I K+FHTS I+LS++F + LGR NYVTPTSYLELI +FR LL+ K+D  M+ KKRY NGLDKLAFA  QV +M+ +L ELQP+L +AK  N  +M  I +ES   E +   V+ +EEI  +KA  ++AL +EC +DLAEAIPALEAALSALDTL+P+D+TIVK+M+NPP+GVKLVM  +C+M+EIKPE++NDP   G+K+LDYWGPSKKLLGDM FL  LREYDKDNI   +M KIR E+ITNP+FDP KV++ASSAAEGLC+WILAME YDRVAKVVAPKK +LA+A+  L   M  LN  + +L+ VED+L  L+   ++  +EK RL+ +V+LCAKKLERA+KLIGGLGGEK RW+ AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R +C   WS +CKS  IPCS  FSL+  LG+P++I++WNI GLP D+FSIDN VIV+N+RRWPLMIDPQ+QANKWIKN E+E  L+VIKLTD+D+MRTLEN IQFG P+LLENVGE+LDPSLEPLLLKQ FKQ GV+ +RLGE+ IEYS +FR YITTKLRNPHYLPE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS++LFFSI DL NIDPMYQYSL+WFVNLYINSI +SNKSK+L+KRLRYL+DHFTY+LY NVCRSLFEKDKLLFSFLLC  +LM+K ++E+ E++FLLTGG+GL+N   NPA SWL +KSWDEICR +DL  FKG +E F      W A YDSK+P  A  P P+  +L+  + ++VLRC+RPDKI PAITNYV EKLGKKF+EPPPFDL++S+ DS    PLIFVLSPGADP  +LLKFA DK  GG KF +ISLGQGQGP+A +MI EA  EGTWV LQNCHLAVSWM  +EKICEE + +  + +FRLWLTSYPSPKFPVT+LQNGVKMTNEPPTGLR NL QS++ D IS+P FF GCPGKE   +KLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+N+YE VPF+AI YLTGECNYGGRVTDDWDRR L+T L DFYN  +I   +Y FSPSG Y VPPK  Y +YIEFIK LP  Q+PEVFG+HENVDI+++LQ ++ + +S+L+   G       G+S++ L EIANDIL K+P  FD+E A   YPV Y ESMNTVLVQEMERFN L+  IR +LQNL KAIKGLVVM  ELEA++ SL+VGK+P  W+K SYPSLKPLGSY++D + RL FLQ WF  GKP+ FW+SGF+FTQAFLTG MQN+ARKY IPIDL+G++F+VL +   +  P DG YI GLFLDGARW+ +   LGEQ PK+L++AVPVIW+KP KR  I  +++ Y CP+YKTSERKG LSTTGHSTNFV+ + LPT++PV HW+KRG ALLCQLDD
Sbjct:  137 LCNPGIRTRHWHQMSDIVQYDLTPDSGSTLRKVLKQNLTPYLEEFEQISVAASKEFSLEKAMHTMVELWDTISFSTSPYRESGVSILSAVDEIQTTLDDQIVKTQTMRGSTFIKPFEKEIK----RLMRIQETIDEWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQTVDRNWKEIMKHCVKE--VLNATSLPGLLEKLQDSNMLLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIRAMYSTEGEHVELIETISTSEARGAVEKWLLTPEKNH-PSIHSY-GIIRSAYPETLRKDWVRDWPGQVVLCVSQMFWTSEVSEAIRDGPQGLRNYYDKLQLQLNDIVELVRGTLSKQTRITLGALVTIDVHARDVLYNLSLAGVSHETDFQWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMDLFNFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGTALPEADYQKLLECAHECCRRHNVQPVPVFLEKMIQTYEMMIVRHGFMLVGEPFSGKTKVLHILADTLSLMNEQQCDE-EKVIFRTVNPKSITMGQLFGQFDPVSHEWTDGNVANTFREFALSESPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPLQLGWNPLVKSWLNTLPEALQAKEHLGLF-MFFSSILVTISYYVL--LKELVATSNSNAVVSLTRLFEMLLFDCIREEPT--NKNIRTWIMVSHIIKHLKPQIIQSPASLVAAIFACFAFSMVWSIGGCCDTDSRLKFDAFLKEILMGKSAEHYIKE---------------FAFSLQLKGRGRWVHWNEFIKSTSLGDKQTKIQDIIVPTMDTVRYTFLMDITLLSPRPLLFVGPTGTGKSVYVKDKLMNSLDKEKFFPFFINFSARTSANQIQNIIMDRLDKRRKGVYGPPMGKKCVIFVDDMNMPALEKYGAQPPIELLRQFFDHGNWYDLKDTSKISLVDIQLLGAMGPPGGGRNAVTPRFLRHFNVCTINAFSDETMVRIFSAIVAFYLRNNEFPPDFFTVGNQIVNGTMEVYKKAMENLLPTPAKSHYTFNLRDFSRVIQGCLLVQKESVENKRVLVRLFVHEVLRVFYDRLVDDKDRSWLFKLIKDVVKDHFKENFDGVFEHLKQG-SQPVKED-FRSLLFGDYLNPDLEGDERLYAEIPSVQEFNEIVERCLDEYNQTHKSRMNLVIFRYVLEHLSRICRILKQPGGNALLVGVGGSGRQSMTRLATAMAKMFIFQPEISKSYGMNEWREDLKSLLKNAGVKGQKTVFLITDTQIKQEAFLEDVDSLLNTGEVPNLFAPDEKQEIMEGVRPAAQAGNKNVELGPLALFAFFVNRCKENLHIVVAFSPIGEAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVKFLETLELSEHEQREVVPICKYFHTSAISLSDKFLRDLGRHNYVTPTSYLELIAAFRQLLSQKRDTVMKAKKRYTNGLDKLAFAESQVGEMKKELVELQPKLEEAKVENANMMKIIEKESAEVEAKSKIVRVDEEIATQKATEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMSAVCVMKEIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLREYDKDNIPVAVMQKIRSEYITNPDFDPAKVAKASSAAEGLCKWILAMEVYDRVAKVVAPKKARLAEAQESLANTMALLNTKRAELKEVEDRLAALEATFREKTEEKARLEVQVDLCAKKLERAEKLIGGLGGEKSRWSSAADSLQNTYDNLTGDVLVSAGVIAYLGAFTAGFRQECTRAWSKMCKSKMIPCSDDFSLSKTLGDPIQIRSWNIAGLPTDNFSIDNGVIVSNSRRWPLMIDPQSQANKWIKNSERENQLSVIKLTDSDYMRTLENCIQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGVECIRLGETTIEYSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKVMSNEITKKQQNAEKTEIKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLNWFVNLYINSIQESNKSKILEKRLRYLNDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLMAKKEIETPEFMFLLTGGIGLQNNVPNPAPSWLPEKSWDEICRASDLPAFKGLREHFIGQANEWHAIYDSKEPHAAPFPSPFNNQLNELQKMIVLRCLRPDKISPAITNYVTEKLGKKFVEPPPFDLSKSYMDSSTTIPLIFVLSPGADPMASLLKFANDKAMGGDKFQAISLGQGQGPVATKMIKEALVEGTWVCLQNCHLAVSWMPTLEKICEEFSADTCHPDFRLWLTSYPSPKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPISDPGFFIGCPGKE---QKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINDYETVPFEAISYLTGECNYGGRVTDDWDRRLLLTTLADFYNNDIIEKPRYSFSPSGNYQVPPKSSYEDYIEFIKRLPFSQHPEVFGLHENVDISKDLQQTKTIFESLLLTQGGGRQGGATGASDHTLYEIANDILSKLPKDFDIEAALQKYPVRYEESMNTVLVQEMERFNNLTRTIRTTLQNLQKAIKGLVVMDSELEALSGSLIVGKVPETWAKRSYPSLKPLGSYVSDFLARLKFLQNWFECGKPNVFWLSGFFFTQAFLTGAMQNYARKYRIPIDLIGYEFQVLWSDSADSPPEDGVYINGLFLDGARWDRQRGVLGEQLPKLLFDAVPVIWIKPNKRSDIKKSKS-YLCPLYKTSERKGTLSTTGHSTNFVIGMLLPTDKPVQHWIKRGVALLCQLDD 3298          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: xpo7 (exportin 7 [Source:Xenbase;Acc:XB-GENE-491338])

HSP 1 Score: 4191.73 bits (10870), Expect = 0.000e+0
Identity = 2089/3191 (65.47%), Postives = 2508/3191 (78.60%), Query Frame = 2
Query: 2438 LCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQ-------------------SAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKN-IREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            LC PGI+ RHW +MS I   D+TP+SG++L KVL   L  Y+EEF QIS AAS+EF+LE  M  M E W+T+ FS + YRESG+SIL++VD+IQ  LDDQIVKTQTMRGS FIKPFE EIK WEE+L+   ETID+WLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQ VDRNWK+IM++ V++  V+ A    G+LE+L++SN LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+S+E E +++ + ISTSEARGAVE+WL+QV+DVML S+RDVIA SR AY    R +WV +W GQVVLCVSQ++WT EV EA+  G             Q+++IV+LVRG L+ Q RITLGALVTIDVHARDV   +CR  V  E DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AM KFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  ++ F FEGTEL+LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG  LP+ADY   L+   E C +HN+Q V  F EK+IQ+YEMMIVRHGFMLVGEPF GKT+VLH+LA+ +S +NE+  DE EKVI+RT+NPKSITMGQLFGQFD VSHEWTDG  ANTFREFA +++P+RKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+P  +GW P+  SWL + PE L+    L +++ LF+W +   LRF+ K CK  + + +   V +L  L +M++   + +E    N+N++ W                     + + F+M WSIGG  D DSR KFD F +E+++GK+   PIP  + ++E    + GLVYDY    K RG W HWN+  K+ S G+ +  I++ +VPTMDT RY F++D+       L+FVGPTGTGKSVY +DKLMN L  +++ P F+NFSA+TSANQ Q IIM +LD+RRKGV+GPP+GK  VIFVDDMNMPA E YGAQPPIELLRQ+FDHGNWYDLKDT+KI L DI L+GAMGPPGGGRN VTPRFLRHFNV ++  FSD+TM+RIFS +++ Y++  EF  D+  VG  +V  T+EVYK A+ NLLPTPAKSHY FNLRDFSRVI G  L++KE VE+KR   RL+VHEVLRVFYDRL++D DR WL+KL+K+     +       F H             +  L+    MN        +Y     + EF  IVE+C+DEYN THK++M+LVIFRYVLEHLSRICRIL  PGGNALLVGVGGSGRQS+TRLA AMA   +FQPEISK+YG  EWREDLK     AG +G+ TVFL+TD+QIK E+FLED+D+LLNTGEVPNLF  +EK E++E       AGNK+ +  PLALFAFFVNRC+E LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPEDALERVA+K LE +++ +  + + V I K+FHTS I+LS+   K LGR NYVTPTSYLELI +FR LL+ K+D  M+ KKRY NGLDKLAFA  QV +M+ +L ELQP+L +AK  N  +M  I +ES   E +   V+ +EEI  +KA  ++AL +EC +DLAEAIPALEAALSALDTL+P+D+TIVK+M+NPP+GVKLVM  +C+M+EIKPE++NDP   G+K+LDYWGPSKKLLGDM FL  LREYDKDNI    ++KIR E+ITNP+FDP KV++ASSAAEGLC+WILAME YDRVAKVVAPKK +LA+A+  L   M  LN  + +L+ VED+L  L+   ++  +EK RL+ +V+LCAKKLERA+KLIGGLGGEK RW+ AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R +C   WS +CKS  IPCS  FSL+  LG+P++I++WNI GLP D+FSIDN VIV+N+RRWPLMIDPQ+QANKWIKN E+E  L+VIKLTD+D+MRTLEN IQFG P+LLENVGE+LDPSLEPLLLKQ FKQ GV+ +RLGE+ IEYS +FR YITTKLRNPHYLPE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS++LFFSI DL NIDPMYQYSL+WFVNLYINSI +SNKSK+L+KRLRYL+DHFTY+LY NVCRSLFEKDKLLFSFLLC  +LM+K ++E+ E++FLLTGG+GL+N   NPA SWL +KSWDEICR +DL  FKG KE    +   W A YDSK+P  A  P P+  +L+  + ++VLRC+RPDKI PAITNYV EKLGKKF+EPPPFDL++S+ DS    PLIFVLSPGADP  +LLKFA DK  GG KF +ISLGQGQGP+A +MI EA  EGTWV LQNCHLAVSWM  +EKICEE + +  + +FRLWLTSYPSPKFPVT+LQNGVKMTNEPPTGLR NL QS++ D IS+P FF GCPGKE  +EKLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+N+YE VPF+AI YLTGECNYGGRVTDDWDRR L+T L DFYN  +I   +Y FSPSG Y VPPK  Y +YIEFIK LP  Q+PEVFG+HENVDI+++LQ ++ + +S+L+T G  +               + +  ++P  FD+E A   YPV Y ESMNTVLVQEMERFN L+  IR +LQNL KAIKGLVVM  ELEA++ SL+VGK+P  W+K SYPSLKPLGSY++D + RL FLQ WF  GKP+ FW+SGF+FTQAFLTG MQN+ARKY IPIDL+G++F+VL +   +  P DG YI GLFLDGARW+ +   +    PK+L++AVPVIW+KP++ D+  +    Y CP+YKTSERKG LSTTGHSTNFV+ + LPT++PV HW+KRG ALLCQLDD
Sbjct:   79 LCNPGIRTRHWHQMSDIVQYDLTPDSGSTLRKVLKQNLTPYLEEFEQISVAASKEFSLEKAMHTMVELWDTISFSTSPYRESGVSILSAVDEIQTTLDDQIVKTQTMRGSTFIKPFEKEIKQWEERLMRIQETIDEWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQTVDRNWKEIMKHCVKEAKVLNATSLPGLLEKLQDSNMLLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIRAMYSTEGEHVELIETISTSEARGAVEKWLVQVEDVMLRSVRDVIARSRLAYPETLRKDWVRDWPGQVVLCVSQMFWTSEVSEAIRDG------------PQLNDIVELVRGTLSKQTRITLGALVTIDVHARDV--RLCRHGVSHETDFQWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMDLFNFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGTALPEADYQKLLECAHECCRRHNVQPVPVFLEKMIQTYEMMIVRHGFMLVGEPFSGKTKVLHILADTLSLMNEQQCDE-EKVIFRTVNPKSITMGQLFGQFDPVSHEWTDGNVANTFREFALSESPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPLQLGWNPLVKSWLNTLPEALQAKEHLGLLEQLFDWLIQPALRFLRKQCKVCVNSNA---VVSLTRLFEMLLFDCIREEPT--NKNIRTWIMVSHIIKHLKPQIIQSPASLACFAFSMVWSIGGCCDTDSRLKFDAFLKEILMGKSAEHPIPAAVGKWECAFDDKGLVYDYL---KGRGRWVHWNEFIKSTSLGDKQTKIQDIIVPTMDTVRYTFLMDI------PLLFVGPTGTGKSVYVKDKLMNSLDKEKFFPFFINFSARTSANQIQNIIMDRLDKRRKGVYGPPMGKKCVIFVDDMNMPALEKYGAQPPIELLRQFFDHGNWYDLKDTSKISLVDIQLLGAMGPPGGGRNAVTPRFLRHFNVCTINAFSDETMVRIFSAIVAFYLRNNEFPPDFFTVGNQIVNGTMEVYKKAMENLLPTPAKSHYTFNLRDFSRVIQGCLLVQKESVENKRVLVRLFVHEVLRVFYDRLVDDKDRSWLFKLIKD-----YNSLSQYCFSH------------KMSPLIIASLMN------GSLY-----VQEFNEIVERCLDEYNQTHKSRMNLVIFRYVLEHLSRICRILKQPGGNALLVGVGGSGRQSMTRLATAMAKMFIFQPEISKSYGMNEWREDLKN----AGVKGQKTVFLITDTQIKQEAFLEDVDSLLNTGEVPNLFAPDEKQEIME-------AGNKNVELGPLALFAFFVNRCKENLHIVVAFSPIGEAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVKFLETLELSEHEQREVVPICKYFHTSAISLSD---KDLGRHNYVTPTSYLELIAAFRQLLSQKRDTVMKAKKRYTNGLDKLAFAESQVGEMKKELVELQPKLEEAKVENANMMKIIEKESAEVEAKSKIVRVDEEIATQKATEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMSAVCVMKEIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLREYDKDNIP---VSKIRSEYITNPDFDPAKVAKASSAAEGLCKWILAMEVYDRVAKVVAPKKARLAEAQESLANTMALLNTKRAELKEVEDRLAALEATFREKTEEKARLEVQVDLCAKKLERAEKLIGGLGGEKSRWSSAADSLQNTYDNLTGDVLVSAGVIAYLGAFTAGFRQECTRAWSKMCKSKMIPCSDDFSLSKTLGDPIQIRSWNIAGLPTDNFSIDNGVIVSNSRRWPLMIDPQSQANKWIKNSERENQLSVIKLTDSDYMRTLENCIQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGVECIRLGETTIEYSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKVMSNEITKKQQNAEKTEIKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLNWFVNLYINSIQESNKSKILEKRLRYLNDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLMAKKEIETPEFMFLLTGGIGLQNNVPNPAPSWLPEKSWDEICRASDLPAFKGNKE----DANEWHAIYDSKEPHAAPFPSPFNNQLNELQKMIVLRCLRPDKISPAITNYVTEKLGKKFVEPPPFDLSKSYMDSSTTIPLIFVLSPGADPMASLLKFANDKAMGGDKFQAISLGQGQGPVATKMIKEALVEGTWVCLQNCHLAVSWMPTLEKICEEFSADTCHPDFRLWLTSYPSPKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPISDPGFFIGCPGKEQIWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINDYETVPFEAISYLTGECNYGGRVTDDWDRRLLLTTLADFYNNDIIEKPRYSFSPSGNYQVPPKSSYEDYIEFIKRLPFSQHPEVFGLHENVDISKDLQQTKTIFESLLLTQGGGSHFP-----------PHVVFIQLPKDFDIEAALQKYPVRYEESMNTVLVQEMERFNNLTRTIRTTLQNLQKAIKGLVVMDSELEALSGSLIVGKVPETWAKRSYPSLKPLGSYVSDFLARLKFLQNWFECGKPNVFWLSGFFFTQAFLTGAMQNYARKYRIPIDLIGYEFQVLWSDSADSPPEDGVYINGLFLDGARWDRQRSVIS--LPKLLFDAVPVIWIKPSESDIKKS--KSYLCPLYKTSERKGTLSTTGHSTNFVIGMLLPTDKPVQHWIKRGVALLCQLDD 3176          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: olfm4 (olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072])

HSP 1 Score: 4095.43 bits (10620), Expect = 0.000e+0
Identity = 2097/3927 (53.40%), Postives = 2759/3927 (70.26%), Query Frame = 2
Query:  305 RMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKP---------NVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFL----PILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDS--------IINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHL--IRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAEN---RNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIG--KNES-------FPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWND-LNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQ-EFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGN--KDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENR--YKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            R NYY +   +    + PM++ WL+N+   +  HL   R+  ++ +  E+++++  S+K+++V   LK P         N+P     ++VP P           W  SF+ N   + + L  + P M  +L L +++FG+  + D    H+ + +M+    +  V    +   D ++K W+P++ NIF   N+RK +P      K ESF+NC   L++ Q+++L   +++ + D+  +     L    P   + L  D+  ++F P++++ E  +  + + + +++  +P +++        I  S  +P+    +L  H  A  KE +   +    E  K Y K      Y++LI+ + + ++ +FL E H+F+E    + K++ +  +I+   + ++  L    L C++L   L K +  +S  L+ ++   H++ N  + ++FE I + A + P ++ EL DL AY+ +   Q M+ + +K+  +K RL +L+D   FSP D++LN+  F W  ++  IF+ + +I +    + +  L  R EK + EL+    +V+EF  +G+M  + + +Y++  +TL SKL +A  ++  +N EEE F    S +P+ ++I+   +P+++L+++  ++    + W+ G +  +  D +E +V   +R L+K++K FN                                        P+AL + +K   ++ EFKE +P+I  +C PG++ RHWD MS+I    I P   T++ K + + L  ++E+F  IS AAS+EF+LE  M+KM  EW+ +EF L  YRE+G  IL+SVDDIQ LLDD +VKTQTMRGSPFIK FE EI+ WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F  VD+ W+D+M+  + D +V+       +LE+ K+SN  LE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA +EF + LDI  + SSE E +++   ISTS+ARG VE+WL++V+  M+ S+  VI  + EAY    R +WV EW GQ VLCVSQ +WT EV  ++++G + L  Y EK NKQI +IV LVRG L+ Q R+TLGALV +DVHARDV+  + +K+V  ENDF WLSQLRYYWEE +   ++ NA ++Y YEYLGN+ RLVITPLTDRCYRTL GA +L+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I R I       +FEGTEL+LN  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS GF+ AR L+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+E+E ILLLRSI+DVNLPKFLS D+PLF GI SDLFPGV LP+ADY +F+ A+ E C   NLQ   FF+EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A++ + E+G  +  KV    +NPKSITMGQL+GQFD VSHEW+DGI A ++R FAS+ +PDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  MSLIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SWL   P  L + +  + ++ LF+  V  CL+ + K  K + PT   +LV++L+NL+D +M      E + +N   R +  W +  +LF++ WS+GG    D R KFD   RE+I G    ES        P+      F V +P+   VYDY +  +  G W  W + L+   S        E +VPT+DT RY  ++++   H++S +FVGPTGTGKS Y  D L+N L  + Y P  +NFSAQT+A QTQ IIMSKLD+RRKGVFGPP+GK  V+FVDD+NMPA+E+YGAQPP+ELLRQ+ DH NWYDLKD + I L DI +M AMGP GGGRN +TPRFLRHFN V++  F D++M  IFS ++  ++  +  F ++Y A+   ++ +T+ VYK A+ +LLPTPAKSHY+FNLRDFSRVI GICL + E  +      RLWVHEVLRV++DRL+++ DR WL   ++E +K H +E F+ LF+HL    +  V+E+ LRSLMF D+   D   ED  Y+E+ ++ +   +VE  ++E+NN  K  M+LV+FR+ +EH+ RI RIL  P  +ALLVGVGGSGRQSLTRLA  MA+  +FQ EISK+YG  EWREDLK +L+K+       VFL TDSQIK ESFLEDI+NLLN GEVPNLF  +EK E+ E +RQ  +  +  K  D SPLALF  F++RCR++LHVV+A SPIG AFR RLR+FPAL+NCCTIDWFQ WPEDAL+ VA + LE V++ +++RN  + + K FHTS INLS+ F   L R NYVTPTSYLELI++F+TLL  KQ E M+ K+RY  GL+KL  A+ QV+ MQ +LE LQPQL  A K  + +MV I RESI        VKA+E + NE+A A+KA+ DEC +DLA+A+P LE+AL+ALDTL   DIT+VK+M++PP+GVKLVME ICI++ +KP+++ DP+  GKK+ D+WGP+K++LG+M FL  L EYDKDNI    M  IRK++ITN EF P KV  AS+AAEGLC+W++AM+SYD+VAKVVAPKKIKL QAES+LK  M  L + Q  L+ V+DKL  L+QKL++ + +K  L+ +V+LC+KKL+RA++LIGGLGGEK RW+  A+ L  +Y NLIGD+L+S+G++AY G FTS YR     +W+ LCKS  IPCS  FSL   LG PVKI+AWNI GLP DSFSIDN +I++NARRWPLMIDPQ QANKW+KNMEK   L+VIKL+D DF+RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEY+ +FR YITTKLRNPHYLPE +VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A N+R LKE ED+IL  LS SEGNILE+ETAI+IL SSKA++ +I  KQ  AEET+KKIDA RM Y PIA HS+ILFFSI DL NI+PMYQYSL+WF+NL++ SI +S KS+ L KRL+ L DHFTYSLY NVCRSLFEKDKLLFSF L + ++  +  ++  E+ FLLTGG+GL+N  +NP T WL  KSWDE+CRL+++  FKG ++ F    +GW+A YDS +P  +  P  W  KL  F+ +L++RC+RPDKI+P +  +V   LGK FIEPPPFDL+++F DS CCAPLIFVLSPGADP  ALLKFA+D+GFGG K +S+SLGQGQGPIA +M  +A +EG+WV+LQNCHLA SWM  +EK+CEE+ P+ T+ +FRLWLTSYPSP FPV+VLQNGVKMTNE P GLR N+ +S++ D IS+PEFF  C  K   F+KLL+GLCFFHALVQERRKFGP+GWNIPY FN++D+RIS +QL MF+N+YE+VP+DA++Y+TGECNYGGRVTDDWDRR L +IL+ FYN  +  +  Y F  SG Y  PP  +Y  YIE+ K LP   +PE+FGM+ N DIT++  +++ L D++L+T  + +  G  SS+  + E++ DIL K+P++FD E A   YP TY +SMNTVLVQEM RFNKL + IR+S  N+ KAIKGLVVMS +LE + SS+L GKIP MW K SYPSLKPLGSY++D + RL FLQ W+  G P  FW+SGF+FTQAFLTG  QN+ARKYTIPIDLLGFDFEVL+       P DG YI GLFLDGARW+ +T KLGE  PK+LY+ VPV+WLKP KR  I    NR  Y  PVYKTSER+G LSTTGHSTNFV+ + LP+++P  HW+ RG ALLCQL+
Sbjct:   11 RYNYY-IHHGIDTEHVAPMEDSWLENVLKLVPEHLNTYRES-IEMLSDEIREDYLLSVKKAIVDFVLKDPRKKEEYKTSNIPHRAEIEIVPKP-----------WKKSFLVNCNTIKENLNAINPTMAAVLDLWHSSFGQLRLVDTDEFHSRQESMELSIFQNLVTRHIDSAKDKLLKKWFPEIQNIFYQGNKRKQIPSSSNYKKLESFFNCAATLMNGQLQSLALVSIQDYTDLIVQPPDSVLAYEHPGFIIRLILDNTSIKFKPDFNEYETALLNVYDMMIKAVNVVPRVETKLYSEWVNISKSTLKPIIPEEILEKHKWA-VKEFVAKESFLPMEHLKLYDK------YNFLISKQADLDVDQFLAEEHTFEEIMREVLKYKALTSEIQ-YTSRKFIRLGMFELHCDELIRALTKRSEAISGKLVAKMFSVHQEVNKILCDEFERIAEKALSTPSSTHELMDLKAYIAKVEAQHMVEMEQKLVDAKNRLVFLVDYAIFSPSDIRLNNSTFHWHSRMGDIFEEHKRIVKEKTEQFQEELKLRCEKFVEELENCAKQVEEFQSYGDM--QEVTKYLKKAQTLNSKLDQAVDKIDQLNAEEEAFGWGASQYPQRKKIQDALNPYLRLYEITSEFNAKYKSWMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNES--------------------------------------PSALSLTAKIKTKVEEFKEYLPLIQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAMEKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVVTIEKMLEKFKKSNEFLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIANVEFTDVLDITHIKSSEGEVVQLVNTISTSKARGQVEKWLVEVETAMIQSVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWTQEVQTSIQKGQQALEEYLEKNNKQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEEGHLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSNLLVFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNLPKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAAALNDICEKGLADENKVQITVLNPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHK-KFIEGLFDRMVPPCLQMIRKCAKELSPTSDTNLVRSLMNLMDCMMD-EFSDESLVQNMSEREICSWLEGIFLFSLIWSVGGSCKEDDRVKFDRLLREIIEGPLSEESRTRFKILHPVDPPEKPFTVPIPKENTVYDYKFVKQDVGRWELWTEALSSAPSIPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNRLDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQPPVELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSMYTIFSRILDWHLTIRYNFPNEYKALTPQIIHSTMAVYKEALKHLLPTPAKSHYLFNLRDFSRVIQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQHLDFDGDGKVQEDDLRSLMFCDFH--DLKREDTNYKEINDVEKLRLVVESHLEEFNNISKKTMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNNEWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQIDRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPWPEDALQAVATRFLEDVEISEEVRNGCIDMCKSFHTSTINLSDRFRSELQRYNYVTPTSYLELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMVVIERESIEVAKTEKVVKADEAVANEQAMAAKAIKDECDSDLAQALPILESALAALDTLTAQDITVVKSMKSPPSGVKLVMEAICILKGVKPDKIPDPSGSGKKIEDFWGPAKRVLGEMKFLQSLHEYDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQAESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLGGEKTRWSLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQMQTNEWTMLCKSKNIPCSEDFSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNSLHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYENVCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGIGLDNPHSNPCT-WLPQKSWDEVCRLDNILLFKGIRKDFMRLRDGWKAVYDSLEPHHSTFPPDWQEKLGQFQRMLMIRCLRPDKIIPMVQEFVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFGGGKLSSLSLGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSC-KKLPEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDRRALRSILNKFYNIEMNKNPNYIFDSSGIYYAPPDGDYDSYIEYTKTLPLNSSPEIFGMNANADITKDQSETQQLFDNILLTQSRSSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYPTTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWMKKSYPSLKPLGSYVSDFLARLKFLQDWYENGTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDFEVLEDKEYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPCKRTDIP---NRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVALLCQLN 3867          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah12 (dynein, axonemal, heavy chain 12 [Source:MGI Symbol;Acc:MGI:107720])

HSP 1 Score: 4888.55 bits (12679), Expect = 0.000e+0
Identity = 2419/3979 (60.79%), Postives = 3027/3979 (76.07%), Query Frame = 2
Query:   29 NSYSVMQSGSKMPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKE--MDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGK--NIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQ-LSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            N  ++      +   LPPI +         PK ++LLK +R S E +KK+++L+I  A     K  D+        P P +P  M SE +   +NY F+K CV+NSPI P+Q +WL N+   +  HLK+G   E  +  ++ EV  ++  SMKR LVQ  L KP V  LE D+  P PE P GLD+S  WH +FV+ R ++   L I++P M+ LL L  T F + ++ D+  +   G +D EALR  + +   K ++ +M  WYPKVIN+F +++++  I+ +  +SFYNC +IL+SNQ+K+LL RTVE ++ +F+      LPI KM L FD ++M+FYP + DLE+++  +I  I++++Q + T+ S ++    PV +   +  H+L +A   LR++     E  K + K  Y   Y++L++G     I +F  ENH+FDEY E+IEKF  +A +I  LP   ++ ++RL+CEDLK GL  +    + ILLN +A  HRKEN  I  +FE I+ HA  VPET++E+ +LIA++E AR  G++ L+ +I+ SK ++ Y LD    S EDL LN+ V  W  KI P+FD ND++ E+ K   E  L+ +REKLI E++K   R++EF EF E+D   M QYV DVR LQ +++E+ + + +IN EEELFK   + +PE+E++K   +P+ + F  V+K+Q++E++W+ G F DL  + +EA++D+  RE+F+  K F+ + KK L E+           +      L   + ++ PK    + +C+  + QI  FKE IP ++ LC PG++ RHW +MS I   D+TP+SGT+L KVL + L  Y+E F  ISA AS+EF+LE +M  M   W+ + F +++YR++GI IL+SVD+IQ +LDDQI+KTQTMRGSPFIKPFE EIK WE++L+   ETID+WLKVQAQWLYLEPIF SEDIMQQMPEEGR FQ VDR+WKDIM+   +DP V+ A   +G+LE+L+  N LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+SSE E++++  +IST+ ARGAVE+WL+QV+D+ML SIRDVIAASR AY   AR +WV EW GQVVLCVSQ++WT E  E +  G EGL  Y+++   Q+++IV+LVRGKL+ Q RITLGALVTIDVHARDVV DM    V  + DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  +E F+FEGTELRLN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLKYP+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP+ADY  FL+   E C  HNLQ V FF EKIIQ+YEMMIVRHGFMLVGEPF  KT+VLHVLA+ ++ +NE  + + EKV+YRT+NPKSITMGQLFGQFD VSHEWTDGI ANTFREFA  ++PDRKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+PS +GW P+  SWL S  E L +     ++  LF+W V   L F  K CK +IPT +I+ V  L  LI++++   +E E    ++++++W  ++++F++ WSIG   D D R  FD F R  + G+NE  P+P  I+++E    E GLVYDY YE + RG W HWN+L K+ S  E K   I++ +VPTMDT RY F++D+ +   + L+FVGPTGTGKSVY +DKLMN L  ++Y P +VNFSA+TSANQ Q IIM++LD+RRKGVFGPP+GK  VIF+DDMNMP+ E YGAQPPIELLRQ+FD G+WYDLKDT+KI L DI L+ AMGPPGGGRN VTPRF+RHFN+ ++ TFSD+TM+RIFS++M+ Y++   F+ +Y  +G  +V  T+EVYK ++ NLLPTPAKSHY FNLRDFSRVI G  LI+K+ +E K T  RL+VHEVLRVFYDRLI D DR WL+ L+K  IK HFKE+FD +F HL    N PV EE LR+LMFGDYMNPD   +DRVY E+ +I+ F  +V+QC+DEYN THK +M+LV+FRYVLEHLSRICRIL   GGNALL+G+GGSGRQSLT+LA +MA   +FQPEISK+YG  EWRED+KTLL+  G +G+ TVFL+TD+QIK+ESFLEDIDN+LNTGEVPN+F A+EK EV+E VR  AQAGNK  + SPLALFAFFVNRC++ LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPEDALERVA+  LE +++    R + V I KHFHTS+++LSE F + LGR NYVT TSYLELI SFR LL  K+   M  K+RYVNGLD+LAFA  QV +M+++L ELQP+L  AK  N  +M  I  ES   E +R  VK +EEI + KA+ ++AL +EC +DLAEAIPALEAALSALDTL+  DITIVK+M+NPPAGVKLVM  +C+M++IKPE+++DP+  G K+ DYWGPSKKLLGDM FL  LREYDKDNI   +M KIR E++TNPEFDP KV++ASSAAEGLC+WI+AME YDRVAKVVAPKK +LA+A+  L E M  LN+ + +L  VE  L NL++  ++  +EK  L+++VELCAKKLERA KLIGGLGGEK RW+QAA +LQ  Y+NL GDVL++AGVIAYLG FTS +R +C  DWS LCK  K PCS +FSL+  LG+PVKI+AWNI GLP D+FSIDN VIV N+RRWPLMIDPQ QANKWIKN EK+  L+VIKL+D D+MRTLEN +QFG P+LLENVGE+LDPSLEPLLLKQ FKQ G+D +RLGE IIEYS +F+ YITTKLRNPHY+PE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LK+ E +IL TLS SEGNILE+E+AI++LDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS++LFFSI DL NIDPMYQYSL+WFVNLYINSIHDSN+SK+L+KRLRYL+DHFTY+LY N+CRSLFEKDKLLFSFLLC+ +L++K ++E  E +FLLTGGV L++   NP   WL DKSW+EICR ++L  F G +E F   +  W   YDSK+P + K P+P    L+  + +++LRC+RPDKI PAITNYV +KLGKKF+EPPPFDL +S+ DS C  PL+FVLSPGADP  +LLKFA DK   G+KF +ISLGQGQGP+A++MI+ A  EGTWV LQNCHLAVSWM  +EKICE+ +PE  N  FRLWLTSYPSPKFPVT+LQNGVKMTNEPPTGLR NL QS+++D IS+ +FF GCPGKE  +EKLLFG+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+NEY+ +PF+AI YLTGECNYGGRVTDDWDRR L+T+L DFYN  +I +  YKFSPSG Y  PPK  Y +YIEFIK LP  Q PE+FG+HENVDI+++LQ +++L +S+L+T G    +G   S +Q L EI  DIL ++P  FD+E A   YPV Y ESMNTVLVQEMERFN L   IR +L++L KAIKGLVVM   LEA++ SLL+GK+P MW+K SYPSLKPLGSYI D + RL FL+ WF+ GKPS FW+SGF+FTQAFLTG MQNFARKYTIPIDLLG++FEV+   + +  P DG YI GL+LDGARW+  +  L EQ PK+L++ +P+IW+KP  +  I   E  Y CP+YKTSERKG LSTTGHSTNFV+ + L T++P  HW+KRG ALLCQLD+
Sbjct:    5 NKTAIAAEKEALNLKLPPIVQPPKNIGVDTPKQSELLK-YRRSKEQQKKINQLVISGAKKSLDKTLDKRIP---PLPEPDFPPTMTSEIKKRGLNYIFMKQCVENSPIVPIQSQWLDNMLMLVPEHLKEGEKSEELLGSLIDEVSMDYEKSMKRYLVQSVLVKPPVKWLE-DEGGPLPESPEGLDYSNPWHSNFVQARSQILANLHIVHPTMKMLLELGYTAFAKIILLDLTGIRARGPIDCEALRNDLSIQARKSEEKIMNTWYPKVINLFTKKEALEGIKTEKLDSFYNCVSILMSNQLKDLLWRTVEEFIKLFDPRYLNRLPIFKMELTFDDDKMEFYPTFQDLEDVVLGLIERISETLQTVQTVPSWLSGTSSPVNLDTEIPEHVLQWALCTLRTAIQHNLEGAKAHHKT-YVTKYNWLLDGTATKMIQRFQAENHTFDEYTEFIEKFFNLASEIMLLPQWAHYPMVRLDCEDLKIGLTNKARAFANILLNDIASKHRKENESICSEFEAIRDHALRVPETTEEMMELIAFVERARTVGILDLALRIQESKRQMSYFLDALLMSQEDLNLNATVLLWPTKITPVFDENDELIENAKHAKENELIAKREKLILEIEKESRRMEEFTEFAELDR--MHQYVADVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELEKLKVTIEPYQKFFNFVLKWQRTEKRWMDGGFLDLNGESMEADIDDFSREVFRTLKFFHAKQKKELQER----------RKAARKRSLMEEKPEEEPKENPTITMCTTVMEQIKSFKEYIPTVSILCNPGMRARHWKQMSEIVGYDLTPDSGTTLRKVLKLNLSPYLESFEVISAGASKEFSLERSMNAMIATWDDISFHISLYRDTGIGILSSVDEIQAILDDQIIKTQTMRGSPFIKPFENEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWKDIMKFCAKDPKVLAATSLTGLLEKLQNCNDLLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLANLDIKAMYSSEGERVELIALISTTAARGAVEKWLIQVEDLMLRSIRDVIAASRLAYPESARKDWVREWPGQVVLCVSQMFWTSETQEIISGGTEGLKKYYKELQYQLNDIVELVRGKLSKQTRITLGALVTIDVHARDVVMDMIEMGVSHDTDFQWLAQLRYYWEYENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLEAFVFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYKEFLECAHETCQTHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTEVLHVLADTLTLMNERNYGDEEKVMYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALAESPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVASWLNSLKEPLSELEHQNLLKELFDWLVPPSLVFRRKKCKELIPTSNINAVVALTRLIEILLCTVVENE--PNSKHIRVWTMASFIFSLIWSIGASCDTDGRLAFDAFLRTAVSGRNEEAPMPVSISKWECPFDEKGLVYDYMYELRNRGRWIHWNELIKS-SDLEDKRAKIQDIIVPTMDTIRYTFLMDLSITSAKPLLFVGPTGTGKSVYVKDKLMNHLEKEKYFPFYVNFSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCVIFIDDMNMPSLEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLIDIELIAAMGPPGGGRNAVTPRFIRHFNICTINTFSDETMVRIFSSIMAFYLRTHAFSPEYFVLGNQIVSGTMEVYKQSMGNLLPTPAKSHYTFNLRDFSRVIRGCLLIEKDAIESKHTMIRLFVHEVLRVFYDRLINDEDRNWLFLLIKNVIKDHFKESFDTVFHHLRNG-NAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPDIHHFNEVVDQCLDEYNQTHKRRMNLVVFRYVLEHLSRICRILKQSGGNALLIGLGGSGRQSLTKLATSMAKMQIFQPEISKSYGMNEWREDIKTLLRNVGVKGQKTVFLITDTQIKEESFLEDIDNVLNTGEVPNIFAADEKQEVMEGVRPVAQAGNKHGELSPLALFAFFVNRCKDNLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVNFLETLELTKVERQEIVPICKHFHTSIMHLSERFLEELGRHNYVTATSYLELIGSFRQLLTKKRQAVMEAKQRYVNGLDQLAFAESQVGEMKLELVELQPKLEAAKIENARMMQIIEVESAQVEAKRKFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKETDITIVKSMKNPPAGVKLVMAAVCVMKDIKPEKISDPSGTGGKIFDYWGPSKKLLGDMNFLRDLREYDKDNIPVAVMQKIRSEYLTNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLAEAQRSLAETMELLNQKRAELAQVEHHLENLEKTFQEKTEEKAALEDQVELCAKKLERASKLIGGLGGEKSRWSQAADDLQITYENLTGDVLVAAGVIAYLGAFTSGFRQECTEDWSKLCKKKKFPCSEEFSLSKTLGDPVKIRAWNIAGLPTDAFSIDNGVIVNNSRRWPLMIDPQGQANKWIKNSEKDNQLSVIKLSDTDYMRTLENCVQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIETKILETLSSSEGNILEDESAIKVLDSAKIMSNEITKKQQVAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNRSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLAKKEIEYQELMFLLTGGVSLKSAEKNPDPDWLQDKSWEEICRASELPVFHGLREHFCNYIYLWEEIYDSKEPHNMKFPEPMDKTLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLVFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPVASKMITAAIEEGTWVCLQNCHLAVSWMPTLEKICEDFSPETCNPTFRLWLTSYPSPKFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDTQFFKGCPGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISVRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNSFIIENPHYKFSPSGNYYAPPKGTYDDYIEFIKKLPFTQEPEIFGLHENVDISKDLQQTKVLFESLLLTQGGAKQTGSSGSTDQVLLEITEDILTQLPNDFDIEAALKNYPVRYEESMNTVLVQEMERFNNLIRTIRNTLRDLKKAIKGLVVMDSALEALSGSLLIGKVPEMWAKRSYPSLKPLGSYITDFLARLKFLEDWFSSGKPSVFWISGFFFTQAFLTGAMQNFARKYTIPIDLLGYEFEVIPFDYSDTPPEDGVYIHGLYLDGARWDRFSGLLAEQYPKLLFDLMPIIWIKPNLKIEIVKIE-AYICPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTQHWIKRGVALLCQLDN 3960          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah12 (dynein, axonemal, heavy chain 12 [Source:MGI Symbol;Acc:MGI:107720])

HSP 1 Score: 4888.55 bits (12679), Expect = 0.000e+0
Identity = 2419/3979 (60.79%), Postives = 3027/3979 (76.07%), Query Frame = 2
Query:   29 NSYSVMQSGSKMPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKE--MDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGK--NIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQ-LSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            N  ++      +   LPPI +         PK ++LLK +R S E +KK+++L+I  A     K  D+        P P +P  M SE +   +NY F+K CV+NSPI P+Q +WL N+   +  HLK+G   E  +  ++ EV  ++  SMKR LVQ  L KP V  LE D+  P PE P GLD+S  WH +FV+ R ++   L I++P M+ LL L  T F + ++ D+  +   G +D EALR  + +   K ++ +M  WYPKVIN+F +++++  I+ +  +SFYNC +IL+SNQ+K+LL RTVE ++ +F+      LPI KM L FD ++M+FYP + DLE+++  +I  I++++Q + T+ S ++    PV +   +  H+L +A   LR++     E  K + K  Y   Y++L++G     I +F  ENH+FDEY E+IEKF  +A +I  LP   ++ ++RL+CEDLK GL  +    + ILLN +A  HRKEN  I  +FE I+ HA  VPET++E+ +LIA++E AR  G++ L+ +I+ SK ++ Y LD    S EDL LN+ V  W  KI P+FD ND++ E+ K   E  L+ +REKLI E++K   R++EF EF E+D   M QYV DVR LQ +++E+ + + +IN EEELFK   + +PE+E++K   +P+ + F  V+K+Q++E++W+ G F DL  + +EA++D+  RE+F+  K F+ + KK L E+           +      L   + ++ PK    + +C+  + QI  FKE IP ++ LC PG++ RHW +MS I   D+TP+SGT+L KVL + L  Y+E F  ISA AS+EF+LE +M  M   W+ + F +++YR++GI IL+SVD+IQ +LDDQI+KTQTMRGSPFIKPFE EIK WE++L+   ETID+WLKVQAQWLYLEPIF SEDIMQQMPEEGR FQ VDR+WKDIM+   +DP V+ A   +G+LE+L+  N LLEKI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF   LDI AM+SSE E++++  +IST+ ARGAVE+WL+QV+D+ML SIRDVIAASR AY   AR +WV EW GQVVLCVSQ++WT E  E +  G EGL  Y+++   Q+++IV+LVRGKL+ Q RITLGALVTIDVHARDVV DM    V  + DF WL+QLRYYWE ENA VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  +E F+FEGTELRLN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLKYP+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP+ADY  FL+   E C  HNLQ V FF EKIIQ+YEMMIVRHGFMLVGEPF  KT+VLHVLA+ ++ +NE  + + EKV+YRT+NPKSITMGQLFGQFD VSHEWTDGI ANTFREFA  ++PDRKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDLSQASPATVSRCGMIYL+PS +GW P+  SWL S  E L +     ++  LF+W V   L F  K CK +IPT +I+ V  L  LI++++   +E E    ++++++W  ++++F++ WSIG   D D R  FD F R  + G+NE  P+P  I+++E    E GLVYDY YE + RG W HWN+L K+ S  E K   I++ +VPTMDT RY F++D+ +   + L+FVGPTGTGKSVY +DKLMN L  ++Y P +VNFSA+TSANQ Q IIM++LD+RRKGVFGPP+GK  VIF+DDMNMP+ E YGAQPPIELLRQ+FD G+WYDLKDT+KI L DI L+ AMGPPGGGRN VTPRF+RHFN+ ++ TFSD+TM+RIFS++M+ Y++   F+ +Y  +G  +V  T+EVYK ++ NLLPTPAKSHY FNLRDFSRVI G  LI+K+ +E K T  RL+VHEVLRVFYDRLI D DR WL+ L+K  IK HFKE+FD +F HL    N PV EE LR+LMFGDYMNPD   +DRVY E+ +I+ F  +V+QC+DEYN THK +M+LV+FRYVLEHLSRICRIL   GGNALL+G+GGSGRQSLT+LA +MA   +FQPEISK+YG  EWRED+KTLL+  G +G+ TVFL+TD+QIK+ESFLEDIDN+LNTGEVPN+F A+EK EV+E VR  AQAGNK  + SPLALFAFFVNRC++ LH+V+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPEDALERVA+  LE +++    R + V I KHFHTS+++LSE F + LGR NYVT TSYLELI SFR LL  K+   M  K+RYVNGLD+LAFA  QV +M+++L ELQP+L  AK  N  +M  I  ES   E +R  VK +EEI + KA+ ++AL +EC +DLAEAIPALEAALSALDTL+  DITIVK+M+NPPAGVKLVM  +C+M++IKPE+++DP+  G K+ DYWGPSKKLLGDM FL  LREYDKDNI   +M KIR E++TNPEFDP KV++ASSAAEGLC+WI+AME YDRVAKVVAPKK +LA+A+  L E M  LN+ + +L  VE  L NL++  ++  +EK  L+++VELCAKKLERA KLIGGLGGEK RW+QAA +LQ  Y+NL GDVL++AGVIAYLG FTS +R +C  DWS LCK  K PCS +FSL+  LG+PVKI+AWNI GLP D+FSIDN VIV N+RRWPLMIDPQ QANKWIKN EK+  L+VIKL+D D+MRTLEN +QFG P+LLENVGE+LDPSLEPLLLKQ FKQ G+D +RLGE IIEYS +F+ YITTKLRNPHY+PE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LK+ E +IL TLS SEGNILE+E+AI++LDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS++LFFSI DL NIDPMYQYSL+WFVNLYINSIHDSN+SK+L+KRLRYL+DHFTY+LY N+CRSLFEKDKLLFSFLLC+ +L++K ++E  E +FLLTGGV L++   NP   WL DKSW+EICR ++L  F G +E F   +  W   YDSK+P + K P+P    L+  + +++LRC+RPDKI PAITNYV +KLGKKF+EPPPFDL +S+ DS C  PL+FVLSPGADP  +LLKFA DK   G+KF +ISLGQGQGP+A++MI+ A  EGTWV LQNCHLAVSWM  +EKICE+ +PE  N  FRLWLTSYPSPKFPVT+LQNGVKMTNEPPTGLR NL QS+++D IS+ +FF GCPGKE  +EKLLFG+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+F+NEY+ +PF+AI YLTGECNYGGRVTDDWDRR L+T+L DFYN  +I +  YKFSPSG Y  PPK  Y +YIEFIK LP  Q PE+FG+HENVDI+++LQ +++L +S+L+T G    +G   S +Q L EI  DIL ++P  FD+E A   YPV Y ESMNTVLVQEMERFN L   IR +L++L KAIKGLVVM   LEA++ SLL+GK+P MW+K SYPSLKPLGSYI D + RL FL+ WF+ GKPS FW+SGF+FTQAFLTG MQNFARKYTIPIDLLG++FEV+   + +  P DG YI GL+LDGARW+  +  L EQ PK+L++ +P+IW+KP  +  I   E  Y CP+YKTSERKG LSTTGHSTNFV+ + L T++P  HW+KRG ALLCQLD+
Sbjct:    5 NKTAIAAEKEALNLKLPPIVQPPKNIGVDTPKQSELLK-YRRSKEQQKKINQLVISGAKKSLDKTLDKRIP---PLPEPDFPPTMTSEIKKRGLNYIFMKQCVENSPIVPIQSQWLDNMLMLVPEHLKEGEKSEELLGSLIDEVSMDYEKSMKRYLVQSVLVKPPVKWLE-DEGGPLPESPEGLDYSNPWHSNFVQARSQILANLHIVHPTMKMLLELGYTAFAKIILLDLTGIRARGPIDCEALRNDLSIQARKSEEKIMNTWYPKVINLFTKKEALEGIKTEKLDSFYNCVSILMSNQLKDLLWRTVEEFIKLFDPRYLNRLPIFKMELTFDDDKMEFYPTFQDLEDVVLGLIERISETLQTVQTVPSWLSGTSSPVNLDTEIPEHVLQWALCTLRTAIQHNLEGAKAHHKT-YVTKYNWLLDGTATKMIQRFQAENHTFDEYTEFIEKFFNLASEIMLLPQWAHYPMVRLDCEDLKIGLTNKARAFANILLNDIASKHRKENESICSEFEAIRDHALRVPETTEEMMELIAFVERARTVGILDLALRIQESKRQMSYFLDALLMSQEDLNLNATVLLWPTKITPVFDENDELIENAKHAKENELIAKREKLILEIEKESRRMEEFTEFAELDR--MHQYVADVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELEKLKVTIEPYQKFFNFVLKWQRTEKRWMDGGFLDLNGESMEADIDDFSREVFRTLKFFHAKQKKELQER----------RKAARKRSLMEEKPEEEPKENPTITMCTTVMEQIKSFKEYIPTVSILCNPGMRARHWKQMSEIVGYDLTPDSGTTLRKVLKLNLSPYLESFEVISAGASKEFSLERSMNAMIATWDDISFHISLYRDTGIGILSSVDEIQAILDDQIIKTQTMRGSPFIKPFENEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWKDIMKFCAKDPKVLAATSLTGLLEKLQNCNDLLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLANLDIKAMYSSEGERVELIALISTTAARGAVEKWLIQVEDLMLRSIRDVIAASRLAYPESARKDWVREWPGQVVLCVSQMFWTSETQEIISGGTEGLKKYYKELQYQLNDIVELVRGKLSKQTRITLGALVTIDVHARDVVMDMIEMGVSHDTDFQWLAQLRYYWEYENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLEAFVFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYKEFLECAHETCQTHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTEVLHVLADTLTLMNERNYGDEEKVMYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALAESPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVASWLNSLKEPLSELEHQNLLKELFDWLVPPSLVFRRKKCKELIPTSNINAVVALTRLIEILLCTVVENE--PNSKHIRVWTMASFIFSLIWSIGASCDTDGRLAFDAFLRTAVSGRNEEAPMPVSISKWECPFDEKGLVYDYMYELRNRGRWIHWNELIKS-SDLEDKRAKIQDIIVPTMDTIRYTFLMDLSITSAKPLLFVGPTGTGKSVYVKDKLMNHLEKEKYFPFYVNFSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCVIFIDDMNMPSLEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLIDIELIAAMGPPGGGRNAVTPRFIRHFNICTINTFSDETMVRIFSSIMAFYLRTHAFSPEYFVLGNQIVSGTMEVYKQSMGNLLPTPAKSHYTFNLRDFSRVIRGCLLIEKDAIESKHTMIRLFVHEVLRVFYDRLINDEDRNWLFLLIKNVIKDHFKESFDTVFHHLRNG-NAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPDIHHFNEVVDQCLDEYNQTHKRRMNLVVFRYVLEHLSRICRILKQSGGNALLIGLGGSGRQSLTKLATSMAKMQIFQPEISKSYGMNEWREDIKTLLRNVGVKGQKTVFLITDTQIKEESFLEDIDNVLNTGEVPNIFAADEKQEVMEGVRPVAQAGNKHGELSPLALFAFFVNRCKDNLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVNFLETLELTKVERQEIVPICKHFHTSIMHLSERFLEELGRHNYVTATSYLELIGSFRQLLTKKRQAVMEAKQRYVNGLDQLAFAESQVGEMKLELVELQPKLEAAKIENARMMQIIEVESAQVEAKRKFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKETDITIVKSMKNPPAGVKLVMAAVCVMKDIKPEKISDPSGTGGKIFDYWGPSKKLLGDMNFLRDLREYDKDNIPVAVMQKIRSEYLTNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLAEAQRSLAETMELLNQKRAELAQVEHHLENLEKTFQEKTEEKAALEDQVELCAKKLERASKLIGGLGGEKSRWSQAADDLQITYENLTGDVLVAAGVIAYLGAFTSGFRQECTEDWSKLCKKKKFPCSEEFSLSKTLGDPVKIRAWNIAGLPTDAFSIDNGVIVNNSRRWPLMIDPQGQANKWIKNSEKDNQLSVIKLSDTDYMRTLENCVQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIETKILETLSSSEGNILEDESAIKVLDSAKIMSNEITKKQQVAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNRSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLAKKEIEYQELMFLLTGGVSLKSAEKNPDPDWLQDKSWEEICRASELPVFHGLREHFCNYIYLWEEIYDSKEPHNMKFPEPMDKTLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLVFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPVASKMITAAIEEGTWVCLQNCHLAVSWMPTLEKICEDFSPETCNPTFRLWLTSYPSPKFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDTQFFKGCPGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISVRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNSFIIENPHYKFSPSGNYYAPPKGTYDDYIEFIKKLPFTQEPEIFGLHENVDISKDLQQTKVLFESLLLTQGGAKQTGSSGSTDQVLLEITEDILTQLPNDFDIEAALKNYPVRYEESMNTVLVQEMERFNNLIRTIRNTLRDLKKAIKGLVVMDSALEALSGSLLIGKVPEMWAKRSYPSLKPLGSYITDFLARLKFLEDWFSSGKPSVFWISGFFFTQAFLTGAMQNFARKYTIPIDLLGYEFEVIPFDYSDTPPEDGVYIHGLYLDGARWDRFSGLLAEQYPKLLFDLMPIIWIKPNLKIEIVKIE-AYICPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTQHWIKRGVALLCQLDN 3960          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 4056.14 bits (10518), Expect = 0.000e+0
Identity = 2078/3965 (52.41%), Postives = 2769/3965 (69.84%), Query Frame = 2
Query:  167 RKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDD---LVPFPEEPIGLD-FSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIF----EEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----NSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLP-NVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPE---VLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWF---QSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIG-----KNESFPIPKEINR-----FEVMLPETGLVYDYFYEHKVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKG-QEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNK--DADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            R  L KL++ Q  ++E  + D+  +  PK       +   + E+ I   YY+++  +    + PM++ WL+++   +  HLK   +  M  +  E+++++  S+K+S+V   LK P     + DD   +   P     ++   + W  SF+     +   L  + P M  +L L ++TF +  + D+   HN + +++    +  V    E   + ++K W+P+V NI+   N++K +P  +   K +SF+NC   L++ Q+++L+  +++ + D+     E   A   P   M L  D   ++F P+++D  +++  +   + + +  +P +++ +     S  +P  +  ++ N I+   KE++R    R    P E+ K +Y+  Y +LI G+ E +I +FL ++ +++   E I K+Q + ++I+          +  + CE+L   LVK    +   L+ ++ +DH++ N  + ++FE I + A ++P  + EL ++ A++++     M+ L +++  SK  L +L++   FSP D++LN+ VF W  ++  IFD + KI +    + +  L  R E+ + EL+ +  +V+EF+ FG++    +++Y++  + L  KL  A  ++   N EEE +    S++P+ ++I+   +P+++L++  +++    R W  G ++ +  D++EA+V   +R L+K++K F++                                         AL +  K  + + EFK+ IP+I  +C PG++ RHW+ MS+I    + P+  +++   + M L+ +++ F  IS AAS+E++LE  M KM  EW+++EF +  YRESG  IL+SVDDIQ LLDD I+KTQTMRGSPFIKP+E +++ WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F+AVD+ W+D+M+  V+D  V+       +LERLK+SN LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIAK+EF   LDI  M SSE E +++   IST++ARG VE+WL++++  M+ SI  VI  +  AY   +R  WV +W GQ VLCVSQ +WT+EV  A+ +G   L  Y  KCN QI +IV LVRGKL+ Q R+TLGALV +DVHARDV+  +  K++  ++DF WLSQLRYYW+E N   ++ NA ++Y YEYLGNS RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I R I    E  +FEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS GF+ AR L++KIV TYRLCSEQLSSQ HY+YGMRAVK+VL+AAGNLKLKYP+ENE ILLLRSI+DVNLPKFLSHD+PLF GI SDLFPGV LP+ DY   L A+ E C   NLQ  DFF+EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A++ + E+G  E  KV    +NPKS+TMGQL+GQFD VSHEW+DGI A +FR FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  M+LIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SW+ + P+   +++K    E ++ LF+  V   + F+ ++ K + PT   +LV++L+NLID  M      E+  + RN +  F   +  ++F++ WS+G     D R KFD   REL+ G         F +     +     F V  PE G +Y+Y +  +  G W  W   L       +     E +VPT+DT RY  ++ +   H++  +FVGPTGTGKSVY  + L+N+L  D Y P  VNFSAQT+A QTQ IIMSKLD+RRKGVFGPP+GK  ++FVDD+NMPA+E+YGAQPPIELLRQ+ DH NWYDLKD + I L DI +M AMGPPGGGRN +TPR++RHFN+V++  FSD +M  IFS +++ +++   +F  D+L +   +V  T+ +YK A+ NLLPTPAKSHY+FNLRDFSRVI G+CL + E  E+K    RLWVHEVLRV+YDRL++++DR WL   ++E +K + +E F  LF++L    +  V+E+ LRSLMF D+ +P    ED  Y E+ N++    IVE  +DEYNN  K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQS+TRLAA MA+  +FQ EISK YG  EW EDLK +L+K        VFL TD+QIK ESFLED++NLLN GEVPNLF  +EK E+ E +RQ  +  +K    D SP+ALF  F++RCR +LHVV+A SPIG AFR RLR+FPAL+NCCTIDWFQ+WPEDALE VA + LE ++M ++++   + + K FHTS INLS  F   L R NYVTPTSYLELI++F+ LL  K++E M+ K+RY  GLDKL  A+ QV+ MQ +LE L PQL  A +  + +M+ I RES+        VKA+E + N++A A+KA+ DEC ADLAEA+P LE+AL+ALDTL   DIT+VK+M++PPAGVKLVME ICI++ IK +++ DP   GKK+ D+WGP+K+LLGD+ FL  L EYDKDNI    M  IRK +I NP+F P K+  AS+AAEGLC+W++AM+SYD+VAK+VAPKKIKLA AE  L+  M  L + Q  L  V+DKL  L+  L+  + +K  L+ +V+LC+KKLERA++LIGGLGGEK RW+ +A+ L  +Y NL GD+L+S+GV+AYLG FTS YR     +WS  CK   IPCS  +SL   LG  V I+AWNI GLP DSFSIDN +I+ NARRWPLMIDPQ QANKWIKNMEK   L +IKL+D D++RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEY+ +FR YITTKLRNPHYLPE +VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A+N+R LKE ED+IL  LS SEGNILE+ETAI+IL SSK+++++I +KQE AEET+KKID  RM Y  IA HS+ILFFSI DL NI+PMYQYSL+WF+NL+I SI +S KS +L KRL+ L DHFTYSLY N+CRSLFEKDKLLFSF L   +L+ +  +  TE+ FLLTGG+GL+N   NP T WL  KSWDEICRL+DL  FK  +  F    +GW+  YDS +P     P+ W  K + F+ +L++RC+RPDK++P +  ++ +KLG+ FIEPPPFDLA++F DS CCAPLIFVLSPGADP  ALLKFA+D+G+GGSK +S+SLGQGQGPIA +M+ +A ++GTWV+LQNCHLA SWM  +EK+CEE++ E+T+ +FR+WLTSYPSP FPV+VLQNGVKMTNE P GLR N+ +S++ D IS+PEFF  C   E  F+KLL+GLCFFHALVQERRKFGP+GWNIPY FN++DLRIS +QL MF+++YE++P+DA+RY+TGECNYGGRVTDDWDRR L +IL+ F+   ++ + +YKF  SG Y VPP  ++  YI + K LP I  PEVFGM+ N DIT++  +++LL D++L+T  Q + SG  SS+  ++E+A DIL K+P +FD+E A   YP TY +SMNTVLVQEM RFNKL   IRES  N+ KAIKGLVVMS ELE + SS+L  KIP MW   SYPSLKPLGSY+ND +ERL FLQ+W+  G P  FW+SGF+FTQAFLTG  QNFARK+TIPIDLLGFD+EV+        P DG YI GLFLDGA WN +T KL E  PKVLY+ VPV+WLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LP+++P  HW+ RG ALLCQL+
Sbjct:  125 RSTLVKLIMQQDGDLESDVIDE--SGIPK-------ATTTAREKDISRYYYYIRHGLDTDHVAPMEDSWLEHVLQLVPQHLKILNNSIM-VLSDEIREDYLLSVKKSIVDFVLKDPR----KKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNKKKQLPTGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESTRAFEHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDTHKEKIREVVLRESVAPTEHLK-MYD-KYQFLITGKAERDIDEFLFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLD--VQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPN--------------------------------------ALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQK----EFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMD-DFADENKQKERNDRESFSLLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEGLGRWDKWIKKLADTPPIPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKR--EDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPCT-WLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEE-FKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPS-YVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 4056.14 bits (10518), Expect = 0.000e+0
Identity = 2078/3965 (52.41%), Postives = 2769/3965 (69.84%), Query Frame = 2
Query:  167 RKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDD---LVPFPEEPIGLD-FSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIF----EEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----NSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLP-NVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPE---VLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWF---QSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIG-----KNESFPIPKEINR-----FEVMLPETGLVYDYFYEHKVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKG-QEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNK--DADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            R  L KL++ Q  ++E  + D+  +  PK       +   + E+ I   YY+++  +    + PM++ WL+++   +  HLK   +  M  +  E+++++  S+K+S+V   LK P     + DD   +   P     ++   + W  SF+     +   L  + P M  +L L ++TF +  + D+   HN + +++    +  V    E   + ++K W+P+V NI+   N++K +P  +   K +SF+NC   L++ Q+++L+  +++ + D+     E   A   P   M L  D   ++F P+++D  +++  +   + + +  +P +++ +     S  +P  +  ++ N I+   KE++R    R    P E+ K +Y+  Y +LI G+ E +I +FL ++ +++   E I K+Q + ++I+          +  + CE+L   LVK    +   L+ ++ +DH++ N  + ++FE I + A ++P  + EL ++ A++++     M+ L +++  SK  L +L++   FSP D++LN+ VF W  ++  IFD + KI +    + +  L  R E+ + EL+ +  +V+EF+ FG++    +++Y++  + L  KL  A  ++   N EEE +    S++P+ ++I+   +P+++L++  +++    R W  G ++ +  D++EA+V   +R L+K++K F++                                         AL +  K  + + EFK+ IP+I  +C PG++ RHW+ MS+I    + P+  +++   + M L+ +++ F  IS AAS+E++LE  M KM  EW+++EF +  YRESG  IL+SVDDIQ LLDD I+KTQTMRGSPFIKP+E +++ WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F+AVD+ W+D+M+  V+D  V+       +LERLK+SN LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIAK+EF   LDI  M SSE E +++   IST++ARG VE+WL++++  M+ SI  VI  +  AY   +R  WV +W GQ VLCVSQ +WT+EV  A+ +G   L  Y  KCN QI +IV LVRGKL+ Q R+TLGALV +DVHARDV+  +  K++  ++DF WLSQLRYYW+E N   ++ NA ++Y YEYLGNS RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I R I    E  +FEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS GF+ AR L++KIV TYRLCSEQLSSQ HY+YGMRAVK+VL+AAGNLKLKYP+ENE ILLLRSI+DVNLPKFLSHD+PLF GI SDLFPGV LP+ DY   L A+ E C   NLQ  DFF+EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A++ + E+G  E  KV    +NPKS+TMGQL+GQFD VSHEW+DGI A +FR FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  M+LIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SW+ + P+   +++K    E ++ LF+  V   + F+ ++ K + PT   +LV++L+NLID  M      E+  + RN +  F   +  ++F++ WS+G     D R KFD   REL+ G         F +     +     F V  PE G +Y+Y +  +  G W  W   L       +     E +VPT+DT RY  ++ +   H++  +FVGPTGTGKSVY  + L+N+L  D Y P  VNFSAQT+A QTQ IIMSKLD+RRKGVFGPP+GK  ++FVDD+NMPA+E+YGAQPPIELLRQ+ DH NWYDLKD + I L DI +M AMGPPGGGRN +TPR++RHFN+V++  FSD +M  IFS +++ +++   +F  D+L +   +V  T+ +YK A+ NLLPTPAKSHY+FNLRDFSRVI G+CL + E  E+K    RLWVHEVLRV+YDRL++++DR WL   ++E +K + +E F  LF++L    +  V+E+ LRSLMF D+ +P    ED  Y E+ N++    IVE  +DEYNN  K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQS+TRLAA MA+  +FQ EISK YG  EW EDLK +L+K        VFL TD+QIK ESFLED++NLLN GEVPNLF  +EK E+ E +RQ  +  +K    D SP+ALF  F++RCR +LHVV+A SPIG AFR RLR+FPAL+NCCTIDWFQ+WPEDALE VA + LE ++M ++++   + + K FHTS INLS  F   L R NYVTPTSYLELI++F+ LL  K++E M+ K+RY  GLDKL  A+ QV+ MQ +LE L PQL  A +  + +M+ I RES+        VKA+E + N++A A+KA+ DEC ADLAEA+P LE+AL+ALDTL   DIT+VK+M++PPAGVKLVME ICI++ IK +++ DP   GKK+ D+WGP+K+LLGD+ FL  L EYDKDNI    M  IRK +I NP+F P K+  AS+AAEGLC+W++AM+SYD+VAK+VAPKKIKLA AE  L+  M  L + Q  L  V+DKL  L+  L+  + +K  L+ +V+LC+KKLERA++LIGGLGGEK RW+ +A+ L  +Y NL GD+L+S+GV+AYLG FTS YR     +WS  CK   IPCS  +SL   LG  V I+AWNI GLP DSFSIDN +I+ NARRWPLMIDPQ QANKWIKNMEK   L +IKL+D D++RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEY+ +FR YITTKLRNPHYLPE +VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A+N+R LKE ED+IL  LS SEGNILE+ETAI+IL SSK+++++I +KQE AEET+KKID  RM Y  IA HS+ILFFSI DL NI+PMYQYSL+WF+NL+I SI +S KS +L KRL+ L DHFTYSLY N+CRSLFEKDKLLFSF L   +L+ +  +  TE+ FLLTGG+GL+N   NP T WL  KSWDEICRL+DL  FK  +  F    +GW+  YDS +P     P+ W  K + F+ +L++RC+RPDK++P +  ++ +KLG+ FIEPPPFDLA++F DS CCAPLIFVLSPGADP  ALLKFA+D+G+GGSK +S+SLGQGQGPIA +M+ +A ++GTWV+LQNCHLA SWM  +EK+CEE++ E+T+ +FR+WLTSYPSP FPV+VLQNGVKMTNE P GLR N+ +S++ D IS+PEFF  C   E  F+KLL+GLCFFHALVQERRKFGP+GWNIPY FN++DLRIS +QL MF+++YE++P+DA+RY+TGECNYGGRVTDDWDRR L +IL+ F+   ++ + +YKF  SG Y VPP  ++  YI + K LP I  PEVFGM+ N DIT++  +++LL D++L+T  Q + SG  SS+  ++E+A DIL K+P +FD+E A   YP TY +SMNTVLVQEM RFNKL   IRES  N+ KAIKGLVVMS ELE + SS+L  KIP MW   SYPSLKPLGSY+ND +ERL FLQ+W+  G P  FW+SGF+FTQAFLTG  QNFARK+TIPIDLLGFD+EV+        P DG YI GLFLDGA WN +T KL E  PKVLY+ VPV+WLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LP+++P  HW+ RG ALLCQL+
Sbjct:  125 RSTLVKLIMQQDGDLESDVIDE--SGIPK-------ATTTAREKDISRYYYYIRHGLDTDHVAPMEDSWLEHVLQLVPQHLKILNNSIM-VLSDEIREDYLLSVKKSIVDFVLKDPR----KKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNKKKQLPTGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESTRAFEHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDTHKEKIREVVLRESVAPTEHLK-MYD-KYQFLITGKAERDIDEFLFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLD--VQRYLKKAQVLNGKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPN--------------------------------------ALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQK----EFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMD-DFADENKQKERNDRESFSLLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEGLGRWDKWIKKLADTPPIPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKR--EDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPCT-WLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEE-FKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPS-YVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah7a (dynein, axonemal, heavy chain 7A [Source:MGI Symbol;Acc:MGI:2685838])

HSP 1 Score: 4055.37 bits (10516), Expect = 0.000e+0
Identity = 2077/3965 (52.38%), Postives = 2756/3965 (69.51%), Query Frame = 2
Query:  167 RKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDD---LVPFPEEPIGLD-FSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNE---RKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFL----PILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----NSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPN-VEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPE---VLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWF---QSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPK----------EINRFEVMLPETGLVYDYFYEHKVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKG-QEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKD--ADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            R  L K+++ +   +E  + D+   +P +  +        + E+ I   YY+++  +    + PM++ WL+++   +  HLK   +  +  +  E+++++  S+K+S+V   LK P     E DD   +   P     ++   + W  SF+     +   L  + P M  +L L ++TF +  + D+   H+ + A++    +  V    E   + ++K W+P+V NIFN+   +K +P  +   K +SF+NC   L++ Q+++L+  +++ + D+  +          P   M L  D   ++F P +++  + +  I   + +++  +P +++ +     S  +P  +  ++ N I+   KE++R    R    P E+ K +Y+  Y +LI G+ E +I + L +N +++   E I K+Q + ++I+          +  + CE+L   LVK    +   L+ ++ +DH++ N  + ++FE I + A + P  + EL ++ A++++     M+ L +++  SKI L +L++   FSP D++LN  VF W  ++  IFD + KI +      +  L  R E+ + EL+ +  +V+EF+ FG++    +++Y+Q  + L  KL  A  ++   N EEE F    S +P+ ++I+   +P++ L++  +++    R W  G ++ +  D++EA+V   +R L+K++K F++                                         AL +  K  + + EFK+ IP+I   C PG++ RHW+ MS+I    + P+  +++   + M L+ +++ F  IS AAS+E++LE  M KM  EW+++EF +  YRESG  IL+SVDDIQ LLDD I+KTQTMRGSPFIKP+E +++ WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F AVD+ W+D+M+  V+D  V+       +LERLK+SN LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIAK+EF   LDI  M SSE E +++   IST++ARG VE+WL++++  M+ SI  VI  +  AY   +R  WV +W GQ VLCVSQ +WT+EV  A+  G   L  Y  KCN QI +IV LVRGKL+ Q R+TLGALV +DVHARDV+  +  K++  ++DF WLSQLRYYW+E N   ++ NA ++Y YEYLGNS RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I R I    +  +FEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS GF+ AR L++KIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+ENE ILLLRSI+DVNLPKFLSHD+PLF GI SDLFPGV LP+ DY   L A+ + C   NLQ  DFF+EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A++ + E+G  E  KV    +NPKS+TMGQL+GQFD VSHEW+DG+ A +FR FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  M+LIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SW+ + P+   +++K    E ++ LF+  V   + F+ ++ K + PT   +LV++L+NLID  M      E+  + RN +  F   +  +LF++ WS+G     D R KFD   REL+ G   +    K              F V  PE G +YDY +  +  G W  W  DL       +     E +VPT+DT RY  ++++   H++  +FVGPTGTGKSVY  + L+N+L  D Y P  VNFSAQT+A QTQ IIMSKLD+RRKGVFGPP+GK  ++FVDD+NMPA+E+YGAQPPIELLRQ+ DH NWYDLKD + I L DI +M AMGPPGGGRN +TPR++RHFN+V++  FS+ +M  IFS +++ +++   +F  D+L +   +V  T+ +YK A+ NLLPTPAKSHY+FNLRDFSRVI G+CL + E  E+K    RLWVHEVLRV+YDRL++++DR WL   ++E +K + +E F  LF++L    +  V+E+ LRSLMF D+ +P    ED  Y E+ N++    IVE  +DEYNN  K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQS+TRLAA MA+  +FQ EISK YG  EW EDLK +L+K        VFL TD+QIK ESFLED++NLLN GEVPNLF  +EK E+ E +RQ  +  +K    D SP+ALF  F++ CR +LHVV+A SPIG AFR RLR+FPAL+NCCTIDWFQ+WPEDALE VA + LE ++M +++R   + + K FHTS INLS  F   L R NYVTPTSYLELI++F+ LL  K++E M+ K+RY  GLDKL  A+ QV+ MQ +LE L PQL  A +  + +M+ I RES+        VKA+E + N++A A+KA+ DEC ADLA A+P LE+AL+ALDTL   DIT+VK+M++PPAGVKLVME +CI++ IK +++ DP   GKK  D+WGP+K+LLGD+ FL  L EYDKDNI    M  IRK +I NP+F P K+  AS+AAEGLC+W++AM+SYD+VAK+VAPKKIKLA AE  LK  M  L + Q  L  V+DKL  L+  L+  + +K  L+ +V+LC+KKLERA++LIGGLGGEK RW+ +A+ L  +Y NL GD+L+S+GV+AYLG FTS YR      WS  CK   IPCS  +SL   LG  V I+AWNI GLP DSFSIDN +I+ NARRWPLMIDPQ QANKWIKNMEK   L +IKL+D  ++RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEYS +FR YITTKLRNPHYLPE +VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A+N+R LKE ED+IL  LS SEGNILE+ETAI+IL SSK+++++I +KQE AEET+KKID  RM Y PIA HS+ILFFSI DL NI+PMYQYSL+WF+NL+I SI +S KS +L KRL+ L DHFTYSLY N+CRSLFEKDKLLFSF L   +L+    +  TE+ FLLTGG+GL+N   NP T WL  KSWDEICRL+DL  FK  +E F    +GW+  YDS +P     P+ WG K + F+ +L++RC+RPDK++P +  ++ +KLG+ FIEPPPFDLA++F DS CCAPLIFVLSPGADP  ALLKFA+D+G+GGSK +S+SLGQGQGPIA +M+ +A ++GTWV+LQNCHLA SWM  +EK+CEE++ E+T+ +FR+WLTSYPSP FPV+VLQNGVKMTNE P GLR N+ +S++ D IS+PEFF  C   E  F+KLL+GLCFFHALVQERRKFGP+GWNIPY FN++DLRIS +QL MF+++YE++P+DA+RY+TGECNYGGRVTDDWDRR L +IL+ F+   ++ + +YKF  SG Y VPP  ++  YI++ K LP I  PEVFGM+ N DIT++  +++LL D++L+T    + SG  SS+  ++E+A DILGK+P +FD+E A   YP TY +SMNTVLVQEM RFNKL   IRES  N+ KA+KGLVVMS ELE + SS+L  KIPAMW   SYPSLKPLGSY+ND +ERL FLQ+W+  G P  FW+SGF+FTQAFLTG  QN+ARK+TIPIDLLGFD+EV+        P DG YI GLFLDGA W+ +T KL E  PKVLY+ VPV+WLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LP+  P  HW+ RG ALLCQL+
Sbjct:  125 RSTLAKVIMQKDGGLESDVIDE-SGIPKETTS--------ATEKDISRYYYYIRQGLDTDHVAPMEDSWLEHVLQLVPEHLKVLTNS-IKVLSDEIREDYLLSVKKSIVDFVLKDPR----EKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHSCQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIFNQGNKKKQLPTGKSTAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPLESIRVFEHPGFIMRLVLDKEAIKFEPEFNEYIDSLINIYEIMIKAVSFVPRVETKLYSQWESKSKPTTLKPIILNEIIDTHKEKIREVILRESVAPTEHLK-MYD-KYQFLITGKAERDIDELLFQNQNYERLIEEIRKYQKLGEEIQYTSQKTVCLGMFEMHCEELIRSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSTPLNTAELMEMKAHVQKLETTDMLELGQRLVDSKICLAFLIECVNFSPADIRLNKSVFQWYGRMGEIFDEHRKIIKEKTELYQEFLKFRCERFVEELESYAKQVEEFHAFGDLLD--VQRYLQKAQVLNGKLDAAADKIDQFNAEEEAFGWVPSAYPQRKKIQDALNPYLHLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPN--------------------------------------ALAMTKKVHSMVEEFKQYIPLIQVFCNPGLRPRHWEAMSTIVGYPLQPSDDSTVFSFIDMNLEPFLDRFGSISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSRDIMSQMPEEGRRFTAVDKTWRDVMKTVVQDKQVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIRDAIVAYTKTSRISWVRDWPGQTVLCVSQTFWTVEVQIAIPEGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHSMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQK----EFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMD-DFADENKQKERNDRESFSLLEGIFLFSLIWSVGATCTDDDRLKFDKILRELLEGPISNLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYDYQFIPEGLGRWDKWIKDLADTPPIPKDVQFNEIIVPTLDTIRYSALMNLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSNKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHDLFKNLDFNHDGTVEEDDLRSLMFCDFHDPKR--EDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAALHEVQDKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPSYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNAINKTEWRFLLTGGIGLDNPYTNPCT-WLPQKSWDEICRLDDLPAFKTIREEFMRLKDGWKKVYDSMEPHHEMFPEDWGNKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEE-FKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDKEYKKAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPRRPS-YVAPLYKTSERRGTLSTTGHSTNFVIAMILPSVHPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 4047.66 bits (10496), Expect = 0.000e+0
Identity = 2076/4003 (51.86%), Postives = 2786/4003 (69.60%), Query Frame = 2
Query:   56 SKMPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESD-DLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEG----NAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----NSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLP-NVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFD-HNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSW---LASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIW--FQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFE--------------VMLPETGLVYDYFYEHKVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMK-GQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGN--KDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
             K+P  +     G + S+ K    +K  + FR +      L  +++ Q  +++  + D   +  PKP A          E+ I   YY++   +    + PM++ WL+++ D +  HLK   D  +  +  E+++++  S+++S+V   LK P   G +   D +P     + +   + W  SF+     +   L  + P M  +L L +T F +  + D+   HN + A++  + +  +    +   + ++K+W+P+V NI+   N++K +P  +   K ESF+NC   L++ Q+++L   +++ + D+  +      A   P   M L  D++ ++F P   D  ++   + + + +++  +P +++ +     S  +P  +  ++ N I+   KE+++    +    P E+ + +Y+  Y +LI  + E ++  FL ENHS+++  + I K+Q + ++I+          +  + CE+L   LVK    +   LL ++ +DH++ N  + ++FE I + A + P  + EL ++ AY+++     MI L +++  SK  L +L++   FSP D++LN+ VF W  ++  IF+ H   I+E ++   E + L R E+ + EL+ +  + +EF  FG++    +++Y++  + L  KL  A  ++   N EEE F    S++P+ ++I+   +P+++L++  +++  + R W  G ++ +  D++EA++   +R L+K++K F++                                       P AL +  K  +++ +FK+ IP+I  +C PG++ RHW+ MS+I    + P+  ++++  L M L+ Y++ F  IS AAS+E++LE  M+KM  EW+ VEF +  YRE+G  ILASVD+IQ LLDD I+KTQTMRGSPFIKP+E +++ WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F AVD+ W+DIMR+ ++D +V+       +LERLK+SN LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIAK+EF   LDI  M SSE E +++ ++IST++ARG VE+WL++++ VM+ SI  V   +  AY    R  WV +W GQ VLCVSQI+WT EV  A+  G++ L  Y + CN+QI +IV LVRGKL+ Q R+TLGALV +DVHARDV+  + +K +  ++DF WLSQLRYYW+E +   ++ NA ++Y YEYLGNS RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I R I    +  MFEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS GF+ AR L+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+ENE ILLLRSI+DVNLPKFLSHD+PLF GI SDLFPGV LP+ DY   L A+ + CA  NLQ   FF+EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A++ + E+G  E  KV    +NPKS+TMGQL+GQFD+VSHEW+DG+ A +FR FAS+ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  M+LIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SW   L +   V++K    E +  LF+  V   + F+ K+ K + PT   +LV++L+NLID  M    ++  + E  + + +   +  +LF++ WS+G     D R KF+   REL+    ES    +  N F+              V  PE G +YDY +  +  G W  W   L +     +     E +VPT+DT RY  ++++   H++  +FVGPTGTGKSVY  + L+N+L  + Y P  +NFSAQT+A QTQ I+MSKLD+RRKGVFGPP+GK  V+FVDD+NMPA+E+YGAQPPIELLRQ+ DH NWYDLKD + I L DI +M AMGPPGGGRN VTPR++RHFN++++  FSD +M  IFS +++ +++   +F  ++L +   +V  T+ +YK A+ NLLPTPAKSHY+FNLRDFSRVI G+CL + E  E      RLWVHEVLRV+YDRL++++DR WL   ++E ++ +  E F  LF+ L    +  V+ + LRSLMF D+ +P    ED  Y E+ +++    IVE  ++EYNN  K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQS+TRLAA MA+  VFQ EISK Y   EW EDLK +L+K        VFL TD+QIK+ESFLED+ NLLN GE+PNLF  +EK E+ + +RQ  +  +  K  D SP+ALF  F++ CR +LHVV+A SPIG AFR RLR+FPAL+NCCTIDWFQ+WPEDAL+ VA + LE ++M +++R+  + + K FHTS I+LS+ FF  L R NYVTPTSYLELI++F+ LL  K+ E M+ KKRY  GL+KL  A+ QV+ MQ++LE L PQL  A K  + +M+ I +ES+        VKA+E I NE+A ASKA+ DEC ADLA A+P LE+AL+ALDTL   DIT+VK+M++PPAGVKLVME ICI++ IK +++ DP   GKK+ D+WGP+K+LLGDM FL  L EYDKDNI    M  IRK +I NP+F P K+  AS+AAEGLC+W++AM+SYD+VAK+VAPKKIKLA AE +LK  M  L + Q  L+ V+DKL  L+  L+  + +K  L+ +V+LC+KKLERA++LIGGLGGEK RW+  A+ L  +Y NL GD+L+S+GV+AYLG FTS YR     +W+ LCK   IPCS   SL   LG  V I+ WNI GLP DSFSIDN +I+ NARRWPLMIDPQ+QANKWIKNMEK   L VIKL++ D++RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEY+ +FR YITTKLRNPHYLPE +VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A N+R LKE ED+IL  LS SEGNILE+ETAI+IL SSKA++++I +KQE AEET+KKID  RM Y PIA HS+ILFFS+ DL NI+PMYQYSL+WF+NL+I SI +S KS++L KRL+ L DHFTYSLY NVCRSLFEKDKLLFSF L   +L+ +  +   E+ FLLTGG+GL+N  AN  T WL  KSWDEICRL+DL  FK  +  F    +GW+  YDS +P     P+ W  K + F+ +L++RC+RPDK++P +  ++  +LG+ FIEPPPFDLA++F DS CCAPLIFVLSPGADP  ALLKFA+D+G+GGSK +S+SLGQGQGPIA +M+ +A +EGTWV+LQNCHLA SWM  +EK+CEE++PE+T+ +FR+WLTSYPSP FPV+VLQNGVKMTNE P GLR N+ +S++ D IS+PEFF  C   E  F+KLL+GLCFFHALVQERRKFGP+GWNIPY FN++DLRIS +QL MF+N+YE++P++A+RY+TGECNYGGRVTDDWDRR L +IL+ F+N  ++ ++ YKF  SG Y VPP  ++  YIE+ K LP    PE+FGM+ N DIT++  +++LL D++L+T  +   +G  SS+  ++E+A+DILGK+P +FD+E A   YP TY +SMNTVLVQEM RFNKL   IR+S  N+ KAIKGL VMS +LE + SS+L  KIP MW   SYPSLKPLGSY+ND + RL FLQ+W+  G P  FW+SGF+FTQAFLTG  QN+ARKYTIPIDLLGFD+EV++       P DG +I GLFLDGA WN +  KL E  PK+LY+ VPV+WLKP KR  I    + Y  P+YKTSER+GVLSTTGHSTNFV+ + LP+++P  HW+ RG ALLCQL+
Sbjct:   94 GKLPHQVDDSYVGPSTSKSKGKSPHKERENFRST------LVNVIMQQDADLDSAVPDG--STIPKPTASAI-------EKDILRYYYYIHHGIDTDHVAPMEDSWLEHVLDLVPQHLKVFTDS-IVTLSDEMREDYLLSVRKSIVDFVLKDPREKGDDKKTDELPAHRAEMEI-LPKPWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEFHNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNKKKQLPTGDSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNEIVDAHKEKIKEVIMKESVAPTEHLR-LYD-KYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKL-RCERFVEELESYAKQSEEFYSFGDLQD--VQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDS--------------------------------------PYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIPMGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNLLPASVSVIQK----EFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERNDRETYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILRELM----ESPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGIGKWEPWIKKLKEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKR--EDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYANLCT-WLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEPHHEVFPEEWEDKANEFQRMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEE-FKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPS-YVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 4031.1 bits (10453), Expect = 0.000e+0
Identity = 2057/3928 (52.37%), Postives = 2743/3928 (69.83%), Query Frame = 2
Query:  293 ERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLD----FSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIF----EEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----NSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLP-NVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPE---VLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWF---QSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEI-NRFEVM--------------LPETGLVYDYFYEHKVRGYWHHW-NDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKG-QEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGN--KDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            E+ I   YY++   +    + PM++ WL+++   +  HLK   +  +  +  E+++++  S+K+S+V   LK P     E +D     E P          + W  SF+     +   L  + P M  +L L ++TF +  + D+   HN + A++    +  V    E   + ++K W+P+V NI+   N++K +P  +   K ESF+NC   L++ Q+++L+  +++ + D+     E   A   P   M L  D   ++F P + D  +++  +   + +++  +P +++ +     S  +P  +  ++ + I+   KE++R    R    P E+ K +Y+  Y +LI  + E +I +FL ++ +++   E I K+Q + ++I+          +  + CE+L   LVK    +   L+ ++ +DH++ N  + E+FE I + A + P  + EL ++ A++++     M+ L +++  SK  L +L++   FSP D++LN+ VF W  ++  IFD + KI +    + +  L  R E+ + EL+ +  + +EF  FG++    +++Y++  + L SKL  A  ++   N EEE F    S++P+ ++I+   +P+++L++  +++    R W  G ++ +  D++EA+V   +R L+K++K F++                                         AL +  K   ++ +FK+ IP++  +C PG++ RHW+ MS+I    + P+  +++   + M L+ +++ F  IS AAS+E++LE +M KM  EWE +EF +  YRESG  IL++VDDIQ LLDD I+KTQTMRGSPFIKP+E +++ WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F AVD+ W+D+M+  V++ +V+       +LER+K+SN LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA++EF   LDI  M SSE E +++   IST++ARG VE+WL++++ +M+ SI  VI  +  AY   AR  WV +W GQ VLCVSQ +WT+EV  A+  G + L  Y  KCN QI +IV LVRGKL+ Q R+TLGALV +DVHARDV+ ++ +KR+  + DF WLSQLRYYW E N   ++ NA ++Y YEYLGNS R+V+ P  D C+ TL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDY+A+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I   I    E  +FEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS GF+ AR L++KIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+ENE ILLLRSI+DVNLPKFLSHD+PLF GI SDLFPGV LP+ DY   L A+ E C   NLQ  +FF+EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A+  + E+G  E  KV    +NPKS+TMGQL+GQFD VSHEW+DGI A +FR FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  M+LIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SW+ + P+   +++K    E ++ LF+  V   + F+ ++ K + PT   +LV++L+NLID  M      E+  + RN +  F   +  +LF++ WS+G     D R K++   REL+ G     PI     N+F+++               PE G +YDY +  +  G W  W   L       +     E +VPT+DT RY  ++ +   H++  +FVGPTGTGKSVY  + L+N+L  D Y P  VNFSAQT+A QTQ IIMSKLD+RRKGVFGPP+GK  ++FVDD+NMPA+E+YGAQPPIELLRQ+ DH NWYDLKD + I L DI +M AMGPPGGGRN +TPR++RHFN++++  FSD +M  IFS +++ +++   +F  D+L +   +V  T+ +YK A+ NLLPTPAKSHY+FNLRDFSRVI G+CL + E  E+K    RLWVHEVLRV+YDRL++++DR WL   ++E ++ + +E F  LF++L    +  V+E+ LRSLMF D+ +P    ED  Y E+ N++    IVE  +DEYNN  K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQS+TRLAA MA+  +FQ EISK YG  EW EDLK +L+K        VFL TD+QIK ESFLED++NLLN GEVPNLF  +EK E+ E +RQ  +  +  K  D SP+ALF  F++RCR +LHVV+A SPIG AFR RLR+FPAL+NCCTIDWFQ+WPEDALE VA + LE ++M +++R   + + K FHTS INLS  F   L R NYVTPTSYLELI++F+ LL  K++E M+ K+RY  GLDKL  A+ QV+ MQ +LE L PQL  A +  + +M+ I +ESI        VKA+E + N++A A+KA+ DEC ADLAEA+P LE+AL+ALDTL   DIT+VK+M++PPAGVKLVME ICI++ IK +++ DP   GKK+ D+WGP+K+LLGD+ FL  L EYDKDNI    M  IRK +I NP+F P K+  AS+AAEGLC+W++AM+SYD+VAK+VAPKKIKLA AE +L+  M  L + Q  L+ V+DKL  L+  L+  + +K  L+ +V+LC+KKLERA++LIGGLGGEK RW+ +A+ L  +Y NL GD+L+S+GV+AYLG FTS YR     +WS  CK   IPCS  +SL   LG  V I+AWNI GLP D FSIDN +I+ NARRWPLMIDPQ QANKWIKNMEK   L +IKL+D D++RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +RLG+S IEY+ +FR YITTKLRNPHYLPE +VKV+LLNFMIT EG++DQLLGIVVA+E+P+LE+ +Q LI+  A N+R LKE ED+IL  LS SEGNILE+ETAI+IL SSKA++++I +KQE AEET+KKID  RM Y PIA HS+ILFFSI DL NI+PMYQYSL+WF+NL+I SI +S KS +L +RL  L DHFTYSLY N+CRSLFEKDK+LFSF L   +L+ +  +   E+ FLLTGG+GL+N   NP T WL  KSWDEICRL++L  FK  +  F    EGW+  YDS +P     P+ W  K + F+ +L++RC+RPDK++P +  ++ +KLG+ FIEPPPFDLA++F DS CCAPLIFVLSPGADP  ALLKFA+D+G+GGSK +S+SLGQGQGPIA +M+ +A ++GTWV+LQNCHLA SWM  +EK+CEE++PE+T+ +FR+WLTSYPSP FPV+VLQNGVKMTNE P GLR N+ +S++ D IS+PEFF  C  K   F+KLL+GLCFFHALVQERRKFGP+GWNIPY FN++DLRIS +QL MF+N+YE++P+DA+RY+TGECNYGGRVTDDWDRR L +IL+ F+   ++ + +YKF  SG Y VPP  ++  YIE+ K LP I +PE+FGM+ N DIT++  +++LL D++L+T  + + SG  SS+  ++E+A DILGK+P +FD+E A   YP TY +SMNTVLVQEM RFNKL   IRES  N+ KAIKGLVVMS ELE + SS+L  KIP MW   SYPSLKPLGSY+ND + RL FLQ+W+  G P  FW+SGF+FTQAFLTG  QN+ARK+TIPIDLLGFD+EV+        P DG YI GLFLDGA WN +T KL E  PKVLY+ VPV+WLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LP+++P  HW+ RG ALLCQL+
Sbjct:  191 EKDILRYYYYIHHGIDTDNVAPMEDSWLEHVLQLVPQHLKVLTNS-ITVLSDEMREDYLLSVKKSIVDFVLKDPR----EKEDDTKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPTMLAVLDLWHSTFKKLRLVDIEEFHNRQDALELSGFQNIVIKHMESAKETLLKTWFPEVQNIYYQGNKKKQLPTGDSSAKLESFFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESIRAFEHPGFIMRLVLDKKAVKFEPEFTDYIDILVNVYEIMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILDEIIDAHKEKIREVVLRESVAPTEHLK-MYD-KYQFLITRQAEQDIEEFLTQSQNYERLIEEIRKYQKLGEEIQYTSRKTVRLGMFEMHCEELIRSLVKRADIICGKLIAKMFRDHQEVNTMLCEEFEKIAEKALSTPPNTAELMEMKAHIQKVETTDMLDLGQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEGLKLRCERFVEELESYAKQAEEFYTFGDLQD--VQRYLKKAQVLNSKLDAAADKIEQFNAEEEAFGWIPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRAWTEGPYHKVNPDQVEADVGNYWRGLYKLEKAFHDSPN--------------------------------------ALAMTKKVRARVEDFKQYIPLVQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDVMKMVVQNKHVLAVVTIERMLERMKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSSEGEVVELVDTISTTKARGQVEKWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTFWTVEVQVAIPMGHKALEDYLGKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLANLVKKRISDDTDFEWLSQLRYYWHENNLETKMINAGLRYGYEYLGNSPRMVLAPFCDYCFLTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALGDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPQMLGWRPLMVSWINTLPQSVSIIQK----EFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMD-DFADENKQKERNDRENFSLLEGIFLFSLIWSVGASCTADDRIKYNKILRELMEG-----PISDLTRNKFKLLSGTEQTSSKALTVPFPEKGTIYDYQFIPEGLGRWDQWIKKLADTPPIPKDVQFNEIIVPTLDTVRYSALMSLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIITINEFSDKSMFTIFSRILTWHLRTCYKFPDDFLDLTTQIVNGTMTLYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLLDNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDLRSLMFCDFHDPKR--EDFGYREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQGELEALHPQLKVASRQVDDMMIMIEKESIEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELRIAMEGLRKKQAALREVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYVNLTGDILISSGVVAYLGAFTSNYRQHQTKEWSHSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDLFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSQRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIHENAINKAEWRFLLTGGIGLDNPYTNPCT-WLPQKSWDEICRLDELHAFKTIRREFMRLKEGWKKVYDSMEPHHEIFPEEWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSC-RKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIEYTKTLPLIPDPEIFGMNANADITKDQSETQLLFDNILLTQSRSSGSGAKSSDEVVNEVAGDILGKLPNNFDIESAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPS-YVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4056          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q8BW94|DYH3_MOUSE (Dynein heavy chain 3, axonemal OS=Mus musculus OX=10090 GN=Dnah3 PE=1 SV=2)

HSP 1 Score: 3732.18 bits (9677), Expect = 0.000e+0
Identity = 1980/3953 (50.09%), Postives = 2655/3953 (67.16%), Query Frame = 2
Query:  314 YYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILI--EVKQNFYDSMKRSLVQMSLKKP---------NVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGE-TLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKS-----VPKIEQDLK---ESFYNCTTILLSNQIKNLLGRTVEAWVDIF---EEGNAK---------FLPILKMY-LNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTI-------DSIINSNP----------QPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYL---------INGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLL----NLIDMIMKPHLEKEDVAE---NRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFE-VMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-----GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEE-MTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL-KTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            YY+L + ++   I P  E+ +  I   I   L      E  ++ +  E + ++Y S+ +S+V   L  P         ++P L       FP   I       WH  +   ++   + L  + P M KL  L    F     V     L  +  +     +  VQ  C +    ++  W P    +F  +K       PK + D     E ++      +S Q+++L+ +++   V  F   ++GN           F+P L M  L      + F P +DD  +LI      I ++   IP +        S I  +P          + +  P L   +++        S  +   ++  E FK     PY YL         ++   E  I++FL E H  +++   I   +    +I  +       +  L+   L   L +    L   L+      +R+ N  I  ++  I      +P  + EL  LI Y++++    +  L  ++R +  RL++L+D  +   E              I+ +F+ +  +  S + + E  L++R  +  S L+ +   ++ F +   M +E MK  V+ +  L   L  A  E   IN EEEL +  KS FP ++ +     P+ QL+    ++     +W++G    + A++I  E+  ++R  +K+ K   +                                       PA   +      +I +FK+ IP++   C PG+K RHW ++S I   +I P   T LA +L  G   ++++   I AAAS+E++LE N++KM+ +W  + FS   YR++  SIL +VDDIQ +LDD ++KTQTM GS FIKP E E + WEEKL+   E +D WLK Q  WLYLEPIFSSEDI+ QMPEEG+ F  VD  WK +M   V D  VM AAD   + E+L+E+N LLE I +GLN YLEKKRLFFPRFFFLSNDE+LEILSETKDPLRVQPHLKKCFEGIAKLEF + L+I  M SSE E +   Q I   +A+G VE+WL QV+ VML S+R VI    EAY    R+ WV EW GQVV+CVS I+WT EV EAL    + L  + +K N QI++IV+LVRGKL++  R+TLGAL  IDVHARDVV  +    + S NDF W+SQLRYYW E+N  V++      Y YEYLGNS RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTETTKDLAKALA QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIE+EVLSVVAQQIL I +AI   ++ F+FEGTEL LN  C V ITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+IGEISLYS GF+D+RSLA KIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+ENE++LLLR+++DVNL KFL+ D+PLF+GIISDLFPGVVLP+ DY +FL+A+     K  LQ V +F  KIIQ YEMM+VRHG+M+VG+P GGKT    VLA A+  L+     E   V ++ INPK+ITMGQL+G FDAVSHEWTDG+ AN FRE AS+ T DRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS  MSLIFE  DL QASPATVSRCGMIY++   +GW+P+  S++ + P  L K++  E+++ +F W V  CL F   +CK V+ T  IHL  +++    +L+D I     E+ ++ E   ++ + +W Q  +LF++ W++ G ++ +SR+KFDVFFR LI+G ++  P PK +   +  + PE G +YD+++  +  G+W+ W +    ++K E        + + ++PTM+TAR  F +   ++H   ++FVGPTGTGKS  T D L++ LP + Y P+F+NFSA+TSANQTQ IIMSKLDRRRKG+FGPPIGK AV+FVDD+NMPAKE+YGAQPPIELLRQ+ DHG W+D KDT ++ + D+ L+ AMGPPGGGRND+T RF RH N++S+  F D+ + +IFS++   +  G+ F   +L  G+ +VQAT  +Y+ A+ N LPTP+KSHYVFNLRDFSRVI G+ L     ++D   + RLW+HEV RVFYDRLI++ DR+  + L+KE+    FK+T + +  HL  +P   + ++++RSL FGDY+ P++  + ++Y+E+ ++     ++E  +DE+N+  K  MSLV+F++ +EH+SRICR+L    G+ LLVG+GGSGRQS T+L+  M +  ++Q EI+KNY   +WREDLK ++ ++G   K+TVFL +D+QIK ESF+EDI+ LLNTG+VPN+F A+EK +++E ++ AA+   +  + +PL+++ FF+ R   + +  +A SPIG AFRTRLR FP+LINCCTIDWFQ+WP DALE VA K LE V+++D++R + V + K+F  SV  LS +++ +L R NYVTPTSYLELI +F+TLLNSK+ E    + RY+ GL KL FA+ QV+ MQ++L  LQPQL+Q  +   ++MV I  E+  A+ ++L V+A+E+  N  A  S+A+ +EC  DLAEA+PALEAAL+ALDTL P+DIT+VK+MQNPP  VKLVME IC+M+ +KPER  DP+  GK + DYWG S+K+LGD+ FL  L+ YDKDNI + IM +IR+ FI +P+F P  +   SSA EGLC+W+ AME YDRVAKVVAPK+ +L +AE  L+  M KLN+ + +L+ VED+L +L  + +    +K  L++ +E+C++KL RA+KLI GLGGEKDRW +AA  L   YDNL GDVLL++G +AYLG FT  YR +C  +W   CK   IP SV FSL+  LG+P+KI+AW I GLP DSFS+DN +IV+N+RRWPLMIDPQ QANKW+KNMEK   L+VIK +D +++RTLENA+QFG PVLLENVGEELD  +EP+LLK  FKQ GV+ +RLGE+IIEYS+EF+ YITT+LRNPHYLPE+AVKV LLNFMIT  GL+DQLLGIV AKEKPELE+ + +LI+ SA N++ LKE ED+IL  LS  EGNILE+ETAI+IL SSK +S++I +KQE A  T+ +ID  RM Y P+A HSA +FF I+DL +I+PMYQYSL+WF+NLY+ S+ +SNKS  LD R+ Y+ +HFT S+Y+NVCRSLFEKDKLLFS LL   +L  +  ++   + FLLTGGV L+N   NPA  WLS+KSW EI R + L++ KG  E    N++ W+  YDS  P +  +P PW   L + + + +LRC+RPDKIVPAI N++ E +GK FIE P FDL  S+ DS CC PLIF+LSPGADP   LLKFA+D   GG+K  +ISLGQGQGPIAA MI++A  EGTWV+LQNCHLA SWM A+EKICEE + PENTN+EFRLWLTSYPS KFPV++LQNG+KMTNEPP GLR NL +S++ND IS+P FF  C  K   ++KLLFGLCFFHA+VQERR +G +GWNIPY FN+SDLRIS RQ+QMF+N+YE+VPF+A+ YLTGECNYGGRVTDD DRR L+++L  FY + +  D  Y  +P   Y++PP   Y  YIE+++ LP   +PEVFG+HEN DIT++ Q++  L   VL+TL + +   G S +  + E+A DIL K+P  F+LE+    YPV Y ESMNTVL QE+ RFN+L+  +R SL +L +AIKG V+MS ELE + +S+LVGK+PAMW+  SYPSLKPLG Y+ DL+ RL F Q+W ++G P  FW+SGFYFTQ+FLTGV QN+ARKYTIPID +GF+FEV  K + M   P DGAYI GLFL+GARW+  T ++GE  PK+LY+ +P+IWLKP +       ++ Y CPVYKTS R+G+LSTTGHSTN+VL + LPT+ P  HW+ RG A LCQLD+
Sbjct:  207 YYYLTNGIRKDMIAPENEEVMMRIYKLIPKTLLTTPALEPLQVSLRSEKESDYYYSLMKSIVDYILMDPMEKKRLFIKSIPRL-------FPHRVIRAPVP--WHNIYQSTKKWNEEHLHTVNPMMYKLKELWFAEFQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFFIPQLIMIKLEVRDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVYLCWKPLASYICVSPHLRMTSVLQVESILFPDLKGYNMILGTVNPEESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPSES-------------IEDVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSSFPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLID--------------------------------------VPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEALVE--DTLTDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYWTEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMDTLPRCLTKEHT-ELVEDMFTWLVQPCLDFSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQEEEMEIYEGLSSQQIFLWLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMGMDDRNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWTEY---ITKEEETIPANAKVSDLIIPTMETARQSFFLKTYLDHEIPILFVGPTGTGKSAITNDFLLH-LPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHF-GKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHL--SPTGKITDDNIRSLFFGDYLKPES--DQKIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTEGEKVEATPLSMYNFFIERGTNRAYFSLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIPGSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNMEKTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWPHEESLPSPWFF-LQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPENTNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSC-TKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIETD-NYHIAPGDAYVIPPYGSYQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPKETTMENIPEDGAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASF-LHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4083          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q8TD57|DYH3_HUMAN (Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1)

HSP 1 Score: 3712.54 bits (9626), Expect = 0.000e+0
Identity = 1939/3796 (51.08%), Postives = 2583/3796 (68.05%), Query Frame = 2
Query:  764 TVQLDCEKHDDNMMKVWYPKVINIFNERKS-----VPKIEQDLK---ESFYNCTTILLSNQIKNLLGRTVEAWVDIF---EEGN---------AKFLPILKMY-LNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII----------------NSNP-QPVFIPALLA-------NHILAY--AKERLRS----SATRCFEE----PKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLV-------KNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFE-VMLPETGLVYDYFYEHKVRGYWHHWND-LNKNLSK-GEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEE-MTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL-KTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
             +Q  C +    ++  W P    +F  RK       PK   D     E ++      +S Q++ L+ +++E  V +F   ++GN           F+P L M  L      + F P++D   ELI      I ++   IP +  I                  + P +P    A  A       N +L    A+E+L S       + F++    P +Y  N+Y+  Y  L++   E NI  FL ENH  D++   I   +    +I  +       +  L+   L   L +    L   L+      +R  N  I  ++ +I      VP  ++EL  LI +++++    +  L  ++R +  RL++L+D  +                 +I+ IFD++  +    + + E  L++R  +    L+ +   ++ F +   M +E MK  V+ +  L   L  A  E   IN EEEL +  KS +P ++ +     P+ QL+    ++     +W++G    L A++I  E+  ++R  +K+ K  ++                                       PA   +      +I +FK+ IP+++  C PG+K RHW ++S I   +I P   T L+ +L  G   ++E+   I AAAS+E++LE N+ +M+ +W  V FS   YR++  +IL ++DDIQ LLDD ++KTQTM GSPFIKP E E + WEEKL+   + +D WLK QA WLYLEPIFSSEDI+ QMPEEGR F  VD  WK +M   V+D  ++ AAD   + E+L+E+N LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDPLRVQPHLKKCFEGIAKLEF + L+I  M SSE E +   Q I  + A+G VE+WL QV+ +ML S+R+VI    EAY    R+ WV +W GQVV+CVS I+WT EV +AL      L  + +K N QI++IV+LVRGKL++  R+TLGAL  IDVHARDVV  +   RV   NDF W+SQLRYYW  ++  V++      Y YEYLGNS RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTETTKDLAKALA QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIE+EVLSVVAQQIL I +AI   ++TF+FEGTEL LN  C V ITMNPGYAGR+ELPDNLK LFR VAMMVPDYA+IGEISLYS GF+D+RSLA KIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP+ENE++LLLR+++DVNL KFL+ D+PLF+GIISDLFPGVVLP+ DY +FLK + +   K  LQ V +F  KIIQ YEMM+VRHG+M+VG+P GGKT    VLA A+  L+     E   V Y+ INPK+ITMGQL+G FD VSHEW DG+ AN FRE AS+ + DRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+  MSLIFE  DL QASPATVSRCGMIY++P  +GW+P+  S++ + P  L K++  E+++ +F W V  CL F   +CK V+ T  IHL         +LL+ I  + +  +E  +   ++ + +W Q  +LF++ W++ G ++ DSR+KFDVFFR LI+G +++ P PK +   +  + PE G +YD+++  +  G+W  W   + K   K   G  + E ++PTM+TAR  F +   ++H   ++FVGPTGTGKS  T + L++ LP + Y+P+ +NFSA+TSANQTQ IIMSKLDRRRKG+FGPPIGK AV+FVDD+NMPAKE+YGAQPPIELLRQ+ DHG W+D KDTT++ + D+ L+ AMGPPGGGRND+T RF RH N++S+  F DD + +IFS+++  +  G+ F   +L  G+ +VQAT  +Y+ A+ N LPTP+KSHYVFNLRDFSRVI G+ L     ++D     RLW+HEV RVFYDRLI+  DR+  + ++KE+    FK+T + +  HL  +P   + ++++RSL FGDY  P++  + ++Y+E+ ++ +   ++E  ++E+NN  K  MSLV+FR+ +EH+SRICR+L    G+ LLVG+GGSGRQS  +L+  M    ++Q EI+KNY   +WREDLK ++ + G   K+TVFL  D+QIKDESF+EDI+ LLNTG+VPN+F A+EK +++E ++ AA+   +  + +PL+++ FF+ R   K+   +A SPIG AFR RLR FP+LINCCTIDWFQ+WP DALE VA K LE V+++D++R + V + K+F  SV  LS +++  L R NYVTPTSYLELI +F+TLLNSK+ E    + RY+ GL KL FAA QV+ MQ +L  LQPQL+   +    +MV I  E+  A+ ++L V+A+E+  N  A  ++ + +EC  DLAEA+PALEAAL+ALDTL PADI++VK+MQNPP  VKLVME ICIM+ +KPER  DP+  GK + DYWG SKK+LGD+ FL  L+ YDKDNI    M +IR+ FI +PEF P  +   SSA EGLC+W+ AME YDRVAKVVAPK+ +L +AE  L   M KLN+ + +L+ V D+L  L    ++   +K  L+E +E+C++KL RA+KLI GLGGEKDRW +AA  L   Y NL GDVLLS+G +AYLG FT  YR +C   W A CK   IP    FSL+  LG+P+KI+AW I GLP DSFSIDN +IV+N+RRW LMIDP  QANKWIKNMEK   L VIK +D+++MR LENA+Q G PVL+EN+GEELD S+EP+LLK  FKQ GV+ +RLGE+IIEYS++F+LYITT+LRNPHYLPE+AVKV LLNFMIT  GL+DQLLGIV AKEKPELE+ + +LI+ SA N++ LKE ED+IL  LS S+GNILE+ETAI++L SSK +S++I +KQ+ A  T+ +ID  RM Y P+A HSA +FF I+DL NI+PMYQYSL+WF+NLY++S+  S KS+ L+ R++Y+ DHFT S+Y+NVCRSLFEKDKLLFS LL   I+  K ++    + FLLTGG+ L+N   NPA  WLS+K+W EI R + L +  G  E    NL  W+  YDS  P + ++P  W       + +++LRC+RPDK+VPA+  ++ E +GK +IE P FDL  S+ DS CCAPLIFVLSP ADP   LLKFA+D G GG++  +ISLGQGQGPIAA+MI+ A ++GTWV+LQNCHLA SWM  +EKICEE + PE+TN  FRLWLTSYPS KFPV++LQNG+KMTNEPP GLR NL +S++ND IS+P FF  C  K   ++K+LFGLCFFHA+VQERR FGP+GWNIPY FN+SDLRIS  Q+QMF+N+Y++VPFDA+ YLTGECNYGGRVTDD DRR L+++L  FY + +  D  Y  +P  TY +PP   Y  YI++++ LP   +PEVFG+HEN DIT++ Q++  L + VL+TL + +   G S +  + E+A DIL K+P  FDLE+    YPV Y ESMNTVL QE+ RFN+L+  +R SL NL +AIKG V+MS ELE + +S+LVGK+PAMW+  SYPSLKPLG Y+ DL+ RL F Q+W ++G P  FW+SGFYFTQ+FLTGV QN+ARKYTIPID +GF+FEV  + + M   P DGAYI GLFL+GARW+ +TM++GE  PK+LY+ +P+IWLKP +   +   ++ Y CPVYKTS R+G LSTTGHSTN+VL + LPT+ P  HW+ RG A LCQLD+
Sbjct:  388 VIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEMKFFIPQLIMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYL-NVYK-KYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLP--------------YQIEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLSD--------------------------------------VPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAENT--LLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDTLPSSLTKEHK-ELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRAVEEEEMELGEGLSSQQIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMGMDDNHPRPKSVKLTKNNIFPERGSIYDFYFIKQASGHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKSAITNNFLLH-LPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHF-GKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHL--SPTGKIVDDNIRSLFFGDYFKPES--DQKIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQGEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSWKFS-QGLEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSC-AKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIEEDY-YSLAPGDTYYIPPHGSYQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPQETVMENNPEDGAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGE-SAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q9P2D7|DYH1_HUMAN (Dynein heavy chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=5)

HSP 1 Score: 2973.73 bits (7708), Expect = 0.000e+0
Identity = 1601/3551 (45.09%), Postives = 2242/3551 (63.14%), Query Frame = 2
Query: 1439 LECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDY-LLDN--HEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEE---GHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKI---------WFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHK-VRGY--------------WHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIV-LQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDY----------LAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVA---LKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMG-FLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTY-IVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL--KTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            +  +++K  L K+   L+  +L+ +A++  KE   I E+F +I +     P + +EL +L  +M+    + ++GL E+I   K+  DY ++D   +  S +D         W  KI    +   +     + K   I +  +     +L+  ++ V  F+   E+      +   +VR ++ +LK+ +Q     N  E +F +P + + ++  +  +  P++ L+     + +    W++   + + A+++E  V E ++ + K  KQF +                                       PA  E+      +I EFK  IP+I  L  PG++ RHW+ +S+  N ++ P +  + A+ L M L  ++E  ++++  A +E+ +E  + KM +EW T+ F++  Y+ +   IL S D+  QLLDD IV TQ M  SP+ KPFE  I  WE KL  T E +++WL  Q  WLYLEPIFSSEDI QQ+P E + +Q ++R WK IM+N   +  V+       +L+ L++ N +L+ + KGL+ YLE KR  FPRF+FLS+DE+LEILS+TKDP  VQPHL+KCFE IA+L F   L+I  M+S+E E++++   I  S     VE WL +V+  M  S+ D+I  +  AY    R +WV  W GQV +   Q YWT+EV EALE G     ++ + C +Q+S++V LVRGKL+  QR  L AL+ I+VHA+DVV  + ++ V S NDF W+SQLRYYW   +  +R  NA   Y YEYLGNSGRLVITPLTDRCY TL GA HL   GAP GPAGTGKTETTKDL KALA+Q VVFNCSD LD++AMGKFFKGLAS+GAWACFDEFNRI++EVLSVVAQQI  I +A Q  VE FMFEG E+ L  +C V ITMNPGYAGR+ELPDNLK LFRPVAMMVPDYAMI EISLYS+GF +A  LA KI TT++L SEQLSSQ HYD+GMRAVK V+SAAGNLK + P  NE ++ LR+I DVN+PKFL  D+ LF GI+SDLFP +     DY +  +A+ E C   NL+ V+ F  K IQ YE  +VRHG MLVG    GK+    VLA AM+ L  +       +E V Y  +NPKSITMGQL+G+FD ++HEWTDGI ++  R  A     ++KW +FDGP+D +WIE+MNTVLDDNKKLCL SGEII++++ M+++FE  DL+ ASPATVSRCGM+YL+PS +G  P    WL   P +LK     E    LF   + E + FV  + K VI + + +L  +LL L+D   KP L +E + +  + K+         WF    +F++ WS+G   D   R  F  + R           +  E  +  ++ PE GLV+DY  E   + G               W  W D +   +     N    +VPTMDT +   ++DM + +++ ++ +GPTGTGK++   DKL+  L  D Y+  F+ FSA+TSANQTQ  I SKLD+RRKGVFGPP+G+  + F+DD+NMPA E YGAQPPIELLRQ+ DHG WYD K       L DI  + AMGPPGGGRN VTPR +RHFN +S     + +  RIFST++  ++ G      Y              + +V+AT+ VY T  S LLPTPAKSHY FNLRD S+V  G+ +    +VED+    RLW HE  RVF DRL+ + DR W  +LLK  +     E ++V F  +   P +P+        ++GD+M+P +  + + YE + + ++   ++E+ +++YN  +  K+ LV+F   + H+ RI R L    GNALL+GVGGSGR SLTRLA+ MA    FQ E+SKNYG  EWR+D+K +L KAG +     FL +D+QIK+ESFLEDI+N+LN+G++PNL+TA+E+ +++  +R   Q   +    +   L A +  R R  +H+V+  SPIG  FR RLRQFP+L+NCCTIDWF  WP +AL+ VA   L  +  ++   +     +++  + H SV     E+   L R NYVTP SYLEL++ F  L+  K+ E    K R  +GLDKL   +E V+ MQ  LE + P L +A K   L M  I  ++ +AE+ R  V+ EE   NEKA  ++A++D+ + DL EA+PAL+AAL++L  L   D+T V+ MQ PP GVKLV+E +CIM+ IKP++V     PG K+ DYW P K LL D G FL  L ++DKDNI   ++  I+  +I N EF P  +++ S A   +C+W+ AM  Y  VAK V PK+  L +A+ DL      L+E +++L+ VED +  ++ K ++   +K  L+ + E C ++L RA KLI GL  EK RW +   NLQ + +N+ GDVL++AG +AYLGPFT  YR      W    +S+ +P + + +L   LGNPVKI++W I GLP D+ S++N VI   ++RW   IDPQ+QANKWIKNMEK+ GL+V KL+D DF+R++ENAI+FG P LLENVGEELDP+LEP+LLKQ +KQ G  +L+LG+++I Y ++FR+YITTKL NPHY PEI+ K++L+NF ++  GLEDQLLG VVA+E+P+LE+A+ +LII++A  R+ LK+ ED+IL  LS SEGN +++   I++L++SK  + +I  K   AE+T+K ID  RM+Y P+A  + ILFF ++DL N+DPMYQYSL WF+N++++ I +S ++  L KR+  ++ + TYSLYSNVCRSLFEK KL+F+FLLC +I+M++G +  +E+ +LL+GG  +     NPA  WLSD++W +I  L++L  F  F   F  +L  +R  +DS +P    +P  W   LD F+ LLVLRC+R DK+  A+ ++V   L  +FIEP   +L+  F+DS    PLIFVLSPG DP   L KFAE+  F   K ++ISLGQGQGP A  M+  +   G WV  QNCHLA SWM A+E++ E + P+  + +FRLWLTS PS KFPV++LQNG KMT EPP G+R NL +S+ +  + E +F N C  K   F+ LL  LC FH    ER KFGP+G+NIPY F D DLRI   QL+MF++EY+ +P+  ++Y  GE NYGGRVTDDWDRRC+M IL+DFYN  V +  ++ +S SG Y  +PP  +   Y+ +IK+LP    PE+FG+H+N +IT    ++  LL +++    + +S+G    E  + ++  +IL K+P   +L+     YPV Y ESMNTVLVQE+ R+N+L   I ++LQ+LLKA+KGLVVMS +LE MA+SL    +P +WS  +YPSLKPL S++ DL++RL+FLQ W  +G P+ FW+SGF+F QAFLTG +QNFARK+ I ID + FDF+V+    S +  +P  G YI GLFL+GARW+ E  +L E +PK LY  + VIWL P   +  +  ++ Y CP+YKT  R G LSTTGHSTN+V+ V +PT +P  HW+KRG AL+C LD
Sbjct:  808 INTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMK-GIPERLVGLEERI--VKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISR--AHEIANEVRRVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKD--------------------------------------MPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVQLCFSIYPS---SNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLC-QQLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLKPYE--EHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRIVELIEPWF----IFSLIWSVGATGDSSGRTSFSHWLR-----------LKMENEQLTLLFPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALD-YISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLLKRCM-----EQWEVTFNKV--CPFQPI--------LYGDFMSPGS--DVKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQ--EQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPG-EKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQP-YIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGG-SISIMTENPAPDWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKF-SKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSS--LGE-DFLNSC-HKVMEFKSLLLSLCLFHGNALERHKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDV-LSPEHSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTP-NRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALICALD 4264          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A4S2L703 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009613 PE=4 SV=1)

HSP 1 Score: 5560.73 bits (14424), Expect = 0.000e+0
Identity = 2700/3994 (67.60%), Postives = 3275/3994 (82.00%), Query Frame = 2
Query:   56 SKMPRN---LPPIEEGS--TKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALME-----------------KAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEIN-RFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAG---NKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKR---DVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            SK+ R    LP IE+     + ++KDP   K L+ F +  E + ++ KL I +A    +    +F T  PK P    PS MMSEE  +  NY  LKS V++S IPP+Q+ WLQNI +KI   LK G++ E++++L EV++NF +S+K++L + +LKKP++P L  DDL P PEEP  ++FS+ WH  +VK+R+EL  +LMILYPHMQK+L LC   F +  +TDV A  N GA+DFE L+  VQ +     + + + W PK+  +F+++ ++P +  D+ ESF+NC + +LS QIK+ L R +E WVD+F+E + + LP+LKMYL ++  ++QFYP+ +DLE+LI FI + IT S+Q++PT+ S +N      ++ A L  H+L  A+E+LR++  R  E P +YF+  +  PYS+L++G E   +  FLN    F +Y EY  K   I  ++  LPN EYF LIRL+CED+K GL +E  RL+  LL RV  D ++ N EI   FE ++  +  +P+ S+EL D+I YMEEARCQGM+ +  KI  ++  LDYLLD + F+PED+  NS VF+W  +IQP FD NDK+QE +++  E+ ++ RREKL +EL + + RVDEFN++GEMDSEM  QYVQDVR +  +L +A  E +WIN EE L+++  + +P+IEEI+A ++PF +LF  V++Y KSER+WLHGEF+ L A+ IEAEV+E +RE+FK+QK F  + KK  ME                  A  +    +         L   +E +  KPPAAL+I  K   Q+  FKE IPVIA LC PGI+KRHW++MS IA +D+TP+SGTSLAK+L + LD YM+EFA IS+ AS+EFTLE NM+KMRE+W  V F +T YRE+GISILASVDDIQQ+LDDQIVKTQTMRGSPFIKPFE EIK WEE+LL+  ETID+WLK+QAQWLYLEPIF SEDIMQQMPEEGRLFQ VDRNWKDIMRNT +DPNV+KA  F GI ERLK+SN LL+KINKGLNAYLEKKRLFF RFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDN+LDI AMFSSE EKI +SQV+STSEARGAVE+WLLQVQ+ ML+S+RDVIAA+REAY  E R++WVC W GQVVLCVSQI+WTL+VHE L  GV+GL  YH+K ++Q+++IV+LVRGKLNAQQRITLGALV IDVHARDVV DM +  V SENDFNWLSQLRYYWEEEN  VRLTNATVKYAYEYLGNS RLVITPLTDRCYRTLIGA+HLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIE+EVLSVVAQQILCIIRAIQ HV+ F+FEGTE+ LN NCYVCITMNPGYAGRSELPDNLK+LFRPVAMMVPDYAMIGEISLYSYGFMDARSL+VKIVTTYRLCSEQLSSQ HYDYGMRAVKAVLSAAGNLKLK+PDENENILLLRSI DVNLPKFL+HD+PLFRGIISDLFPGVVLP+ADYT+FL    +V  +HN+Q V FF EK+IQ+YEMMIVRHGFMLVGEPFG KT VLH LAE M++LNE GH+E+EKV+++TINPKSITMGQLFG+FD VSHEWTDG+TAN FREFASNDTP+RKWV+FDGP+DTLWIESMNTVLDDNKKLCLMSGEIIQMS+VMSLIFETMDLSQASPATVSRCGMIY++P S+GWRP+  SW  S P+VL   +G E +  L +W ++ CL F+  NC+ ++ T   +LV + L  ++M++  H ++ED +ENR L++W  +A++F + W +GG LD   RQKFD F R +++G++E +P+PKE+  R E  +PE GLVYDY+YE+K RG W HWN+ NKN+     +NIRE +VPTMDTARYK+II +C+++ + LMF+GPTGTGKS Y Q+KLM EL  +++V  F+NFSAQTSANQTQ I+MSK+DRRRKG++GPP+GK A+ FVDD+NMPAKE YGAQPP+ELLR   DHG WYDLKDTTK++LQDI L+ AMGPPGGGRNDVT RFLRHF++VSMT F+D+TM RIFSTLM  YM+ QEF+S+Y+++GQ MV +TLEVYK A+ NLLPTPAKSHY+FNLRDFSRVILGICLI+K++VEDK+T+ RLW HEV+RV+YDRL +D DR WL+  +K  +  +FKE  D+LF HLT    EP++E+HLRSL+FGD+M+ D++PEDR YEE+K I+  YP++EQC+D+YN  +K KM LVIFRYV+EHLSRICRIL  PGGNALLVGVGGSGRQSLTRLAAAMA   +FQPEISKNYGK EWRED+K LL++AGGEGK TVFLMTD+QIK+ESFLEDIDNLLN+GEVPNL+ +EEK EV+++++ A +A     + AD SPLAL+A FVNRC+EKLHVVMAFSPIG AFR RLRQFPALINCCTIDWFQ WPEDALERVA KAL+ +DM+D++RN TV + K+FHTS+ +L+++F + LGRK YVTPTSYLELI+SF+ LL  KQ+E  R + RYVNGLDKLAFA+ QV+DMQ+KLEELQPQLV+A   NE L++ I+ ES+  E+QR+KVKAEEEIVN+KADASKALS+ECRADLAEA PAL+AAL ALDTL+PADITIVK+M+NPP GVKLVME +C+MR+IKP++VNDP   GKK+ DYWGPSKKLLG+M FL  LRE+DKDNI+  IM +IRKE+I NP+FDP +V+RASSAAEGLC+WI+AME YDRVAK+VAPK+ KLA+AE++L ENM  L +TQ  L  VE+KL NL+ +L+ T++EK RL+EEV LCA KLERAKKLIGGLGGEKDRW+QAA +L  +Y NL GD+L++AGVIAYLGPFTSV+R++C+ DW  LC  Y I CS  FSLT+CLG+PV+IQ WNI GLPRD+FSIDNSVIVA ARRWPLMIDPQ QANKWIKNMEKE G+ V+KLTD+DFMR LEN IQFG PVLLENVGE+LDPSLEPLLLKQ FKQ+GV+M+RLGE++IEYS +FRLYITTKLRNPHYLPE+AVKVSLLNFMITLEGLEDQLLGIVVAKEKPELE+ARQELI+T+ANNRRMLKETEDRILATLSESEGNILENETAI+ILDSSK +SDDI KKQ+ AEETQKKID+ RMDYAPIA+HSA+LFFSITDLPNIDPMYQYSL+WFVNL+INSIHDSNKSK+++KR+RYL DHFTYSLY NVCRSLFE  KLLFS +LC+K+LMS+G+LE  E+LF LTGGVGLENK ANPA++WLSDKSWDEICRL+ LK FK F+E F  +L  W+ +YDSKDP +  +P PW  K+D F+ L+VLRCIRPDK+VP + NYV+EKLG+KFIEPPPFDLAR++QDS C  PL+F+LSPGADPTMALLKFA DKGFGG++F SISLGQGQGPIAA MI++ K +G+WV+LQNCHLAVSWM A+EKICE++T ENTN  FRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNL QS++ND IS+PEFF GC GK+ TFEKLL+GLCFFHALVQERRKFGP+GWNIPYGFN+SDLRIS RQLQMFVNEY++VP+DAI+Y+TGECNYGGRVTD+ DRRCLMTIL DF    ++ D +YKFS SG Y  P KMEYT+Y+EFIK+LP+ QNPEVFGMHENVDITREL ++R+L DS+L+T+GQ T+   G S+ +L EIA+DILGK+P +F+LE A   YP+ Y ESMNTVLVQEMERFN L+  I+ +L +L KAIKGLV+MS  LE++A++L V K+P +W+  SYPSLKPLGSYINDLIERL+F ++W+ E KP T+W+SGF+FTQAFLTGV+QN+AR+ TIPIDLL FDF VL T H +  P++GAY+ GLFLDG RW+ + M+LGEQ+PKVL E +P++ LKP  R   + +S T NRY CPVYKTSER+GVLSTTGHSTNFVL VFL T    SHWVKRG ALLCQLDD
Sbjct:    3 SKIKRTFQPLPNIEKVKLEIEEKEKDPTLQKFLR-FSLEKERKAEIDKLSIKRANAAYRLAQIEFATRAPKLPQLDLPSFMMSEELKLSKNYKLLKSYVESSIIPPIQDSWLQNIMEKIPKRLKSGKEAELNQVLYEVRENFLESLKKALARQTLKKPDIPQLADDDLTPPPEEPKNINFSKPWHGEYVKHRKELVSRLMILYPHMQKILDLCQRQFAQIKITDVKAYRNLGAVDFENLKAAVQQEVANKMEILTQKWLPKIFQLFSDKNAIPPLRSDMLESFFNCVSTVLSIQIKHFLQRNLEEWVDLFDEEHTERLPVLKMYLTYEDQKVQFYPSMEDLEDLILFISDQITNSLQQVPTVQSWLNIPTNKKYVDATLPPHVLNPAREKLRAAVKRYLESPYKYFEKEFVEPYSFLLDGSEAKKVENFLNSKQEFRDYREYTAKLHAIGHEVMTLPNTEYFDLIRLDCEDVKVGLSRECRRLANALLERVVSDFKQTNNEICASFEEMRDRSRAIPQNSEELIDMIRYMEEARCQGMVRMEGKISWAREYLDYLLDVYIFTPEDIAQNSAVFSWKARIQPEFDENDKLQERMRAVGESAVIARREKLTTELNRLRNRVDEFNDYGEMDSEMQNQYVQDVRAVLKRLMDAENERAWINKEEALYRLQVTSYPDIEEIRALAEPFQRLFTTVVRYNKSERRWLHGEFDKLNAEAIEAEVEEYWREVFKLQKLFTARVKKMRMELDERRRNQRKRRKEEARAAAEEGADPEAIAAAEAAALAAEKELEDVKPPAALDIIKKIQAQMKSFKEIIPVIAILCNPGIRKRHWEQMSLIAGQDLTPDSGTSLAKMLQLNLDPYMDEFAGISSGASKEFTLETNMRKMREDWVEVAFGMTAYRETGISILASVDDIQQMLDDQIVKTQTMRGSPFIKPFECEIKEWEERLLYIQETIDEWLKMQAQWLYLEPIFCSEDIMQQMPEEGRLFQVVDRNWKDIMRNTAKDPNVLKATAFQGIKERLKDSNALLDKINKGLNAYLEKKRLFFARFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNRLDIKAMFSSEGEKIVLSQVVSTSEARGAVEKWLLQVQESMLLSVRDVIAAAREAYEIENREDWVCSWPGQVVLCVSQIFWTLDVHEYLRYGVQGLQNYHQKLDQQMADIVRLVRGKLNAQQRITLGALVVIDVHARDVVRDMIKMEVTSENDFNWLSQLRYYWEEENVKVRLTNATVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIEMEVLSVVAQQILCIIRAIQAHVDRFVFEGTEIDLNPNCYVCITMNPGYAGRSELPDNLKILFRPVAMMVPDYAMIGEISLYSYGFMDARSLSVKIVTTYRLCSEQLSSQPHYDYGMRAVKAVLSAAGNLKLKFPDENENILLLRSIQDVNLPKFLAHDLPLFRGIISDLFPGVVLPEADYTVFLSEAEQVAKEHNIQAVPFFKEKLIQTYEMMIVRHGFMLVGEPFGSKTTVLHTLAEVMTRLNESGHEEYEKVLFKTINPKSITMGQLFGEFDPVSHEWTDGVTANAFREFASNDTPERKWVVFDGPVDTLWIESMNTVLDDNKKLCLMSGEIIQMSRVMSLIFETMDLSQASPATVSRCGMIYMEPMSLGWRPLARSWFNSLPQVLIAGDGRETISALLDWLIDPCLEFIRLNCRSMVSTRQANLVTSCLGFVNMLIDVHAQQEDASENRYLRLWTCTAFIFGVVWGLGGCLDLSGRQKFDQFLRAVMLGQDERYPVPKELGPRIEFPMPEGGLVYDYYYEYKSRGSWKHWNERNKNIDLSTNRNIREMIVPTMDTARYKYIIQLCLDNGRRLMFIGPTGTGKSAYVQEKLMRELDIEKFVAYFMNFSAQTSANQTQMILMSKVDRRRKGIYGPPVGKTALFFVDDLNMPAKEEYGAQPPVELLRMLVDHGYWYDLKDTTKLILQDINLITAMGPPGGGRNDVTQRFLRHFHMVSMTPFNDETMYRIFSTLMLTYMRIQEFSSEYISMGQVMVNSTLEVYKAAMENLLPTPAKSHYIFNLRDFSRVILGICLIQKDRVEDKKTFARLWTHEVMRVYYDRLTDDPDRNWLFNFIKNVLANNFKEKIDLLFAHLTKGNGEPIEEKHLRSLLFGDFMDSDSLPEDRAYEEIKEISAVYPVIEQCLDDYNQANKKKMPLVIFRYVVEHLSRICRILRVPGGNALLVGVGGSGRQSLTRLAAAMAGYTIFQPEISKNYGKAEWREDIKVLLRRAGGEGKPTVFLMTDTQIKEESFLEDIDNLLNSGEVPNLYNSEEKAEVMDMIQTAQEAAAGVGQSADLSPLALYALFVNRCKEKLHVVMAFSPIGEAFRNRLRQFPALINCCTIDWFQPWPEDALERVAHKALQHLDMDDEVRNVTVHLFKYFHTSITSLADKFLRRLGRKTYVTPTSYLELIDSFQRLLTQKQNEISRARTRYVNGLDKLAFASTQVADMQVKLEELQPQLVEASAENENLLIVIATESVAVEEQRVKVKAEEEIVNQKADASKALSEECRADLAEAQPALDAALCALDTLKPADITIVKSMKNPPTGVKLVMEAVCVMRDIKPDKVNDPAGSGKKINDYWGPSKKLLGEMNFLASLREFDKDNINPAIMQRIRKEYIVNPDFDPAQVARASSAAEGLCKWIMAMEQYDRVAKIVAPKRAKLAEAEAELAENMAALKKTQAALHEVEEKLENLQNQLQATQEEKQRLEEEVLLCATKLERAKKLIGGLGGEKDRWSQAADHLLRVYSNLTGDILVAAGVIAYLGPFTSVFREECIYDWIRLCTEYNITCSENFSLTSCLGDPVRIQQWNINGLPRDAFSIDNSVIVAMARRWPLMIDPQGQANKWIKNMEKEAGITVVKLTDSDFMRNLENGIQFGTPVLLENVGEDLDPSLEPLLLKQTFKQSGVEMIRLGENVIEYSGDFRLYITTKLRNPHYLPEVAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEEARQELIVTTANNRRMLKETEDRILATLSESEGNILENETAIEILDSSKQLSDDIQKKQKVAEETQKKIDSTRMDYAPIAKHSAVLFFSITDLPNIDPMYQYSLTWFVNLFINSIHDSNKSKIIEKRIRYLIDHFTYSLYVNVCRSLFEAHKLLFSLVLCAKLLMSRGELEMNEFLFFLTGGVGLENKLANPASNWLSDKSWDEICRLSSLKSFKEFREHFETHLTEWKRYYDSKDPHETPLPPPWD-KVDVFRALIVLRCIRPDKVVPGVLNYVREKLGRKFIEPPPFDLARTYQDSSCTTPLLFILSPGADPTMALLKFATDKGFGGARFQSISLGQGQGPIAANMIAQGKADGSWVLLQNCHLAVSWMPALEKICEDLTIENTNGTFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLLQSYLNDPISDPEFFGGCAGKQETFEKLLYGLCFFHALVQERRKFGPLGWNIPYGFNESDLRISVRQLQMFVNEYDKVPYDAIQYMTGECNYGGRVTDERDRRCLMTILCDFLCPAIVSDPRYKFSASGLYFAPNKMEYTDYLEFIKSLPATQNPEVFGMHENVDITRELSETRMLTDSILLTVGQSTTGTVGFSDAELDEIASDILGKIPDAFNLEDAIKKYPIKYEESMNTVLVQEMERFNNLTRVIKNTLTDLKKAIKGLVIMSEMLESLAAALSVNKLPDVWAGKSYPSLKPLGSYINDLIERLDFFRRWYQEDKPPTYWISGFFFTQAFLTGVLQNYARRNTIPIDLLAFDFAVLPTHHEDTPPDEGAYVHGLFLDGCRWDYDAMELGEQQPKVLNEPMPILQLKPMLREKLETVSATLNRYTCPVYKTSERRGVLSTTGHSTNFVLAVFLKTSVNPSHWVKRGAALLCQLDD 3994          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A1I8JJN8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 5424.75 bits (14071), Expect = 0.000e+0
Identity = 2671/3946 (67.69%), Postives = 3192/3946 (80.89%), Query Frame = 2
Query:  281 MMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKK----ALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDE-FEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLT--TTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKET-GLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSK-----------------------------------------------GDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEE-MTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            MMS++R +R+NY FL+ CV++SPIPPM  +WL NIK KI+ HL++G+D  ++E+L EV QNF  SMK+SLVQ+SLKKP+VPGLE DDLV   EEP+GLDFS+EWH SFV N+ E+S +LMILYP M KLL LC    G+ ++ D+     E  M+FE LRT V  +CEK ++ ++  WY +V+ IF+ER +   +  DL+E FY+C T L+SNQ+K L   TV AWV +F+E     LP L M+L+F   QM   P Y   E+L+  +++ + +S+  IPT+ S +++ P  V +P  LA HI+  AK +L+S+A R FE  +   ++ +E  Y YL++G   + + KFL E H+F EY E IE+++ I+  I+  P +E++ LIRL  E+LK+GL +     +  LL RV +DHR EN +I ++F+ ++  A+  PETS+EL ++I +ME+AR  GM+ L+EKI+ S+ RL YLLD   F+ +DL+LNSEV TW ++I PIFD N+ +QE  K++ E +L++R+EKLI+ELQ+ + RVDEFN++GEMD E+M QYVQDV  +Q +L  AR +  WIN EE+L+K P + FP+I+++     PF+ +F+   +Y   E +WL GEF  L A++I  EVDEI RE+F++ K FNN+ KK        + E+ + KK +  T  +      ++++  KPPAAL+IC+    +I EFKEKI VI  LC PGI++RHW+KMSSI   DITP+SGT+L KVL + LD++MEEF QISAAA++E +LE  MKKM E+WE + FSL  YRE+GI+IL+SVDDIQ  LDDQI++TQTMRGSPFI+PFE EI+ WEE+LL   ETID+WLKVQA WLYLEPIFSSEDIMQQMPE+GRLFQ VDRNW+DIM+NT +DP ++KA D  G+LE+LK+SN LL+KI KGLN+YLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFD+ LDIH M+SSE EKIK SQ ISTSEARGAVE+WLLQVQDVMLMS+RDVIAAS +AY  EAR +WVC+W GQVVLCVSQIYWT EVH++L  GV+GL  Y++K + Q+S+IV LVRGKLNAQQRITLGALV IDVH+RDVVEDM +K V  ENDFNWL+Q+RYYWE+EN  +RLTNA V+YAYEYLGNS RLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQIL II A++     F FEGT L+LN NCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYS+GFMDAR+LAVKIVTTYRL SE LSSQSHYDYGMRAVKAVLSAAGNLKLK+PD++ENILLLRSI+DVNLPKFLSHDIPLF GIISDLFPGV  P+ADY +FL  +  VC  H LQ+VDFFTEKIIQ+YEMMIVRHGFMLVGEPFGGKT VLHVLAE M+ LNE G+ E +EKV+YRTINPK+ITMGQLFGQFD VSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYL+PS++GWRP+  SW+ S PEVL KD   E+M  L EW ++ CL FV K+C+  I +   +LV++ +  IDM+M  H+  E+  +N++LK W  +AWLFA+PWSIGG+LD DSR+KFD FFRELI G+NE+ PIPKEI + E + PE G+VYDY YE K RG W HWNDL +      GK IRE LVPTMDTARYKFI+D+C+E  + LMFVGPTGTGKSVY QDK+MNEL  D++VP FVNFSAQTSANQTQ +IMSKLDRRRKG+FGPPI K AVIF+DD+NMP KE+YGAQPPIELLRQYFDHGNWYDLKDT+KI+LQD+Y + AMGPPGGGRND+TPRF+RHFN+VSMT F+DDTMIRIF+ LM+ YMK Q FTSD+LA+G T+V +T+EVYK AI NLLPTPAKSHYVFNLRDFSR+ILG+CLIK+EQV +KR +TRLW HEV+RVFYDRL +D+DR+WL+KLL++S+K HFK++F+ +FEHL    T    V EE +RSL+FGD+MNPD  P++RVYEE K+I++ YPIVEQ +DEYNN  KNKM LVIFRYVLEHLSRICRIL +PGG+ALLVGVGGSGRQSLTRLA +MA  ++ QPEISKNYG  EWRED+K ++KKAG EGK TVFLM D+QIK+E+FLEDIDNLLNTGE+PNLF  +EK E++E VR  AQAG+K+ADFSP+AL+AFFVNR RE LH+V+AFSPIG AFR RLR+FP+LINCCTIDWFQ WP DALERVA+K+ E+VDMEDD R D VKIV++FHTS+  LSE+F   +GRK YVTPTSYLELI SFR L+N+KQ+ETMR K+RYVNGLDKLAFA EQV DMQ KLE LQPQLVQA   N  LM  I  ES++  +Q  KV  EE +VNEKA +S+AL DEC ADLAEA+PALEAAL AL+TL+P+DITIVKTMQNPP GVK+VM  +C+MR++ P+++ DP    KK+LDYWGPSKKL+ DM FL YL+EYDKDNI   +MTKIRKE+I NPEF+P KVSRASSAAEGLC+WILAME YDRVAKVVAPKK KLA+AES+LK NM  L + Q +L+ V+DKL  LKQ+L+D ++EK RL+ EV+LCAKKL+RAKKLIGGLGGEKDRW QAA NLQ+IYDNL+GDVL+SAGVIAYLGPFT +YR +   +W  LCK   IPCS  FSLT CLG+PV+IQAWNI GLPRD+FSIDNSVIV+N+RRWPLMIDPQ QANKWIKN  K T G  VIKL+D+++MR +E AI +G P+LLENVGEELDPSLEP+LLKQ FKQN                 F+ +ITTKLRNPHYLPEIAVKVSLLNFMIT EGLEDQLLGIVVAKEKP+LE+ RQ LI  +A NRR LKE ED+ILATL+E+EGNILENE+AIQILDSSK +SDDI KKQ+ AE+TQ+KIDAARMDYAPIA HS+ILFFSITDLPNIDPMYQYSL WFVNLYI+SI++SNKSK+L++R+RYL DHF Y+LY NVCRSLF KDKLLFS  LC+ ++++K                                               G+L+  E LFLLTGGVGLENK  NP  SWLS+KSWDEICR++DL  FKGF++ F  ++  W+ FY+SKDP +A +P+PW TKLD FK ++V+RCIRPDKI+P +T YV+EKLG KF+EPPPFDL+RS+QDS+   P+IFVLSPGADPTMALLKF +D GF G+KF+SISLGQGQGPIAA+ I +A  +G+W+MLQNCHLAVSWM  +EKICEE +  ENT+ +FRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNL QS++ND IS+P FFNGCPGKE+TFEKLL+ LCFFHALVQERRKFGPMGWNIPYGFNDSDL IS RQL+MFVNEYEQVP+DAI YLTGECNYGGRVTDD DRRCLMTIL DFYN  V+ + KYK SPSG Y +P KM+Y +Y+EFIK LP+ Q+PEVFGMHENVDI+RELQ++R L DSVL+TLGQ  SS  G S++ L+EIA DIL K+P +FDLE A   +PV Y ESMNTVL QEMERFNKL   +R SLQ+L KAIKGLVVM+ +LEA+  SL VGK+PA+W + SYPSLKPLGSYINDL+ERL FL+KW++E KP+ FW++GF+FTQAFLTGV QN+ARKYTIPIDLLGFDF+VL    M+  P DGAY+ GL+LDGARW+ +   L EQ PK+LY+ VPVIWL+P KR+ I    NRY CPVYKTSER+GVLSTTGHSTNFVLP+ L   E  SHWVKRG ALLCQLDD
Sbjct:    1 MMSDDRKVRLNYEFLRKCVESSPIPPMSPEWLVNIKHKIAEHLREGKDDFLNEVLAEVNQNFDTSMKKSLVQLSLKKPDVPGLEDDDLVEPSEEPVGLDFSKEWHESFVANKREISYRLMILYPQMPKLLELCQRELGQQIILDLAEYKAESPMEFETLRTNVTYECEKMEERLLGHWYREVMKIFSER-TTSVLRVDLQEPFYSCVTTLMSNQLKLLKEETVNAWVLLFDEEQRFRLPQLNMFLSFQDRQMSVDPEYAVYEDLLLSVVDEVNKSLSSIPTVSSQLSATPN-VNVPTELAEHIVQLAKAKLKSAAARYFESVENSLRSYHE-RYDYLVDGTANSRVEKFLTEEHTFAEYCELIEEYRAISYAIRRNPTIEFYDLIRLNVEELKNGLAEVAQGYADRLLERVVRDHRAENTKICQQFDYVKARAQKKPETSEELMEMIKFMEQARSTGMVTLNEKIKESQNRLQYLLDVWIFNDDDLQLNSEVLTWPKRISPIFDENETLQEESKTQGEKLLIERKEKLIAELQRIRNRVDEFNDYGEMDLEIMSQYVQDVNKVQQRLDTARADSEWINKEEQLYKYPVTPFPDIDDLTNLMQPFLSIFKNTFRYLNKENQWLKGEFLALDAERIAEEVDEISREIFRVSKVFNNRLKKMQAEKEEREREKKKRKKLEEDTQGEGGEEEKDDEEEVKPPAALDICNTLTEKIREFKEKINVIEILCNPGIRQRHWEKMSSICGFDITPDSGTTLIKVLGLKLDAFMEEFGQISAAATKEHSLEKGMKKMIEDWEPISFSLIPYRETGINILSSVDDIQTQLDDQIMRTQTMRGSPFIRPFEKEIREWEERLLRIQETIDEWLKVQANWLYLEPIFSSEDIMQQMPEQGRLFQTVDRNWRDIMKNTAKDPKLLKATDMPGLLEKLKDSNDLLDKIQKGLNSYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDSALDIHGMYSSEGEKIKFSQTISTSEARGAVEKWLLQVQDVMLMSMRDVIAASYDAYAIEARKKWVCDWPGQVVLCVSQIYWTAEVHDSLSAGVQGLKDYYKKLSDQLSDIVVLVRGKLNAQQRITLGALVVIDVHSRDVVEDMVKKGVSDENDFNWLAQMRYYWEDENVFIRLTNAKVRYAYEYLGNSPRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILSIIIAVRSKASEFDFEGTLLKLNPNCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSFGFMDARNLAVKIVTTYRLSSELLSSQSHYDYGMRAVKAVLSAAGNLKLKFPDDDENILLLRSILDVNLPKFLSHDIPLFEGIISDLFPGVKRPEADYRIFLDEIRRVCEAHKLQSVDFFTEKIIQTYEMMIVRHGFMLVGEPFGGKTSVLHVLAETMTNLNEAGYSEDYEKVMYRTINPKAITMGQLFGQFDPVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLEPSTLGWRPLVKSWIESFPEVLIKDGSQEVMSHLMEWAIDPCLDFVRKSCREYINSSQTNLVRSCMFFIDMLMDEHVNAENAKDNKHLKTWIVAAWLFAIPWSIGGILDVDSREKFDKFFRELISGRNEANPIPKEIGKIETVFPENGMVYDYMYETKARGQWRHWNDLIRGADLFAGKKIREILVPTMDTARYKFIMDLCIEKSRPLMFVGPTGTGKSVYVQDKMMNELSKDKFVPHFVNFSAQTSANQTQTVIMSKLDRRRKGIFGPPINKQAVIFIDDINMPQKEVYGAQPPIELLRQYFDHGNWYDLKDTSKIILQDVYFIAAMGPPGGGRNDITPRFMRHFNIVSMTPFNDDTMIRIFTALMNTYMKTQGFTSDFLAIGSTIVHSTMEVYKAAIKNLLPTPAKSHYVFNLRDFSRIILGVCLIKREQVTEKRVFTRLWCHEVMRVFYDRLTDDTDRKWLFKLLQDSVKNHFKDSFESVFEHLAGGGTGQGSVSEEDVRSLIFGDFMNPDLEPDERVYEEAKSIDDLYPIVEQALDEYNNIQKNKMHLVIFRYVLEHLSRICRILRTPGGHALLVGVGGSGRQSLTRLATSMAGYIICQPEISKNYGMTEWREDVKKMMKKAGAEGKKTVFLMADTQIKEETFLEDIDNLLNTGEIPNLFPNDEKVEIMETVRPFAQAGDKNADFSPIALYAFFVNRVRENLHIVIAFSPIGDAFRNRLRKFPSLINCCTIDWFQPWPPDALERVAMKSFESVDMEDDHRTDVVKIVQNFHTSIRLLSEKFLTEMGRKTYVTPTSYLELILSFRGLINAKQEETMRQKRRYVNGLDKLAFAGEQVKDMQEKLEALQPQLVQASAENIELMKVIEHESVVVAEQEDKVTKEEAMVNEKAASSRALKDECEADLAEALPALEAALEALNTLKPSDITIVKTMQNPPEGVKIVMAAVCVMRQVPPDKIQDPAGGPKKVLDYWGPSKKLINDMNFLNYLKEYDKDNIPVAVMTKIRKEYIPNPEFEPSKVSRASSAAEGLCKWILAMEVYDRVAKVVAPKKAKLAEAESELKSNMEILAQKQGELRAVQDKLAQLKQRLEDAQNEKARLEMEVDLCAKKLDRAKKLIGGLGGEKDRWDQAAKNLQSIYDNLLGDVLISAGVIAYLGPFTMIYRSQTTNEWVKLCKEKNIPCSDNFSLTVCLGDPVQIQAWNIAGLPRDAFSIDNSVIVSNSRRWPLMIDPQGQANKWIKNTYKSTPGFAVIKLSDSNYMRQMEMAISYGNPLLLENVGEELDPSLEPVLLKQTFKQN-----------------FKFFITTKLRNPHYLPEIAVKVSLLNFMITPEGLEDQLLGIVVAKEKPDLEEERQSLIKMTAQNRRQLKEIEDKILATLAEAEGNILENESAIQILDSSKILSDDIQKKQKVAEKTQEKIDAARMDYAPIANHSSILFFSITDLPNIDPMYQYSLIWFVNLYISSINESNKSKILERRIRYLKDHFQYNLYENVCRSLFAKDKLLFSLKLCTNLVINKSRILEKRIRYLIEHFTISLYTNVCRSLFATDKLLFSFLMTTQLMSARGELDEKELLFLLTGGVGLENKLPNPDPSWLSEKSWDEICRMSDLPAFKGFRQHFCDHISEWKQFYESKDPHEATLPEPWHTKLDEFKRIIVVRCIRPDKIIPMVTQYVREKLGPKFVEPPPFDLSRSYQDSRRDVPMIFVLSPGADPTMALLKFVDDMGFSGNKFDSISLGQGQGPIAARKIEKAMEDGSWIMLQNCHLAVSWMGELEKICEEWLARENTHQDFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLLQSYLNDPISDPSFFNGCPGKEATFEKLLYSLCFFHALVQERRKFGPMGWNIPYGFNDSDLSISVRQLRMFVNEYEQVPYDAITYLTGECNYGGRVTDDRDRRCLMTILADFYNPGVVTEQKYKLSPSGNYYIPNKMDYADYLEFIKKLPAYQHPEVFGMHENVDISRELQETRGLFDSVLLTLGQAGSSKAGQSDSYLNEIATDILKKLPPNFDLEAAVRKFPVVYTESMNTVLTQEMERFNKLVGTVRSSLQSLEKAIKGLVVMNADLEALGGSLAVGKVPALWMRASYPSLKPLGSYINDLLERLKFLKKWYDEDKPAVFWIAGFFFTQAFLTGVTQNYARKYTIPIDLLGFDFQVLAVDSMSTAPKDGAYVIGLYLDGARWDRDRNCLAEQLPKILYDHVPVIWLRPMKREEIDENSNRYTCPVYKTSERRGVLSTTGHSTNFVLPILLNCTEKPSHWVKRGCALLCQLDD 3926          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A1I8J266 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 5419.74 bits (14058), Expect = 0.000e+0
Identity = 2688/4026 (66.77%), Postives = 3212/4026 (79.78%), Query Frame = 2
Query:   74 LPPI--EEGSTKSQDKDPKSNKL--------LKKFRMSDENRKKLHKLLIDQAVNVEQKI-YDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKK----ALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDE-FEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLT--TTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKET-GLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSK-----------------------------------------------GDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEE-MTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            LPPI  E+ S    D   KS           L  +R++D+ R +L + LI++A+  + ++ YD      P PP  +YP  MMS++R +R+NY FL+ CV++SPIPPM  +WL NIK KI+ HL++G+D  ++E+L EV QNF  SMK+SLVQ+SLKKP+VPGLE DDLV   EEP+GLDFS+EWH SFV N+ E+S +LMILYP M KLL LC    G+ ++ D+     E  M+FE LRT V  +CEK ++ ++  WY +V+ IF+ER +   +  DL+E FY+C T L+SNQ+K L   TV AWV +F+E     LP L M+L+F   QM   P Y   E+L+  +++ + +S+  IPT+ S +++ P  V +P  LA HI+  AK +L+S+A R FE  +   ++ +E  Y YL++G   + + KFL E H+F EY E IE+++ I+  I+  P +E++ LIRL  E+LK+GL +     +  LL RV +DHR EN +I ++F+ ++  A+  PETS+EL ++I +ME+AR  GM+ L+EKI+ S+ RL YLLD   F+ +DL+LNSEV TW ++I PIFD N+ +QE  K++ E +L++R+EKLI+ELQ+ + RVDEFN++GEMD E+M QYVQDV  +Q +L  AR +  WIN EE+L+K P                                 WL GEF  L A++I  EVDEI RE+F++ K FNN+ KK        + E+ + KK +  T  +      ++++  KPPAAL+IC+    +I EFKEKI VI  LC PGI++RHW+KMSSI   DITP+SGT+L KVL + LD++MEEF QISAAA++E +LE  MKKM E+WE + FSL  YRE+GI+IL+SVDDIQ  LDDQI++TQTMRGSPFI+PFE EI+ WEE+LL   ETID+WLKVQA WLYLEPIFSSEDIMQQMPE+GRLFQ VDRNW+DIM+NT +DP ++KA D  G+LE+LK+SN LL+KI KGLN+YLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFD+ LDIH M+SSE EKIK SQ ISTSEARGAVE+WLLQVQDVMLMS+RDVIAAS +AY  EAR +WVC+W GQVVLCVSQIYWT EVH++L  GV+GL  Y++K + Q+S+IV LVRGKLNAQQRITLGALV IDVH+RDVVEDM +K V  ENDFNWL+Q+RYYWE+EN  +RLTNA V+YAYEYLGNS RLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQIL II A++     F FEGT L+LN NCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYS+GFMDAR+LAVKIVTTYRL SE LSSQSHYDYGMRAVKAVLSAAGNLKLK+PD++ENILLLRSI+DVNLPKFLSHDIPLF GIISDLFPGV  P+ADY +FL  +  VC  H LQ+VDFFTEKIIQ+YEMMIVRHGFMLVGEPFGGKT VLHVLAE M+ LNE G+ E +EKV+YRTINPK+ITMGQLFGQFD VSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYL+PS++GWRP+  SW+ S PEVL KD   E+M  L EW ++ CL FV K+C+  I +   +LV++ +  IDM+M  H+  E+  +N++LK W  +AWLFA+PWSIGG+LD DSR+KFD FFRELI G+NE+ PIPKEI + E + PE G+VYDY YE K RG W HWNDL +      GK IRE LVPTMDTARYKFI+D+C+E  + LMFVGPTGTGKSVY QDK+MNEL  D++VP FVNFSAQTSANQTQ +IMSKLDRRRKG+FGPPI K AVIF+DD+NMP KE+YGAQPPIELLRQYFDHGNWYDLKDT+KI+LQD+Y + AMGPPGGGRND+TPRF+RHFN+VSMT F+DDTMIRIF+ LM+ YMK Q FTSD+LA+G T+V +T+EVYK AI NLLPTPAKSHYVFNLRDFSR+ILG+CLIK+EQV +KR +TRLW HEV+RVFYDRL +D+DR+WL+KLL++S+K HFK++F+ +FEHL    T    V EE +RSL+FGD+MNPD  P++RVYEE K+I++ YPIVEQ +DEYNN  KNKM LVIFRYVLEHLSRICRIL +PGG+ALLVGVGGSGRQSLTRLA +MA  ++ QPEISKNYG  EWRED+K ++KKAG EGK TVFLM D+QIK+E+FLEDIDNLLNTGE+PNLF  +EK E++E VR  AQAG+K+ADFSP+AL+AFFVNR RE LH+V+AFSPIG AFR RLR+FP+LINCCTIDWFQ WP DALERVA+K+ E+VDMEDD R D VKIV++FHTS+  LSE+F   +GRK YVTPTSYLELI SFR L+N+KQ+ETMR K+RYVNGLDKLAFA EQV DMQ KLE LQPQLVQA   N  LM  I  ES++  +Q  KV  EE +VNEKA +S+AL DEC ADLAEA+PALEAAL AL+TL+P+DITIVKTMQNPP GVK+VM  +C+MR++ P+++ DP    KK+LDYWGPSKKL+ DM FL YL+EYDKDNI   +MTKIRKE+I NPEF+P KVSRASSAAEGLC+WILAME YDRVAKVVAPKK KLA+AES+LK NM  L + Q +L+ V+DKL  LKQ+L+D ++EK RL+ EV+LCAKKL+RAKKLIGGLGGEKDRW QAA NLQ+IYDNL+GDVL+SAGVIAYLGPFT +YR +   +W  LCK   IPCS  FSLT CLG+PV+IQAWNI GLPRD+FSIDNSVIV+N+RRWPLMIDPQ QANKWIKN  K T G  VIKL+D+++MR +E AI +G P+LLENVGEELDPSLEP+LLKQ FKQN                 F+ +ITTKLRNPHYLPEIAVKVSLLNFMIT EGLEDQLLGIVVAKEKP+LE+ RQ LI  +A NRR LKE ED+ILATL+E+EGNILENE+AIQILDSSK +SDDI KKQ+ AE+TQ+KIDAARMDYAPIA HS+ILFFSITDLPNIDPMYQYSL WFVNLYI+SI++SNKSK+L++R+RYL DHF Y+LY NVCRSLF KDKLLFS  LC+ ++++K                                               G+L+  E LFLLTGGVGLENK  NP  SWLS+KSWDEICR++DL  FKGF++ F  ++  W+ FY+SKDP +A +PDPW TKLD FK ++V+RCIRPDKI+P +T YV+EKLG KF+EPPPFDL+RS+QDS+   P+IFVLSPGADPTMALLKF +D GF G+KF+SISLGQGQGPIAA+ I +A  +G+W+MLQNCHLAVSWM  +EKICEE +  ENT+ +FRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNL QS++ND IS+P FFNGCPGKE+TFEKLL+ LCFFHALVQERRKFGPMGWNIPYGFNDSDL IS RQL+MFVNEYEQVP+DAI YLTGECNYGGRVTDD DRRCLMTIL DFYN  V+ + KYK SPSG Y +P KM+Y +Y+EFIK LP+ Q+PEVFGMHENVDI+RELQ++R L DSVL+TLGQ  SS  G S++ L+EIA DIL K+P +FDLE A   +PV Y ESMNTVL QEMERFNKL   +R SLQ+L KAIKGLVVM+ +LEA+  SL VGK+PA+W + SYPSLKPLGSYINDL+ERL FL+KW++E KP+ FW++GF+FTQAFLTGV QN+ARKYTIPIDLLGFDF+VL    M+  P DGAY+ GL+LDGARW+ +   L EQ PK+LY+ VPVIWL+P KR+ I    NRY CPVYKTSER+GVLSTTGHSTNFVLP+ L   E  SHWVKRG ALLCQLDD
Sbjct:    7 LPPIAGEKRSNGKHDVKSKSGVEEGEFAALNLHNYRLADKKRDQLQQFLIERALKTQHEMKYDNKDLSKPTPP--EYPQEMMSDDRKVRLNYEFLRKCVESSPIPPMSPEWLVNIKHKIAEHLREGKDDFLNEVLAEVNQNFDTSMKKSLVQLSLKKPDVPGLEDDDLVEPSEEPVGLDFSKEWHESFVANKREISYRLMILYPQMPKLLELCQRELGQQIILDLAEYKAESPMEFETLRTNVTYECEKMEERLLGHWYREVMKIFSER-TTSVLRVDLQEPFYSCVTTLMSNQLKLLKEETVNAWVLLFDEEQRFRLPQLNMFLSFQDRQMSVDPEYAVYEDLLLSVVDEVNKSLSSIPTVSSQLSATPN-VNVPTELAEHIVQLAKAKLKSAAARYFESVENSLRSYHE-RYDYLVDGTANSRVEKFLTEEHTFAEYCELIEEYRAISYAIRRNPTIEFYDLIRLNVEELKNGLAEVAQGYADRLLERVVRDHRAENTKICQQFDYVKARAQKKPETSEELMEMIKFMEQARSTGMVTLNEKIKESQNRLQYLLDVWIFNDDDLQLNSEVLTWPKRISPIFDENETLQEESKTQGEKLLIERKEKLIAELQRIRNRVDEFNDYGEMDLEIMSQYVQDVNKVQQRLDTARADSEWINKEEQLYKYP---------------------------------WLKGEFLALDAERIAEEVDEISREIFRVSKVFNNRLKKMQAEKEEREREKKKRKKLEEDTQGEGGEEEKDDEEEVKPPAALDICNTLTEKIREFKEKINVIEILCNPGIRQRHWEKMSSICGFDITPDSGTTLIKVLGLKLDAFMEEFGQISAAATKEHSLEKGMKKMIEDWEPISFSLIPYRETGINILSSVDDIQTQLDDQIMRTQTMRGSPFIRPFEKEIREWEERLLRIQETIDEWLKVQANWLYLEPIFSSEDIMQQMPEQGRLFQTVDRNWRDIMKNTAKDPKLLKATDMPGLLEKLKDSNDLLDKIQKGLNSYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDSALDIHGMYSSEGEKIKFSQTISTSEARGAVEKWLLQVQDVMLMSMRDVIAASYDAYAIEARKKWVCDWPGQVVLCVSQIYWTAEVHDSLSAGVQGLKDYYKKLSDQLSDIVVLVRGKLNAQQRITLGALVVIDVHSRDVVEDMVKKGVSDENDFNWLAQMRYYWEDENVFIRLTNAKVRYAYEYLGNSPRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILSIIIAVRSKASEFDFEGTLLKLNPNCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSFGFMDARNLAVKIVTTYRLSSELLSSQSHYDYGMRAVKAVLSAAGNLKLKFPDDDENILLLRSILDVNLPKFLSHDIPLFEGIISDLFPGVKRPEADYRIFLDEIRRVCEAHKLQSVDFFTEKIIQTYEMMIVRHGFMLVGEPFGGKTSVLHVLAETMTNLNEAGYSEDYEKVMYRTINPKAITMGQLFGQFDPVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLEPSTLGWRPLVKSWIESFPEVLIKDGSQEVMSHLMEWAIDPCLDFVRKSCREYINSSQTNLVRSCMFFIDMLMDEHVNAENAKDNKHLKTWIVAAWLFAIPWSIGGILDVDSREKFDKFFRELISGRNEANPIPKEIGKIETVFPENGMVYDYMYETKARGQWRHWNDLIRGADLFAGKKIREILVPTMDTARYKFIMDLCIEKSRPLMFVGPTGTGKSVYVQDKMMNELSKDKFVPHFVNFSAQTSANQTQTVIMSKLDRRRKGIFGPPINKQAVIFIDDINMPQKEVYGAQPPIELLRQYFDHGNWYDLKDTSKIILQDVYFIAAMGPPGGGRNDITPRFMRHFNIVSMTPFNDDTMIRIFTALMNTYMKTQGFTSDFLAIGSTIVHSTMEVYKAAIKNLLPTPAKSHYVFNLRDFSRIILGVCLIKREQVTEKRVFTRLWCHEVMRVFYDRLTDDTDRKWLFKLLQDSVKNHFKDSFESVFEHLAGGGTGQGSVSEEDVRSLIFGDFMNPDLEPDERVYEEAKSIDDLYPIVEQALDEYNNIQKNKMHLVIFRYVLEHLSRICRILRTPGGHALLVGVGGSGRQSLTRLATSMAGYIICQPEISKNYGMTEWREDVKKMMKKAGAEGKKTVFLMADTQIKEETFLEDIDNLLNTGEIPNLFPNDEKVEIMETVRPFAQAGDKNADFSPIALYAFFVNRVRENLHIVIAFSPIGDAFRNRLRKFPSLINCCTIDWFQPWPPDALERVAMKSFESVDMEDDHRTDVVKIVQNFHTSIRLLSEKFLTEMGRKTYVTPTSYLELILSFRGLINAKQEETMRQKRRYVNGLDKLAFAGEQVKDMQEKLEALQPQLVQASAENIELMKVIEHESVVVAEQEDKVTKEEAMVNEKAASSRALKDECEADLAEALPALEAALEALNTLKPSDITIVKTMQNPPEGVKIVMAAVCVMRQVPPDKIQDPAGGPKKVLDYWGPSKKLINDMNFLNYLKEYDKDNIPVAVMTKIRKEYIPNPEFEPSKVSRASSAAEGLCKWILAMEVYDRVAKVVAPKKAKLAEAESELKSNMEILAQKQGELRAVQDKLAQLKQRLEDAQNEKARLEMEVDLCAKKLDRAKKLIGGLGGEKDRWDQAAKNLQSIYDNLLGDVLISAGVIAYLGPFTMIYRSQTTNEWVKLCKEKNIPCSDNFSLTVCLGDPVQIQAWNIAGLPRDAFSIDNSVIVSNSRRWPLMIDPQGQANKWIKNTYKSTPGFAVIKLSDSNYMRQMEMAISYGNPLLLENVGEELDPSLEPVLLKQTFKQN-----------------FKFFITTKLRNPHYLPEIAVKVSLLNFMITPEGLEDQLLGIVVAKEKPDLEEERQSLIKMTAQNRRQLKEIEDKILATLAEAEGNILENESAIQILDSSKILSDDIQKKQKVAEKTQEKIDAARMDYAPIANHSSILFFSITDLPNIDPMYQYSLIWFVNLYISSINESNKSKILERRIRYLKDHFQYNLYENVCRSLFAKDKLLFSLKLCTNLVINKSRILEKRIRYLIEHFTISLYTNVCRSLFATDKLLFSFLMTTQLMSARGELDEKELLFLLTGGVGLENKLPNPDPSWLSEKSWDEICRMSDLPAFKGFRQHFCDHISEWKQFYESKDPHEATLPDPWHTKLDEFKRIIVVRCIRPDKIIPMVTQYVREKLGPKFVEPPPFDLSRSYQDSRRDVPMIFVLSPGADPTMALLKFVDDMGFSGNKFDSISLGQGQGPIAARKIEKAMEDGSWIMLQNCHLAVSWMGELEKICEEWLARENTHQDFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLLQSYLNDPISDPSFFNGCPGKEATFEKLLYSLCFFHALVQERRKFGPMGWNIPYGFNDSDLSISVRQLRMFVNEYEQVPYDAITYLTGECNYGGRVTDDRDRRCLMTILADFYNPGVVTEQKYKLSPSGNYYIPNKMDYADYLEFIKKLPAYQHPEVFGMHENVDISRELQETRGLFDSVLLTLGQAGSSKAGQSDSYLNEIATDILKKLPPNFDLEAAVRKFPVVYTESMNTVLTQEMERFNKLVGTVRSSLQSLEKAIKGLVVMNADLEALGGSLAVGKVPALWMRASYPSLKPLGSYINDLLERLKFLKKWYDEDKPAVFWIAGFFFTQAFLTGVTQNYARKYTIPIDLLGFDFQVLAVDSMSTAPKDGAYVIGLYLDGARWDRDRNCLAEQLPKILYDHVPVIWLRPMKREEIDENSNRYTCPVYKTSERRGVLSTTGHSTNFVLPILLNCTEKPSHWVKRGCALLCQLDD 3977          
BLAST of Dynein heavy chain vs. TrEMBL
Match: K1QKQ9 (Dynein heavy chain 7, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10012096 PE=4 SV=1)

HSP 1 Score: 5271.83 bits (13674), Expect = 0.000e+0
Identity = 2589/4023 (64.35%), Postives = 3198/4023 (79.49%), Query Frame = 2
Query:   53 GSKMPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYD--QFCTVPPKPPA-PQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKK--GRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLF-PEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALME--KAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDE-FEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLT--TTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDS-----------------------------------------------NKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            GS+    LPPI + S ++ D  P +N  L  FR+++  +  L K+L DQA    + I D  +FC      P+ P YP  MMS++R IR+NY +LK CV+  P+ P+Q+ W  NI   +   L++       + ++  EVKQ++  SMK+S+VQ  L KP V GL+++   P P EP GLD+S+ WH S+V  R+ + + L  L+P MQ +L +C +T G  ++ D       G ++FE+ + T+ LD EK +D +   W+P +IN+F ++ S    + +  +SF++C T L+SNQ+KNLL RT++++V +F+  +   LP++KM L FD  +MQFYP  +DLEE + F+++ I ++MQ++PT+ S +          A +A+H++  A E+L+ +  R FE P+ + ++  +  Y Y++NGE    I  ++  +H+F EY ++I++++ +A +I  LP++E+F +IRL+CEDLK GL +    L+  LL +V+ DHR+EN  I E+F  I+  A   PETS+EL +++ + +EAR  GM+ L+E+I+ SK RL YL+D + F  ED++LN EV TW  +I P+FD ND++ E  K   E  LL++REK+I+EL+K + RVDEFN++GE+D  MM+QYVQDVR +Q +L + + ++S+IN EE LFK P S +  +++EI  Q +PF +LF +V+K+QK+E+KW+ G F DL A+++EAEVDE  R+++K+QK FN++ KK  +E     R+R+K+++   +  + + P ++D+    P  +EIC+K  + + EFK+ +PVI  +C  G++ RHW KMS +   DITPN+GT+L KVL + +  +ME F  ISAAA++E +LE  M KM E+W+++ F+L  YR+SGI+IL+SVDDIQ  LDDQIVKTQTMRGSPFIKPFE EIK WEE+LL   +TID+WLKVQ+QWLYLEPIFSSEDIMQQMPEEGRLFQ VD+NWKD+MR+T ++P V+ A +  G+LE+L++SN LL+KI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFD+KLDIHAMFSSE EKIKM + ISTSEARGAVE+WLLQVQD+MLMS++DV A S EAY  E R +WV EW GQVVLCVSQ+YWT EVHEA+  G  GL  Y EK  +Q+ +IV LVRGKL+ Q R TLGALV IDVHARDVV  M  K V SENDF WL+QLRYYWEEEN  VR+TNATVKYAYEYLGN+ RLVITPLTDRCYRTLIGA+HLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLAS+GAWACFDEFNRI+LEVLSV+AQQILCIIRA++  V+ FMFEGTEL LN NCYVCITMNPGYAGRSELPDNLKVLFR VAMMVPDYAMI EISLYS+GF +AR+L+VKIVT YRLCSEQLSSQ HYDYGMRAVKAVLSAAGNLKL++PDE+E+ILLLRSI+DVNLPKFLSHDIPLF GI SDLFPGV LP+ADY +FL A+  V  K NLQ VDFF EK+IQ+YEMMIVRHGFMLVGEPFG KT V+  L E M+ LNEEGHDE +EKV+YR INPKSITMGQLFGQFD VSHEWTDG+ ANTFREFAS DTPDRKWV+FDGPID LWIE+MNTVLDDNKKLCLMSGEIIQMS  MSLIFETMDL+QASPATVSRCGM+YL+P+++GWRP+  SW+ S  EV+++++G E+++ +FEW ++ CL FV KN K  I +   + V++L+ +IDM+M   L KED  EN+++K +   A LF++PWSI  ++D D RQKFD F++EL+ GKNES P+PK + +F+V +P+    YD F+E K RG WHHWNDL K   + + K IRE LVPTMDTARY +++ +C+EH + ++FVGPTGTGKSVY QDKLMN L  DRY+P+F+NFSAQTSANQTQ IIMS+LD+RRKGVFGP +GK A+IF+DD+NMP KEIYGAQPPIELLRQY DHG WYDLKDTTKI LQD+  + AMGPPGGGRNDVT RFLRH+N++ M  FS++TMI+IFS L++ Y++  EF+++Y A+G  +V AT ++YK AI+NLLPTPAKSHYVFNLRDFSRVILGICL+KK +VE KRT  RLWVHEV+RVFYDRL +D+DR WL+K      K++FKE+FDV+FEHL    T    V+EE LRSLMFGDYMNPDA PE+RVY EV+++ E Y IVEQ ++EYNNTHKN+M+LVIFRYVLEHLSRICR+L  PGGNALLVGVGGSGRQSLTRLA AMA   +FQPEISKNYGK EWRED+K++L   G +GK TVFL+TD+QIK+ESFLEDIDNLLNTGEVPNLF A+EK E++E VR  AQAG+K ADFSPLALFAFFVNRCRE LH+++AFSPIG AFR RLRQFPALINCCTIDWFQ WP+DALERVA K LE V++ D+ R +T  IVK+FH S I LSE +   LGR NYVTPTSYLELINSF+ LL+SKQ+ETM+ K+RYV GL+KLAFAA QV+ MQ +LEELQPQLV +++ N  +MV I +ES+  E     V+A+E + NE+A  ++AL DEC A+LAEAIPALEAAL+ALDTL+PADITIVK+M++PP+GVKLVM  +C+M++IKP++VNDP+ PG+K+LDYWGPSKKLLGDM FL+ L+EYDKDNI   +M KIRKE+I+NPEFDP KV+ ASSAAEGLC+WI+AME YDRVAKVVAPKKIKLA+AES+L   M KLN+ + +L  VE +L +L+   K+  D+K +L+ +V+LC KKLERA+KLIGGLGGEK RW  AA NLQ  YDNL+GDVL+SAGVIAYLGPFT  +R++C  DW  +C    IPCS +FSL+  LG P+KIQAWNIFGLPRDSFSIDN VIVAN+RRWPLMIDPQ QANKW+KNMEKE  L+VIKLTD+D+MRTLEN I FG P+LLENV EELDPSLEPLLLKQ +KQ GVDM+++GE++IEYSK+FR YITTKLRNPHYLPEIAVKVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ RQ LI+ SA N++ LKE ED+IL TLS SEGNILE+E+AI++LDSSK +SD+I KKQ+ AEET++KI+ +RM Y PIA+HS+ILFFSI DLPNIDPMYQYSL+WFVNLY+ SIHDS                                               NKSK+LD+RLRYLSDHFTYSLY NVCRSLFEKDKLLFSF+LCS +L+SK +L+  E++F LTGGVGLENK ANPA +WL+DKSWDE+CRL+DLK++K F++ F  NL+ W +FY+S++P + ++P PW  +L+ F+ +++LR IRPDK+ PAITN+V+EKLGKKF+EPPPFDLA+S+QDS CCAPLIF+LSPGADPTMALLKFAEDKGF G+KFNSISLGQGQGPIA++MISEA+++G+WVMLQNCHLAVSWMT +EK+CE+ T +NTN +FRLWLTSYPS KFPVTVLQNGVKMTNEPPTGLRQNL QS++ND +S+ EFF GCPGKE  FEKLLFGLCFFHALVQERRKFGP+GWNIPYGFN+SDLRIS  QLQMF+NEYE VPFDAI Y+TGECNYGGRVTDDWDRR L+T+L DFY  ++I + +YKFSPSG Y  PPK  Y +Y+EFIK+LP  Q PEVFGMHENVDI++ELQ++ LL DSVL+T G      GGSS++QL  IA DI+ K+P  +D+E A   YPV+YNESMNTVLVQEMERFN+L + IR SL NL KAIKGLVVMS ELEA+A SLL+GK+PAMW+K SYPSLKPLGSYIND +ERL FLQKW++EGKP TFW+SGF+FTQAFLTGVMQNFARKYTIPID L FDF+VL   + +  P DG Y+ GLFLDGARWN     L EQ PK+L EA+P++W  P K+  I  +  RYKCP+YKTSERKGVLSTTGHSTNFVL V L T+ PV HW+KRG ALLCQLD
Sbjct:   50 GSEGYPRLPPITKPSQRADD--PYANSKLMTFRLANHKQAMLMKILHDQAA---KDILDTEEFCEKHQDTPSNPDYPQEMMSKDRRIRLNYQYLKKCVEAGPVTPVQQHWNDNILKMVPERLQQNPALQPSIMDLFAEVKQDYNASMKKSMVQHVLIKPEVKGLDNEVAGPPPSEPNGLDYSRPWHDSYVAARQSIRENLHTLHPSMQTVLRMCQSTLGNMILVDCSNFRANGPVEFESFKNTIILDMEKTEDKLNNSWFPGIINVFADKNSFVSPKAEKLDSFFDCVTTLISNQLKNLLERTIDSYVTLFDPNDKAKLPLMKMELTFDDQKMQFYPPKEDLEETVLFVVSHICKAMQQVPTVQSWLAGGSTVNHTDATVADHVVKAAVEKLKEAVKREFEGPQLHLESFVK-RYDYIVNGEALKEIQDYIKYDHTFAEYQKHIDRYRNLASEIMGLPSIEHFDMIRLDCEDLKRGLAEAARGLADELLRKVSDDHRRENKSICEEFTLIRDRALKPPETSEELMEMVKFTQEARTSGMVKLNERIKESKDRLAYLIDVYMFPAEDIELNCEVLTWPNRISPVFDDNDELIEKSKHAGERQLLEKREKVIAELEKLRQRVDEFNDYGELD--MMQQYVQDVRAVQKRLADVQDQISFINKEEHLFKYPISTYSADVDEITNQVEPFYRLFNIVLKWQKAEKKWMDGAFMDLDAEQVEAEVDEYTRDIYKVQKVFNSRLKKLQLEVDDRNRERKKRRRHAEENGQEVAPEDQDEVLVQPQGMEICNKVQDSMREFKDNVPVIGVMCNKGMRPRHWSKMSELMGFDITPNAGTTLRKVLKLEIAPHMEMFEGISAAATKEHSLEKAMAKMMEDWDSINFNLIAYRDSGINILSSVDDIQTTLDDQIVKTQTMRGSPFIKPFEAEIKDWEERLLRIQDTIDEWLKVQSQWLYLEPIFSSEDIMQQMPEEGRLFQIVDKNWKDVMRHTTKEPKVLLATNLPGLLEKLQDSNNLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDSKLDIHAMFSSEGEKIKMVETISTSEARGAVEKWLLQVQDIMLMSVKDVCAHSMEAYAIEPRIDWVREWPGQVVLCVSQVYWTQEVHEAIRSGPGGLKDYWEKLQQQLGDIVILVRGKLSKQTRTTLGALVVIDVHARDVVLQMAEKGVASENDFAWLAQLRYYWEEENMRVRMTNATVKYAYEYLGNTPRLVITPLTDRCYRTLIGAFHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASAGAWACFDEFNRIDLEVLSVIAQQILCIIRAVRAKVDVFMFEGTELSLNPNCYVCITMNPGYAGRSELPDNLKVLFRTVAMMVPDYAMIAEISLYSFGFQNARNLSVKIVTVYRLCSEQLSSQFHYDYGMRAVKAVLSAAGNLKLRFPDEDEDILLLRSIIDVNLPKFLSHDIPLFNGITSDLFPGVKLPEADYKVFLDAMIRVAEKKNLQFVDFFKEKLIQTYEMMIVRHGFMLVGEPFGCKTMVIETLCEGMTLLNEEGHDEDYEKVMYRIINPKSITMGQLFGQFDPVSHEWTDGVVANTFREFASTDTPDRKWVVFDGPIDALWIENMNTVLDDNKKLCLMSGEIIQMSNPMSLIFETMDLAQASPATVSRCGMVYLEPTTLGWRPIVKSWIESFSEVMQRESG-EVINDMFEWLIDPCLDFVRKNTKEYISSKQANQVRSLMYMIDMLMTETLSKEDANENKHIKNYSMCAMLFSIPWSIAAVVDNDGRQKFDSFYKELLSGKNESCPVPKSVGKFDVPMPDAMSCYDVFFEFKARGTWHHWNDLIKG-QESKQKKIREMLVPTMDTARYTYLLALCIEHDRPILFVGPTGTGKSVYVQDKLMNGLEKDRYLPAFINFSAQTSANQTQNIIMSRLDKRRKGVFGPQMGKKAIIFIDDLNMPQKEIYGAQPPIELLRQYIDHGYWYDLKDTTKITLQDVLFLCAMGPPGGGRNDVTARFLRHYNIIGMNPFSEETMIKIFSILLTTYLRQGEFSTEYYALGNQIVAATNDMYKQAIANLLPTPAKSHYVFNLRDFSRVILGICLVKKNEVESKRTMIRLWVHEVMRVFYDRLTDDADRAWLFKSTGSVCKEYFKESFDVIFEHLAGDGTGEGKVREEDLRSLMFGDYMNPDAEPEERVYSEVQSLEEMYKIVEQGLEEYNNTHKNRMNLVIFRYVLEHLSRICRVLRIPGGNALLVGVGGSGRQSLTRLATAMAGYNLFQPEISKNYGKTEWREDIKSVLTSCGAQGKTTVFLITDTQIKEESFLEDIDNLLNTGEVPNLFAADEKAEIMEAVRPLAQAGDKMADFSPLALFAFFVNRCRENLHIIIAFSPIGDAFRNRLRQFPALINCCTIDWFQTWPDDALERVANKFLEQVELGDNERKETTHIVKYFHQSTIRLSERYLSELGRHNYVTPTSYLELINSFKNLLSSKQEETMKAKRRYVVGLEKLAFAASQVATMQKELEELQPQLVVSQEENAKMMVVIEKESVEVEATSKVVRADEAVANEQAAEAQALKDECEAELAEAIPALEAALAALDTLKPADITIVKSMKSPPSGVKLVMAAVCVMKDIKPDKVNDPDKPGQKILDYWGPSKKLLGDMSFLSMLKEYDKDNIPVHVMQKIRKEYISNPEFDPAKVANASSAAEGLCKWIMAMEIYDRVAKVVAPKKIKLAEAESELNTTMDKLNKKRAELAAVEKRLADLQATFKEMTDKKEQLEFQVDLCGKKLERAEKLIGGLGGEKARWTAAAENLQNTYDNLVGDVLISAGVIAYLGPFTMAFREQCTTDWVKVCTERTIPCSQEFSLSKTLGEPIKIQAWNIFGLPRDSFSIDNGVIVANSRRWPLMIDPQGQANKWVKNMEKEFKLSVIKLTDSDYMRTLENCITFGNPLLLENVAEELDPSLEPLLLKQTYKQAGVDMIKIGENVIEYSKDFRFYITTKLRNPHYLPEIAVKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERQALIVQSAANKKALKEIEDKILHTLSASEGNILEDESAIKVLDSSKILSDEISKKQKIAEETEQKIEQSRMGYRPIAKHSSILFFSIADLPNIDPMYQYSLTWFVNLYVMSIHDSNKSKILDRRLRYLKDHFQYQLYDNVSRSIFAKHRGVFTFILCANLLLNKSKILDRRLRYLSDHFTYSLYCNVCRSLFEKDKLLFSFILCSNMLLSKNELDKDEFMFFLTGGVGLENKLANPAPTWLTDKSWDELCRLSDLKKYKKFRDHFMKNLDKWNSFYNSREPHNEELPSPWQDELNDFQRMIILRVIRPDKVNPAITNFVREKLGKKFVEPPPFDLAKSYQDSNCCAPLIFILSPGADPTMALLKFAEDKGFSGNKFNSISLGQGQGPIASKMISEARQDGSWVMLQNCHLAVSWMTPLEKVCEDFTTDNTNPDFRLWLTSYPSDKFPVTVLQNGVKMTNEPPTGLRQNLLQSYLNDPVSDEEFFKGCPGKELPFEKLLFGLCFFHALVQERRKFGPLGWNIPYGFNESDLRISIMQLQMFINEYEDVPFDAISYMTGECNYGGRVTDDWDRRLLLTMLADFYTPNIINETRYKFSPSGLYYSPPKGTYDDYVEFIKSLPLNQVPEVFGMHENVDISKELQETNLLFDSVLLTRGGSGGGAGGSSDDQLYTIAGDIISKLPKDYDIEAAGKKYPVSYNESMNTVLVQEMERFNRLLSIIRSSLINLQKAIKGLVVMSAELEALAGSLLIGKLPAMWAKRSYPSLKPLGSYINDFLERLKFLQKWYDEGKPPTFWLSGFFFTQAFLTGVMQNFARKYTIPIDTLAFDFDVLSIDNSDTAPEDGCYVYGLFLDGARWNKTRSALEEQLPKILNEALPMMWFFPKKKLEIDESNKRYKCPIYKTSERKGVLSTTGHSTNFVLAVLLNTDNPVQHWIKRGLALLCQLD 4062          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A074ZF62 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06797 PE=4 SV=1)

HSP 1 Score: 5259.12 bits (13641), Expect = 0.000e+0
Identity = 2569/3806 (67.50%), Postives = 3098/3806 (81.40%), Query Frame = 2
Query:  638 MILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALME-----------------KAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEIN-RFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWY-----------DLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGN---KDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKR---DVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            MILYPHMQK+L LC   F +  +TDV A  N GA+DFE L+  VQ +     + + + W PK+  +F+++ S+P +  D+ ESF+NC + +LS QIK+ L R +E WVD+F+E + + LP+LKMYL ++  ++QFYP+ +DLE+LI FI + IT S+Q++PT+ S +N      ++ A L  H+L  A+E+LR++  R  E P +YF+  +  PYS+L++G E   +  FLN    F +Y EY  K   I  ++  LPN EYF LIRL+CED+K GL KE  RL+ +LL RV  D ++ N EI   FE ++  +  +P++S+EL D+I YMEEARCQGM+ +  KI  ++  LDYLLD + F+PED+  NS VF+W  +IQP FD NDK+QE +++  E+ ++ RREKL +EL + + RVDEFN++GEMDSEM  QYVQDVR +  +L +A  E +WIN EE L+++  + +P+IEEI+A ++PF +LF  V++Y KSER+WLHGEF+ L A+ IEAEV+E +RE+FK+QK F  + KK  ME                  A  +    +         L   +E +  KPPAAL+I  K   Q+  FKE IPVI  LC PGI+KRHW++MS IA +D+TP+SGTSLAK+L + LD YM+EFA IS+ AS+EFTLE NM+KMRE+W  V F +T YRE+GISILASVDDIQQ+LDDQIVKTQTMRGSPFIKPFE+EIK WEE+LL+  ETID+WLK+QAQWLYLEPIF SEDIMQQMPEEGRLFQ VDRNWKDIMRNT +DPNV+KA  F GI ERLK+SN LL+KINKGLNAYLEKKRLFF RFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDN+LDI AMFSSE EKI +SQV+STSEARGAVE+WLLQVQ+ ML+S+RDVIAA+REAY  E R++WVC W GQVVLCVSQI+WTL+VHE L  GV+GL  YH+K ++Q+++IV+LVRGKLNAQQRITLGALV IDVHARDVV DM +  V SENDFNWLSQLRYYWEEEN  VRLTNATVKYAYEYLGNS RLVITPLTDRCYRTLIGA+HLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGK                               ILCIIRAIQ HV+ F+FEGTE+ LN NCYVCITMNPGYAGRSELPDNLK+LFRPVAMMVPDYAMIGEISLYSYGFMDARSL+VKIVTTYRLCSEQLSSQ HYDYGMRAVKAVLSAAGNLKLK+PDENENILLLRSI DVNLPKFL+HD+PLFRGIISDLFPGVVLP+ADYT+FL    +V  +HNLQ V FF EK+IQ+YEMMIVRHGFMLVGEPFG KT VLH LAE M++LNE GH+E+EKV+++TINPKSITMGQLFG+FD VSHEWTDG+TANTFREFASNDTPDRKWV+FDGP+DTLWIESMNTVLDDNKKLCLMSGEIIQMS+VMSLIFETMDLSQASPATVSRCGMIY++P S+GWRP+  SWL S P+VL   +G E ++ L +W ++ CL F+  NC+ ++ T   +LV + L  ++M++  H ++ED +ENR L++W  +A++F + W +GG LD   RQ+FD F R +++G++E +P+PKE+  R E  +PE GLVYDY+YE+K RG W HWN+ NKN+     +NIRE +VPTMDTARYK+II +C+++ + LMF+GPTGTGKS Y Q+KLM EL  +++V  F+NFSAQTSANQTQ I+MSK+DRRRKG++GPP+GK A+ FVDD+NMPAKE YGAQPP+ELLR   DHG WY           DLKDTTK++LQDI L+ AMGPPGGGRNDVT RFLRHF++VSMT F+D+TM RIFSTLM  YM+ QEF+S+Y+++GQ MV +TLEVYK A+ NLLPTPAKSHY+FNLRDFSRVILGICLIKK++VEDK+T+ RLW HEV+RV+YDRL +D DR WL+  +K  +  +FKE  D+LF HLT    EPV+E+HLRSL+FGD+M+ D++PEDR YEE+K I+  YP++EQC+++YN  +K KM LVIFRYV+EHLSRICRIL  PGGNALLVGVGGSGRQSLTRLAAAMA   +FQPEISKNYGK EWRED+K LLK+AGGEGK TVFLMTD+QIK+ESFLEDIDNLLN+GEVPNL+++EEK EV+++V+ A +A +   + AD SPLAL+A FVNRC+EKLH                                 WPEDALERVA KAL+ +DM+D++RN TV + K+FHTS+ +L+++F + LGRK YVTPTSYLELI+SF+ LL  KQ+E  R + RYVNGLDKLAFA+ QV+DMQ+KLEELQPQLV+A   NE L++ I+ ES+  E+QR+KVKAEEEIVN+KADASKALS+ECRADLAEA PAL+AAL ALDTL+PADITIVK+M+NPP GVKLVME +C+MR+IKP++VNDP   GKK+ DYWGPSKKLLG+M FL  LRE+DKDNI+  IM +IRKE+I NP+FDP +V+RASSAAEGLC+WI+AME YDRVAK+VAPK+ KLA+AE++L ENM  L +TQ  L  VE+KL NL+ +L+ T+DEK RL+EEV LCA KLERAKKLIGGLGGEKDRW+QAA +L  +Y NL GD+L+SAGVIAYLGPFTSV+R++C+ DW  LC  YKI CS  FSLT CLG+PV+IQ WNI GLPRD+FSIDNSVIVA ARRWPLMIDPQ QANKWIKNMEKE G+ V+KLTD+DFMR LEN IQFG PVLLENVGE+LDPSLEPLLLKQ FKQ+GV+M+RLGE++IEYS++FRLYITTKLRNPHYLPE+AVKVSLLNFMITLEGLEDQLLGIVVAKEKPELE+ARQELI+T+ANNRRMLKETEDRILATLSESEGNILENETAI+ILDSSK +SDDI KKQ+ AEETQKKID+ RMDYAPIA+HSA+LFFSITDLPNIDPMYQYSL+WFVNL+INSIHDSNKSK+++KR+RYL DHFTYSLY NVCRSLFE  KLLFS +LC+K+LMS+G+LE +E+LF LTGGVGLENK ANPA++WLSDKSWDEICRL+ LK FKGF+E F  +L  W+ +YDSKDP +  +P PW  K+D F+ L+VLRCIRPDK+VP + NYV+EKLG+KFIEPPPFDLAR++QDS C  PL+F+LSPGADPTMALLKFA DKGFGG++F SISLGQGQGPIAA MI++ K +G+WV+LQNCHLAVSWM A+EKICE++T ENTN  FRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNL QS++ND IS+PEFF GC GK+ TFEKLL+GLCFFHALVQERRKFGP+GWNIPYGFN+SDLRIS RQLQMFVNEY++VP+DAI+Y+TGECNYGGRVTD+ DRRCLMTIL DF    ++ D +YKFS SG Y  P KMEYT+Y+EFIK+LP+ QNPEVFGMHENVDITREL ++R+L DS+L+T+GQ T+   G S+ +L EIA+DILGK+PA+FDLE A   YPV Y ESMNTVLVQEMERFN L+  I+ +L +L KAIKGLV+MS  LE++A++L V K+P +W+  SYPSLKPLGSYINDL ERL+F ++W+ E KP T+W+SGF+FTQAFLTGV+QN+AR+ TIPIDLL FDF VL T H +  P++GAY+ GLFLDG RW+ + M+LGEQ+PKVL E +P++ LKP  R   + +S T NRY CPVYKTSER+GVLSTTGHSTNFVL VFL T    SHWVKRG ALLCQLDD
Sbjct:    1 MILYPHMQKILDLCQRQFAQIEITDVKAYRNLGAVDFENLKAVVQQEVANKMEILTQKWLPKIFQLFSDKNSIPPLRSDMLESFFNCVSTILSIQIKHFLQRNLEEWVDLFDEEHTERLPVLKMYLTYEDQKVQFYPSMEDLEDLILFISDQITNSLQQVPTVQSWLNIPTTKKYVDATLPPHVLNPAREKLRAAVKRYLESPYKYFEKKFVEPYSFLLDGSEAKKVENFLNSKQEFRDYREYTAKLHAIGHEVMTLPNTEYFDLIRLDCEDVKVGLSKECRRLANVLLERVVSDFKQTNNEICASFEEMRDRSRAIPQSSEELIDMIRYMEEARCQGMVRMEAKISWAREYLDYLLDVYIFTPEDIAQNSAVFSWKARIQPEFDENDKLQERMRAVGESAVIARREKLTTELNRLRNRVDEFNDYGEMDSEMQNQYVQDVRAVLKRLMDAENERAWINKEEALYRLQVTNYPDIEEIRALAEPFQRLFTTVVRYNKSERRWLHGEFDKLNAEAIEAEVEEYWREVFKLQKLFTARVKKMRMELDERRRNQRKRRKEEARAAAEEGADAEAIAAAEAAALAAEKELEDVKPPAALDIIKKIQAQMKSFKEIIPVIGILCNPGIRKRHWEQMSLIAGQDLTPDSGTSLAKMLQLNLDPYMDEFAGISSGASKEFTLETNMRKMREDWVEVAFGMTAYRETGISILASVDDIQQMLDDQIVKTQTMRGSPFIKPFESEIKEWEERLLYIQETIDEWLKMQAQWLYLEPIFCSEDIMQQMPEEGRLFQVVDRNWKDIMRNTAKDPNVLKATAFQGIKERLKDSNALLDKINKGLNAYLEKKRLFFARFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNRLDIKAMFSSEGEKIVLSQVVSTSEARGAVEKWLLQVQESMLLSVRDVIAAAREAYDIENREDWVCSWPGQVVLCVSQIFWTLDVHEYLRYGVQGLQNYHQKLDQQMADIVRLVRGKLNAQQRITLGALVVIDVHARDVVRDMIKMEVTSENDFNWLSQLRYYWEEENVKVRLTNATVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGK-------------------------------ILCIIRAIQAHVDRFVFEGTEIDLNPNCYVCITMNPGYAGRSELPDNLKILFRPVAMMVPDYAMIGEISLYSYGFMDARSLSVKIVTTYRLCSEQLSSQPHYDYGMRAVKAVLSAAGNLKLKFPDENENILLLRSIQDVNLPKFLAHDLPLFRGIISDLFPGVVLPEADYTVFLTEAEQVAREHNLQAVPFFKEKLIQTYEMMIVRHGFMLVGEPFGSKTTVLHTLAEVMTRLNESGHEEYEKVLFKTINPKSITMGQLFGEFDPVSHEWTDGVTANTFREFASNDTPDRKWVVFDGPVDTLWIESMNTVLDDNKKLCLMSGEIIQMSRVMSLIFETMDLSQASPATVSRCGMIYMEPMSLGWRPLARSWLNSLPQVLVAGDGRETINALLDWLIDPCLEFIRLNCRSMVSTRQANLVTSCLGFVNMLIDVHAQQEDASENRYLRLWTCTAFIFGVVWGLGGCLDLSGRQRFDQFLRAVMLGQDERYPVPKELGPRIEFPMPEGGLVYDYYYEYKSRGSWKHWNERNKNIDLSTNRNIREMIVPTMDTARYKYIIQLCLDNGRRLMFIGPTGTGKSAYVQEKLMRELDTEKFVAYFMNFSAQTSANQTQMILMSKVDRRRKGIYGPPVGKTALFFVDDLNMPAKEEYGAQPPVELLRMLVDHGYWYAAIYTHIYAMYDLKDTTKLILQDINLITAMGPPGGGRNDVTQRFLRHFHMVSMTPFNDETMYRIFSTLMLTYMRVQEFSSEYISMGQVMVNSTLEVYKAAMENLLPTPAKSHYLFNLRDFSRVILGICLIKKDRVEDKKTFARLWTHEVMRVYYDRLTDDPDRNWLFNFIKNVLVDNFKEKIDLLFAHLTKGNGEPVEEKHLRSLLFGDFMDTDSLPEDRAYEEIKEISAVYPVIEQCLEDYNQANKKKMPLVIFRYVVEHLSRICRILRVPGGNALLVGVGGSGRQSLTRLAAAMAGYSIFQPEISKNYGKAEWREDIKILLKRAGGEGKPTVFLMTDTQIKEESFLEDIDNLLNSGEVPNLYSSEEKAEVMDMVQTAQEAASGVGQSADLSPLALYALFVNRCKEKLH--------------------------------PWPEDALERVAHKALQHLDMDDEVRNVTVHLFKYFHTSITSLADKFLRRLGRKTYVTPTSYLELIDSFQRLLTQKQNEISRARTRYVNGLDKLAFASTQVADMQVKLEELQPQLVEASAENESLLIVIATESVAVEEQRVKVKAEEEIVNQKADASKALSEECRADLAEAQPALDAALCALDTLKPADITIVKSMKNPPTGVKLVMEAVCVMRDIKPDKVNDPAGSGKKINDYWGPSKKLLGEMNFLASLREFDKDNINPAIMQRIRKEYIVNPDFDPAQVARASSAAEGLCKWIMAMEQYDRVAKIVAPKRAKLAEAEAELAENMAALKKTQAALHEVEEKLENLQNQLQATQDEKQRLEEEVLLCATKLERAKKLIGGLGGEKDRWSQAADHLLQVYSNLTGDILVSAGVIAYLGPFTSVFREECIHDWIRLCTEYKITCSENFSLTNCLGDPVRIQQWNINGLPRDAFSIDNSVIVAMARRWPLMIDPQGQANKWIKNMEKEAGITVVKLTDSDFMRNLENGIQFGTPVLLENVGEDLDPSLEPLLLKQTFKQSGVEMIRLGENVIEYSRDFRLYITTKLRNPHYLPEVAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEEARQELIVTTANNRRMLKETEDRILATLSESEGNILENETAIEILDSSKQLSDDIQKKQKVAEETQKKIDSTRMDYAPIAKHSAVLFFSITDLPNIDPMYQYSLTWFVNLFINSIHDSNKSKIIEKRIRYLIDHFTYSLYVNVCRSLFEAHKLLFSLVLCAKLLMSRGELEMSEFLFFLTGGVGLENKLANPASNWLSDKSWDEICRLSSLKSFKGFREHFETHLTEWKRYYDSKDPHETPLPPPWD-KVDVFRALIVLRCIRPDKVVPGVLNYVREKLGRKFIEPPPFDLARTYQDSSCTTPLLFILSPGADPTMALLKFATDKGFGGARFQSISLGQGQGPIAANMIAQGKADGSWVLLQNCHLAVSWMPALEKICEDLTIENTNGTFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLLQSYLNDPISDPEFFGGCDGKQETFEKLLYGLCFFHALVQERRKFGPLGWNIPYGFNESDLRISVRQLQMFVNEYDKVPYDAIQYMTGECNYGGRVTDERDRRCLMTILCDFLCPAIVSDPRYKFSASGLYFAPNKMEYTDYLEFIKSLPATQNPEVFGMHENVDITRELSETRMLTDSILLTVGQSTAGTVGFSDAELDEIASDILGKIPAAFDLEDAIKKYPVKYEESMNTVLVQEMERFNNLTRVIKNTLTDLKKAIKGLVIMSEMLESLAAALSVNKLPDVWAGKSYPSLKPLGSYINDLTERLDFFRRWYQEDKPPTYWISGFFFTQAFLTGVLQNYARRNTIPIDLLAFDFAVLPTHHEDTPPDEGAYVHGLFLDGCRWDYDAMELGEQQPKVLNEPMPIVQLKPMLREKLETVSATLNRYTCPVYKTSERRGVLSTTGHSTNFVLAVFLKTSVNPSHWVKRGAALLCQLDD 3742          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 4796.88 bits (12441), Expect = 0.000e+0
Identity = 2368/3892 (60.84%), Postives = 2980/3892 (76.57%), Query Frame = 2
Query:  308 MNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSL---VQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCV--EHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIEL---VRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFK-ESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLIT-LGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            MNY FLK CV+  PI P+Q+ WL ++  ++S  L++GR + ++ +  EV+++F+  + +       +    P V  L              LDF++ WH SF+++R+ + K L IL+P M+ +L +C  TF + L+ D+ A  + G +   +L+  V L+CE+ +  +M  W+PKVI++   + +V  I  +  ++FYNC + LLSNQ+K ++ R+V A+V++F+  +   LP+ +M L F+  +M FYP++ D+EE +  I   I+ +MQK+ T+ S ++     V I A L +H+ A+A+  L+++  +  E P ++F+N Y   Y +L+N   +  + KF+ E HSFD+Y + IEKFQ ++++I  LP+V +F +IRL+CE+LK GL K+    ++ILL ++    R++ +EI E+FE IQ+ A   PET++++ ++IAY+  AR +G+  L  KI  +  R  YLL  H FS EDL+LNS++  W + I PIFD N+++ E  K K E  L  +REKL+ +L+K   R++EF E  E+D  MM+QYV +++T+Q  L+E    +S+IN EE L+K  ++++PEI+ +K   +P+ ++F LV+K+Q++E++W+ G F DL  + +EAE+DE +RE++K+ K F  + KKA   +  +   K++    D D    P              +C K + QI EFKE IP+++ LC PGI+ RHW++MS I N D+TPNSGT+L KVL   L +YME F  ISAAAS+EF+LE  ++ M E W+ + FS   +RESG+SIL +VD+IQ +LDDQIVKTQTMRGSPFIKPFE EIK WEE+L+   +TID+WLKVQAQWLYLEPIFSS+DIMQQMPEEG+LFQ VD++W+++MR+ V+DP V+ A   +G+LE+L+ESN LLE+I KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKL+F   LDI AM+SSE E++++ Q+ISTSEARGAVE+WL+QV+DVML SIRDVI  SR AY    R +WV EW GQVVLC SQ+YWT EVHEA+  GV GL  Y+ +   Q+ +IV+LVRGKL  Q R TLGALVTIDVHARDVV +M  K V  E DF WL+QLRYYW  +N  V + N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAI+  +E F FEGTELRLN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+PDENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP ADY LFL    E C KHN+Q V  F +K+IQ+YEMMIVRHGFMLVGEPF GKT+VLHVLA+ ++ +NE G+++ EKV YRT+NPKSITMGQLFGQFD VSHEWTDGI ANTFRE+AS +TPDRKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFE MDLSQASPATVSRCGMIY++PS +GW P+  SWL + P+ L+      ++  LF W +   LR + KNC+ V+ T + + V +L  L +M++   + +E    N+N++ W  +A+ F++ WSIGG  D DSR++FD F RE++ GK E  PIP  ++++E    + GLVYDY YE K +G W HWN+  KN++ G+    +++ +VPT+DT        + +     + L+FVGPTGTGKSVY ++KLMN L  +RY+P F+NFSA+TSANQ+Q IIM++LD+RRKGVFGPP+GK  +IFVDDMNMPA E++GAQPPIELLRQYFDHGNWYDLKDT+KI L D+ L+ AMGPPGGGRN VTPRFLRHFN+ SM  FSDDTM RIFS +++ Y++  +F +D  ++G  +V ATLEVYK A+ NLLPTPAKSHY FNLRDFSRV+ G  L+KKE +E+KRT  RL+VHEV RVFYDRL++D DR+WLYKL+K  +K+HFKE+FD +FEHL         EE +RSL+FGDYM PD    +R+Y EV ++  F  +VE  + EYN THKN+M+LVIFRYVLEHLSRI R+L  PGGNALLVGVGGSGRQS+TRLA  MA+  +FQPEISKNYG  EWREDLK LLKKAG +G+ TVFL+TD+QIK+E+FLED+D++LNTGEVPNLF  +EK E++E+   VR  AQAGNK  +FSPLALFAFFVNRCRE LHVV+AFSPIG AFR RLRQFP+LINCCTI+WFQ WPE+ALERVA K LE ++M D  R + + I K FHTS I+LSE+F   LGR NYVTPTSYLELI +FR LL +K+D  M  KKRY NGLDKLAFA  QV +M+ +L +LQP+L QAK  N  ++  I  ES+  E +   V+ EEE  ++KA  ++AL +EC +DLAEAIPALEAALSALDTL+P+D+TIVK+M+NPP+GVKLVM  +C+M++IKPE++NDP   G+K+LDYWGPSKKLLGDM FL  L+ YDKDNI  P+M KIR E++TNP+FDP KV++ASSAAEGLC+WI AME YDRVAKVVAPKK  L  A+  L   M  LN+ + +L+ VED+L  LK+ L++  +E+ +LQ +V+LCA+KLERA+KLIGGLGGEK RW++AA +LQ  YDNL GDVL+SAGVIAYLG FT+ +R  C  +W+ LCKS  IP S  FSL+  LG+P+KI+AWNI GLP DSFSIDN VIV+N+RRWPLMIDPQ QANKW+KN E+E  LNVIKLTD D+MRTLEN IQFG P+LLENVGEELDPSLEPLLLKQ+FKQ G+D +RLGES+IE+S +FR YITTKLRNPHYLPE+A KVSLLNFMIT EGLEDQLLGIVVAKE+PELE+ R  LI+ SA N++ LKE ED+IL TL  SEGNILE+E+AIQILDS+K +S++I KKQ+ AE+T+ KI  +R  Y PIA+HS+ILFFSI DL NIDPMYQYSL+WFVNLYINSI DSNKSK+L+KRLRYL +HFTY+LY NVCRSLFEKDKLLFSFLLCS +L++K ++E  E++FLLTGGVGL+N   NP  +WL DKSWDEICR +DL   +G +   F   L      YDSK+P +  +P PW  KL  F+ +++ RC+RPDKI PAI+NY+  KLGKKF+EPPPFDL++S+ DS    PL+FVLSPGADP  +LLKFA DK  GG+ F SISLGQGQGPIA +MI  A +EGTWV LQNCHLAVSWM+ +EKICE+ +PE  + +FRLWLTSYPSP FPVT+LQNGVKMTNEPPTGLR NL QS+++D +S+P+FF+ C  KE  +EKLL+G+CFFHALVQER+KFGP+GWNIPYGFN+SDLRIS RQLQ+FVN YE+VPF+AI YLTGECNYGGRVTDDWDRR L+TIL DFYN+ +I + +Y FSPSG Y  PPK  Y +Y+EFI+ LP+ Q+PEVFGMHENVDI+++LQ ++LL DS+++T  G          ++ L +IANDI  K+P +F+++ A   +PV Y ESMNTVLVQEMER+N L N IR SLQNLLKAIKGLVVM  ELEA+A SLLVGK+P  W+K SYPSLKPLGSYI D + RL FLQ W++  KP+ FW+SGF+FTQAFLTG MQN+ARKY+IPIDLL FD+EVL        P DG Y+ GLFLDGARW+ ++  L EQ PKVL+++VP+IW+KP        T     C    TSERKG LSTTGHSTNFV+ + LPT +   HW+KRG A+LCQLD+
Sbjct:   50 MNYMFLKECVERRPIVPIQQSWLDDMLTRVSPQLRQGRQELLENLCDEVRESFHSCILKHTGKHTSVDFISPRVFSLVRT-----------LDFARPWHDSFIRSRKLIKKNLHILHPVMKIILDICYVTFSDLLLVDLSACRSSGPVSCGSLKNKVALECERIETKLMNTWFPKVIHLLTSKDTVQGITTEKLDAFYNCASTLLSNQLKAVVERSVVAFVNLFDPLSTHKLPLFRMNLTFEEEKMDFYPSFQDMEEAVLEIFTSISNTMQKVQTVQSWLSETNNSV-IDAKLVDHVRAWAETTLKNAVWKNLEAPNQHFQN-YSNNYDWLVNRTAQDLVEKFIQEEHSFDQYTQVIEKFQALSREISSLPSVAHFDMIRLDCEELKQGLAKKAETFAQILLEQLINTQRQQCLEICEEFETIQKKAMKKPETTEDMIEMIAYISHARTKGLEELHSKIMETHQRFTYLLHVHTFSAEDLELNSKMVLWPQNINPIFDLNNELLEQAKQKGEQELQGKREKLMLKLEKLGRRMEEFAECSELD--MMQQYVTEIKTVQKWLQEVEDSISFINKEEALYKWDQTVYPEIDVMKENIEPYQKVFGLVLKWQRTEKRWMDGSFLDLNGESMEAELDEFFREIYKMLKSFQQKQKKAEQGRERQVAMKRRPGEGDDDHLESPTAL-----------MCIKVIEQIKEFKEHIPMVSILCNPGIRARHWEQMSEIVNHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRESGVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQWVREWPGQVVLCTSQMYWTQEVHEAIRSGVGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNNDNVRVCIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDEEKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNTLPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVVSTTNSNTVVSLTRLFEMLLTEPVTEE--PGNKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEEHPIPAAVSKWECPFNDKGLVYDYSYEFKGKGCWIHWNESIKNVTLGDKNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLC------EEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLEMSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVPNPDPNWLQDKSWDEICRASDLPGLQGLRYPPFCHFL----PIYDSKEPYNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFSPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYSPPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVLPFDTSATSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKPKH----CCTFLLLSC----TSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAMLCQLDN 3895          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2437.14 bits (6315), Expect = 0.000e+0
Identity = 1332/3393 (39.26%), Postives = 2022/3393 (59.59%), Query Frame = 2
Query: 1877 QKHKVRVDEFNEFGEMDSEMMKQY-VQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGT-SLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFD----NKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAY--CFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGL--AIYHEKCNKQISEIVKL---VRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEE--NALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRN----LKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHK-NKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGN--KDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDME--DDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLD-WSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGL--ENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXX----XXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPST-FWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNV--QPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEE-PVSHWVKRGTALLCQLDD 11950
            +K +  + +FN  G   S +  +  ++ +  L+++L+  ++E   I     +FK  +    +++ ++   D  +Q++++  ++     +W  G+F  L+ + +E+    +Y+ L K+ ++  ++                                          EI   + N+I +FK  IP+I  L  P ++ RHW+++     R    NS   +L K++A+GL+ + E   +IS AA +E ++E +++ + + WE     +  Y++ G       +++ Q L+D  V   TM+ S F++ FE E+  WE  L   LE I+  L VQ QW+YLE IF  EDI +Q+P E   F  ++ +WK IM    +D N ++     G+LE+L E N  LE+I K L+ YLE KR  FPRF+FLSND++LEIL ++++P  VQPHLKKCF+ I  L  +    NK +   MFS++ E ++ +  +      G VE WL  V+  M  +++D +   R A       RD+WV +W GQ+++  SQI WT +V + L  G E    +       KQ+S + +    +RG L+   R+ + ALVT++VHARDV++ + +      N F+WL QLR YWE++  + ++R TN   +Y YEYLGNSGRLVITPLTDRCY TL  A HL+  G+P+GPAGTGKTET KDL K L +  +V NCSDGLDY +MG+ + GLA +GAW CFDEFNRI +EVLSVVAQQIL I+ A+   +  F+FEG ++ L  +C + ITMNPGYAGR+ELPDNLK +FRP++M+VPD  +I EI+L+  GF + + LA K+ T Y L  +QLS Q HYD+G+RA+ ++L  AG  +   PD  +  +LL S+ D+N+ K  S D+PLF GII DLFP V  P  DY    + + E   +  LQ   F   K+IQ YE    RH  M+VG+    K+    +L +A+S ++ +G   F  V    +NPK++++G+L+G++D  ++EWTDG+ ++  R   +++ PD KW++FDGP+DTLWIESMN+V+DDNK L L++GE I M + +SL+FE  DL+ ASPATVSRCGM+Y   S +GW+P   SW+  + ++      ++ +  LF+  + + + F   +CK ++P   ++ V +L  L D +  P     + A+N N    +++WF    +F++ WSI   +D D R+K D F RE+                 E   P    +Y+Y+ + K + +    + L K           + +VPT+DT RY F+++  V  +  ++  GP GTGK+   Q  L    PA ++    +N S+QT++N  Q II S++++R KG + P  GK  + F+DD+NMPA + +G+QPP+ELLR + D+G WYD     + +  D++L+ +MGPPGGGR  ++ R    FN+++MT  ++  +  IF T+  I  K QEF  +   +G  + QATLE+Y    +  LPTPAK HY+FNLRD S+V  G+    ++  + K++ TRLW+HE  RVF DRL++ +D E    LL E +       FD+ + ++     +P+         FGD++      E  VYE++ +       +E  +++YN T     MSLV+FR  +EH++R+ R++  P GN LLVG+GGSGRQSL+RLAA +   +VFQ E++K Y KQE+RED+K L +  G + K TVFL  D+QI DESFLEDI+N+L++GEVPNL+ ++E  EV   +  +A+  N  + AD    A+F + + R R  LH+V+  SP+G  FR R+RQ+PAL+NC T+DWF  WP+DAL  VA + L+ + +   + ++    +I    H SV   S+     L R NYVTPT+YLEL++ ++ LL  K+ E      +  NGL K+     +V  M ++LE+ + ++ + +K  E  +V I ++   A++Q++ V A  E +  +    KA+++  + DL EA+PALE A+ AL++L   D+T +K+   PPA V+ VM+ + I+R  +P                W  +K+ LG+  F+  L  +DKDNIS  ++ KI  ++ T P+F P  + R S AA+ LC W+ AME Y R+ +VV PK+ +L  A + L E    L E + + + VE+KL  LK +  +  ++K  L+++ E    KL+RA KL+ GL GE+ RW Q   +L+     L+GD LL+A  ++Y+GPF S YR++ L + W    +  ++PCS  F+    L  P  ++ WNI GLP D+FS +N VIV    RWPLM+DPQ QA KWIKNME + GL VI L   DF+R LENA+QFG PVLL+NV EELDPSL P+L K      G  +L+LG+  +EY+ +F+ YITTKL NPHY PEI+ K +++NF +  +GLE QLLGIVV +E+PELE+ +  L+I  A+ +R L+E ED IL  L+E+ G++L++   +  L +SK  + ++  + ET+E+T+ KID AR  Y P A+ ++ILFF + D+  IDPMYQ+SL  +++L+  SI  S +S  L++R+  L+D+ TY++Y   CR LFE+ KLLFSF +C+KIL   G L   EY F L GG+ L  E +  NP TSWL+D +WD I  L+ L  F G   SF    + W  +Y S +P++A +P  W T  +  + +L++R +R D++   + +++   LG +F+EPP  D+    +DS    PLIFVLSPG DPT AL++ AE  G G S F+++SLGQGQ PIA +MI E  + G WV L NCHL++SWM  ++K+ E++  E+++ +FRLWL+S P P+FP+ +LQ G+KMT EPP G++ N+++ +   L++E + F+ C  +   + KLLF LCFFH+++ ER+KF  +GWNI Y FNDSD  +S   + ++++EYE++P+DA++YL    NYGG VTDDWDRR L T ++D++ E  +    +K S   TY +P       Y E+I+ LP +++PEVFG H N DI  ++ ++R L D++L    Q+TS+       S E+++ EI+ D+  K+P   D E  +       +  +N VL+QE++R+N L + IR SL  L K IKGLVVMS  LE M   +   ++P +W K +YPSLKPL S+  DL +R+     W     P   FW+SGF F   FLT V+Q+ AR++ + +D L ++F V      N+   P DG +I GL+L+GA W+ +   L E +P  L   +P I  +P + +     +N Y CP Y    R G         +FV+ V L +      HW+KRGTALL  LD+
Sbjct: 1149 KKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQ----------------------------------------WEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKG------TEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLE---GPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKM-----EVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPE-NGVNPADNENYGRMVELWF----IFSLIWSICASVDEDGRKKIDNFLREM-----------------EGTFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPA-KWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYD-----RQMKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTM--INQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGS----LFDLTYHNICPNKQQPI---------FGDFLK-----EPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETAD----AMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPT---------------WAEAKRQLGESNFIKQLVHFDKDNISDRVLKKI-GQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPS-FHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLY--QLVTESQ-FSRC-SRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQKLLQDDPS-PLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEK-AYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVE-NRKKVAKNMYSCPCYYFPVRSG----GAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSLDN 4407          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1927.91 bits (4993), Expect = 0.000e+0
Identity = 1158/3160 (36.65%), Postives = 1808/3160 (57.22%), Query Frame = 2
Query: 2618 NMKKMREEWETVEFSLTVY----RESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLD----IHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYC-FEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEG----LAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEE--ENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREF-ASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFV---------SKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFREL----IIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDL-KDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVR-QAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTV-KIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLD-WSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDL--KEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQ-----VPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKF----SPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQ-LSEIANDILGKMPASFDLE--KAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPID---LLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
             +K++ + WE ++FS+  Y    +E G  IL SVD+IQQ LDD  V  Q+M GS FI PF   I+ WE+ L    E I+ W+ VQ +W+YLE IF   DI  Q+PEE + F  +D+ +K IM +TVRDP + +       L  L+  +  LE+  K LN YL+ KR  FPRFFF+S+DE+L IL  + +P  VQ H+ K ++ IA L FD+  +      A+ S+E E +++ Q +    A G VE W+  V   M  + R +   +   YC  ++R +W+ ++ G VVL  +Q++WT EV +  ++   G    +  Y +K ++QI  +V+ +   L    R  L  ++ IDVHARD+V+   R  +    +F W SQLR+YW++  ++  VR  +A   Y YEY+G +GRLVITPLTDR Y TL  A  + L GAP GPAGTGKTE+TKDLAKAL + CVV NC +G+DY+A+GK F GLA  GAW CFDEFNRI+  VLSV++ QI  I  A+   ++ F FEG E+ L+    + ITMNPGYAGR+ELP+++K LFRPV ++VPD   I EI L+S GF+ A+ LA K+   Y+L  EQLS QSHYD+G+RA+K+VL  AG LK   PD NE+++L+R++ D+NLPKF+  D+PLF G+ISDLFPG+  P+  Y  F  AV  +  ++    +    +K++Q YE M+ RH  M+VG   GGK+ V++ L +A ++L           +Y  +NPK++++ +L+G  D V+ +WTDGI +N FR+     D  +R++++FDG +D LW+E+MN+V+DDNK L L +GE I++    +L+FE  DL  ASPATVSRCGM+++ P ++ + P +  W+ S+P   + D     +  LFE  V   +  V          +  K ++P   +++V  L  ++D +++P    ED++ +  L+ +F    + A+  S+G  L    R+KFD   ++L     +   ++   P EI  +   LP    ++D+ ++   +  W  W+ L             + LVPT+DT R  ++++  V+ ++ ++ VG +GT K+  TQ+  +N L  D  +   +NFS++T++   Q+ + + +++R K  +GPP+GK  ++F+DD+NMP  + YG Q PI LL+   D G  YD  K+     L+D+  + AMG  GGGRN+V  RF+  F+V ++    ++ +  I+S+++  + +   F      +   +   TLE+YKT I +L PTP+K HY+FNLRD SRV  G+ L   E+   +  + R+W +E LRVFYDRLI ++D+  +   +K  I++HF    D       +   +P+        +FGDY    +  E RVYE++++ +    + ++ ++EYN  +K +M+LV+F   L+HL+R+ RI+    G+ALLVGVGGSG+QSLT+LAA  A   VF+  +S+ Y +  +REDLKTL  K G E K TVFL TD+ + +E FLE I+N+L +G VP LF  +EK  V+  +R +A + G   +  S  +++ +F+N+    LH+V+  SP+G   RTR R FP L+N   IDWF  WP  AL  VA   L    M     ++TV   V   H SV   S  F + L R NYVTP +YL+ I+++ TLL  K    +   KR   GLDKL  A+ Q++D+  KL E +  L +   A E L+ +IS  + +AE+++   + + + + E+         +  + LAEA+PALEAA  AL  L  +D+T +++   PP  V++V E I +MR             G K ++ W  +K ++ +  FL  L E D D+IS   +  +R  F+ N      ++   S A  G+ +++ A+  Y  VA+ + PK+ K+A+ E +  ++  +L + Q +L+ ++ +L  L +K      EK  LQEE +L  ++L  A KLI GLG E  RW +    L+     L+GD L+SA  ++Y G F   +R++ + + W        IP S  F + + L + V+I  W    LP D  S+ N ++   A R+P+ IDPQ QA  WIK  E++  L +    D DF++ LE AI++G+P L ++V E +DP ++ +L K V    G  ++ LG+  ++Y   F+LY+ TKL NP Y P +  K  ++N+ +TL+GLEDQLL ++V  E+ ELE+ R+ LI  ++ N+R+LK+ ED +L  L+ S GN+L+N   +  L+ +K+ + ++ +K + AE T   ID  R  Y P A+  AILFF + ++  ++ MYQYSL+ F+ ++  S+  S  + +L KRL  + +  T ++Y+  C  LFE+ KLLFSF +  KI  ++G     E  F L G + LE         WL D+ W++I RLN+L   EF    E    N + W+ ++D   P+ A  P  +   L  F+ LL+LRC R D++  A+++YV   +G+K+++PP       F+ S   +P++F+LSPG +P   L+K AE  GFG ++   +++GQGQ  +A Q++  A   G W+MLQNCHL V W+  +EK  E +T    + +FRLWLT+ P   FP+ +LQ  +K+  EPP GL+ N++ ++      + E    CP     +  L++ L FFHA+VQERRK+G +GWN+PY FN+SD  +    L  ++ +        +P+ +++YL GE  YGGR  D +DRR L   +D++  +  I D    F    +    Y +PP      Y+E I++LP    PEVFG+H N +I    Q +R +   ++    Q   SGGG S ++ ++++A DI  K+P++FDL+  + ++   V+     + VL+QE+ERFN+L   +  SL  L +A+ G V MS EL+ +A +L  G+IPA+W K +  +LK LG+++     R      W   G+P+  W+SG +  +++LT ++Q   R+   P+D   L            +  +P  G Y++GL+L+GA W+ E   L   KPK L   +P++ + P +   +   +N  + PVY TS R+  +         V    L T E  SHWV +G  L    D
Sbjct: 1268 GVKEVVDTWEVMKFSVQRYFKGTQERGY-ILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVP---AEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLG------LLTKMY-ALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQAD-----LRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEP----EDLS-SEELECFF----IEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGY---LPT---LFDFHFDGTTKK-WMPWSSLVAKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQN-FLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGHTR--PFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELD-------SAMRDPI--------LFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNE-NKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMG---SGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMR-------------GHKEIN-WKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRG-FLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERIT--KPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFK---IQLETLMSCP--HPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDF-IFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDVS---PTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLR-LQNTLRTPVYTTSMRRNAM-----GVGLVFEADLFTTEHHSHWVLQGVCLYLNSD 4340          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1853.57 bits (4800), Expect = 0.000e+0
Identity = 1132/3215 (35.21%), Postives = 1779/3215 (55.33%), Query Frame = 2
Query: 2426 VIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIF-SSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIH------AMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEG----LAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEE--ENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVD-MEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKK-ANELLMV------DISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLD--YWGPSKKLLGDM-GFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLD--WSALCKSYKIPCSVKFSLT--ACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKG--FGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPK-----FPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFI-KALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXX---XXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNE-GKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQ--PNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQL 11944
             IA L  P I+ RHW ++ +      + +  T+L  +L + L  + +E   I   A +E  +E  + ++   W  +EF    +  + + +L S +D+ + L+D  V+ Q +  S  +  F  E+  W+++L      I  W +VQ  W +LE IF  SEDI  Q+PE+ + F+ +D ++K++  +  + PNV++A +  G+  RL++  G L    K L  YL+ KRL FPRF+F+S+ ++L+ILS   DP +VQ HL K F+  AK++F+   D         MFS E E +  ++     +  G VE WL +V D M  ++R  +  +  AY  + R++W+ ++  QV L  +QI+WT +V  A  R  EG    +  Y++K   Q++ ++ ++ G+L+   R  +  + TIDVHARDVV  +  ++VE+   F WLSQLR+ W+E  ++    + +A   Y+YEYLGN+ RLVITPLTDRCY TL  + HL ++GAP GPAGTGKTETTKDL +AL +   VFNCS+ +DY + G  +KGLA +GAW CFDEFNRI +EVLSVVA Q+  I  AI+   + F F G E+ L  +  + ITMNPGYAGR+ELP+NLK LFRP AM+VPD+ +I EI L + GF++AR LA K +T Y+LC E LS Q HYD+G+RA+K+VL  AG+LK   P+  E+ +L+R++ D N+PK ++ D+P+F G+I DLFP + +P+     F K V E      LQ  D F  K++Q  E++ VRH   +VG    GK+QVL         LN+   +   + ++  +NPK++T  +LFG  +  + EW DG+ +N  RE A+      KW++ DG ID +WIES+NTV+DDNK L L S E I ++  M L+FE   L  A+PATVSR G++Y+  + +GW P   SW+  +    +K N    + ILF+  +  CL  +    K +IP     +V+ L +L++ ++ P     D       K  ++  ++FA  W+ GG L  D    + V F +  + + ++           +  P  G V+DY+ + + + +   W+ +           ++  LV T +T R  + ++  +E R+ +M VG  GTGKSV    KL   L  D+Y    V F+  T++   Q ++   L+++    +GPP  K  + F+DDMNMP  + YG   P  L+RQ+ D+ +WYD        +  +  +  M P  G    + PR  RHF+V +++    D +  I+ +++  ++  + F++     G  +VQ  L+ ++   +  LPT  K HY+FNLRD S +  G+   K E ++  +   ++++HE  RV+ D+++ED D     KL  E + K +++  + L             EE     M+  +     I E R Y  V++       + + +D YN  +   M+LV+F   + H+ RI RIL SP GNALLVGVGGSG+QSLTRLAA +++  VFQ  + K YG  + + DL  L  KAG +   TVFLMTD+Q+ DE FL  +++LL +GE+P+L+  +E   +I  VR   + G    D S    + FF+ R R +L V + FSP+GS  R R R+FPA++NC  IDWF  WP++ALE V+L+ L+ V+ +E ++++   K + + H SV   S+++  +  R NY TP S+LE I  +R LL  K+ +     +R  NGL KL   + QV D++ KL   +  L Q  + A+ L+ V       +SRE  +A+++  KV +   +V  K         +C  DLA+A PAL AA  AL+TL   ++T +K+  +P A V  V   + ++             PG ++     W  +K ++  +  FL  L  ++K+NI    +  I+  ++ +PEF P  V+  S+AA GLC W++ +  +  V   V PK+  L +A ++L     KL+  + ++ ++ + L  L  K +    +KL+ Q+E E  A+ +  A +L+GGL  E  RWA+A  N +     L GDVLL    ++YLG FT  YR + L+D  W       K+P  V   L   + L +   + AW   GLP D  S +N+ I+ +  RWPLM+DPQ Q  KWIKN   +  L VI++    ++ ++E A+  G  VL+EN+ E +DP L PLL ++  K+     +++G+   EY+  FRL + TKL NPHY PE+  + +L+NF +T +GLEDQLL  VV+ E+P+LE+ +  L       +  LK  ED +L+ LS + GN L +   ++ L+ +K  + +I +K + A+ T+ KI+ AR  Y P A  +++L+F + DL  I PMYQ+SL  F  ++  ++  +   + L +R+  L D  T S++    R LFE DKL ++  L  +IL+   ++  +E  FLL   V            +LS  SW  I  L  + EF+       ++ + W+ F + + P+  K P  W  K  S + L ++R +RPD++  AI ++V+EKLG K++     D A SF++S    P+ F+LSPG DP   + K     G  F    F+++SLGQGQ  +A Q +  A REG WV+LQN HL   W+  +EK  E+   E ++  FR+++++ PS        P  +L+N +K+TNEPP G+  NL ++  N      +    C  +E+ F+ +LF LC+FHA+V ERRKFGP GWN  Y FN  DL IS   L  ++    +VP+D +RYL GE  YGG +TDDWDRR   T L++F     +M+ +   +P   + +P  M+Y  Y ++I  ALP+ ++P ++G+H N +I    Q S  L  +VL    +   S    G S + ++  +  + L K+P  F++   E+   V        V +QE ER N L+  I+ SL+ L   +KG + M+ ++E + +++ + ++P  W+K +YPS+  L  +  DL+ R+  L+ W ++   P   W++GF+  Q+FLT +MQ+ AR+   P+D +    +VLK +  +    P +GAY+ GLF++GARW+++   + + + K L  A+PVI++K    D    T N Y+CPVYKT +R            +V    L T+E  S W   G ALL Q+
Sbjct: 1211 AIAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNE---PCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVL-------KSLNKTYQNMKRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKREIQSEKAN----LTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCH-----KELYELYFVFAAIWAFGGALFQDQLVDYRVEFSKWWVTEFKT-----------IKFPSQGTVFDYYIDPETKKF-EPWSKMVPRFEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKL-GSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMNPTSGSFT-INPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMVGKFYEDMEEAL-------------EEAKVMNMYCHFAL--GIGEPR-YMPVQSWESLNKTLLEALDSYNEVNA-AMNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVR-GQGLLD-SRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRK-------QKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMA-----------PGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQP-YLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHE-LMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGD-NLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKG--RYIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPV---QPGVTSPVDFLSHHSWGGIKALCSMDEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKNK-TSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQHG-EGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDN---FNQDTLEMC-ARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPE-MMEGELYLAPG--FPLPGNMDYNGYHQYIDDALPA-ESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNM--VELMGKVEERSPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLKKNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDK-QETRNVYQCPVYKTRQR---------GPTYVWTFNLKTKENPSKWTLAGVALLLQI 4325          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 1700.64 bits (4403), Expect = 0.000e+0
Identity = 1102/3441 (32.03%), Postives = 1799/3441 (52.28%), Query Frame = 2
Query: 1805 IQESVKSKNEAILLQR--REKLISELQKHKVRVDEFNEFGEMDSEM-MKQYVQDVR----TLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGT-SLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILA--SVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAA----DFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQ-----ISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEE--NALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMF-EGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWL----ASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPET-GLVYDYFYEHKVRGYWHHWNDLNKNL--SKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLK---DTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTL-MSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETF--------DVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNK-MSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDME--DDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRL---KVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIM--REIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATS-WLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMN---DLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQ---VPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVL-ITLGQLTXXXXXXXENQLSEIANDILGKMPASFD-LEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFAR-KYTIPIDLLGFDFEVLK--TSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQL 11944
            +  S + +NE + LQ   R +LIS +Q      D F +  + D  M M    QD        Q++     ++       EELF +P +  P++ EI+ Q     +L+ L     ++    ++G ++ L AD     ++ I  EL   Q +   +  +AL E                                A L++  KT   I +F E  P++  +    +  RHW +++ +        + T  L  ++   L  Y EE   I  +A +E  +E  +K++  EW+   F+   ++  G  +L   S  +I   ++D ++   ++  + +  PF+ +I+ W + L +T + I+ W+ VQ  W+YLE +F   DI +Q+P+E + F  +D++W  IM      PNV+++         +L  L +    LE   K L  YLEKKRL FPRFFF+S+  +LEIL +  D   +Q HL   F+ I  + F +K              +++ V+ + + +     + +  + V L++                          QV L   Q+ WT +  EAL        I  +   KQ     ++ ++ +    L   +R     L+TI VH +D+ +D+C   + S +DF WL Q R+Y+ E+    ++ +T+   KY  E+LG + RLVITPLTDRCY TL  A  +++ GAP GPAGTGKTETTKD+ + L    VVFNCSD +D+  +G+ +KGLA SG+W CFDEFNRI+L VLSV AQQI  ++   +   +TF F +G  + +N    + +TMNPGYAGR ELP+NLK+ FR VAMMVPD  +I  + L S GF+D   LA K  T Y+LC EQLS Q HYD+G+R + +VL   G  K   P + E+ +++R + D+NL K +  D PLF  +I DLFPG+ L +A Y     A+ +   +  L     +  KIIQ +E   VRHG M +G    GK+  +H L +AM+   +  H E        +NPK+IT  Q+FG+ D  +++WTDGI +  +R+       +  W++ DGP+D +WIE++N+VLDDN+ L L +G+ I M+    ++FE  ++  ASPATVSR GM+++  S + W P+   WL    A + EVL+          LF        +F  ++    +      ++   +N++  +++P  +  +++         +  ++FA+ WSIG LL+ D R+K + + R      ++S  +         + P++   ++DY   +   G W HWN   +     K         LVP +D  R  F+I    +  ++++ +G  GT K+V  +  L    P      S +NFS+ T+    Q+ + S +D+R    +GPP GK   IF+DD+NMP    +G Q   E++RQ  +   +++L+   + T IV  DI  + AM  PGGGRND+  R  R F++ + T  S+ ++ +IF  +    Y   + F  D   V   +V  T  +++     +LPTPA  HY+FNLRD SR+  G+  +  + +   +    LW HE  RV  DR     D  W   +L   +++   E +        D  F        E   EE   +    D+  P      +VYE + +       +   +  YN + +   M LV F   + HL +I RI+ +P GNALLVGVGGSG+QSLTRLA+ +A   +FQ  ++++Y      EDLK L + AG +GK   F++TD++IKDESFLE ++N+L++GEV NLF  +E  E++  +    +        +   L  +F++R R+ LHVV+ FSP           FPALI+ CT+DWF  WP+DAL  V+   L + D++    ++ + V+ +  F   V     ++F+   R  +VTP SYL  I  ++ +   K  E+++       GL KL  A+E V+ +  +LE  + +L  A +  ++++ +++ ++  AE  ++   KVK + + + +   A KA++ E    L  A PALE A +AL T++P+DI  V+T+  PP  +  +M+ + ++  R +   +++   N    +   W  S KL+    FL  L+++ KD I+  ++ ++   +   P+++     R      GLC W  AM ++  + + V P K  L   E+ L      L + Q +L   + +L  ++ + +    EK  L E+ E C  K++ A  LI GL GEK RW + +    A    L+GDVLL+   ++Y GPF   +R+  L DW    ++  IP  +  +LT  L +   +  WN+ GLP D  SI N +IV  A R+PL+IDPQ Q   WI+N E +  L +  L    F   LE+++  G P+L+E+VGEELDP+L+ +L K   K      +++G+  ++  K FRLY+TTKL NP Y PEI+ + S+++F +T+ GLEDQLLG V+  EK ELE  R +L+     N+R +KE ED +L  L+ ++G+++++E+ I +L ++K  S+++ +K + A ET+ KI+AAR +Y P+A   +IL+F IT++  ++ MYQ SL  F+ L+  S+  S+KS +  KR+  + +H TY +++   R L+E+ K LF+ LL  KI M    ++  E+L L+ GG  L+ KA  P  S W+ D +W  +  L+ L +F    +    + + WR+++D + P++  +P+ +   LD FK LL++R   PD+ +     Y+ + +G+++ E    DL R++++S    P+I +LS G+DPT  ++   + +    +    +S+GQGQ   A +++ +    G W +LQNCHL + ++  +     E   ++ +  FRLW+T+     FP+T+LQ  +K TNEPP GL+  L++++     +L+         P        +L+ + F H+ VQERRK+GP+GW+IPY FN +D   + + +Q  +++ +    V +  +RY+ GE  YGGRVTDD+D+R L T    +++E +     ++F     Y +P      +Y+++I+ LP+   PEVFG+H N DIT + + ++ +LD++L I     +S GG + E  +  +A+D+L K+P  +   E  +    +   E MN  L QE++R  ++   +R +L +L  AI G +VMS  L      +   +IPA W K S+ S   LG +  +L+ER    Q W  EG+P+ FW++GF+  Q FLT + Q   R      +D +    EV +     +   P +G Y+ GL+L+GA W+    +L + KPKVL+E +PV+ +      V  +    Y CP+YK   R           N +  V L T +   +W+ RG ALLC +
Sbjct:  910 LARSSEVQNELVSLQPNFRGELISNVQTFVEDCDHFYQEYDKDGPMVMGLAPQDASDRLIMFQNRFDNLYRKFVTFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIET----VNGYYDVLWAD---VHIERINNELLDFQTRCR-KLPRALKE------------------------------WQAFLDL-KKT---IDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQ---LEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVFHDKTR------------RVNHVLISKQVKHHCILFKVMFKFVFLLA--------------------------QVGLLGIQMIWTKDSEEALTNARFDRKIMTK--TKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQP-HREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRH---------LFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPKDQGGELSREH-----MERLYVFALMWSIGALLEQDDRKKMEHWLRH-----HDSIHLD-----LPYIPPDSQDTMFDYHVTND--GQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKS-LNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIV--DIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENA----DFDMP------KVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLESVKFAMN--TGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKE---KLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNC---ITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVV-ELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVETA---YVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTET--DSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRP--------MLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMF---NHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWAS-STLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYAENNGVKDS--RLYSCPIYKKPART--------DQNIIAAVDLRTSQRPEYWILRGVALLCDV 4172          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2567.34 bits (6653), Expect = 0.000e+0
Identity = 1348/2865 (47.05%), Postives = 1877/2865 (65.51%), Query Frame = 2
Query:  167 RKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKK--GRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLES-DDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHN-EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIF---EEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSII---------NSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPN-VEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVA--ENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGK-----------NESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWND-LNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQ-EFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKD--ADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYR 8647
            R++    L+    N +  +  Q     P  P+P       S ER     +Y+++  +    +  M+E+WLQ++   +   L+        +  +  E++ ++  S+K+++V   L+ P    L+  +DL P  EE   L   + W   F   R  L ++L  + P M  +L L + T+ +  + +V  +     A++  + +  V    +   + ++  W  ++  I+   N++K VPK+    +  S++NC   L+++ ++ L   ++  + D+    + G  K  P   + L    + ++F P++ D + ++  + + + +++  +P +++ +         +++ QPV +       +L   +  +R+   +    P+E+ ++ YE P+  L+ G+ E ++ +FL+E H+F E+ + +  ++ ++  I      V    +  L C++L   L K    L   LL R++Q+H+K    + E+FE+I + A + P  ++ L +L  Y+++   Q M  L  K+  +K  L +LLD+   SP +++ N+  F W  ++  IF  + +I      + +  L  RR +   +L+ +  + +EF+  G++    + +Y++  + L +KL+ A + +   N EEE F  P S +P+ ++I+    P+++L+++ +++    + W+ G   D+  D +E +V   +R L+K+++      +                                      AL I  +  + +  F+  +P+   LC PG++ RHWD +S +    +       L K L M L+S++ +F  IS  AS+E++LE  ++KM  EW+ ++F+L VYR+SG SIL++VDDIQ LLDD IVKTQTMRGSPFIKPFE+++K WE KLL   E +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F  VD+ W+D+++ T+ D +V+       +LERL++S  LLE I KGLN YLEKKRLFFPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI+++EF   LDI  M SSE E +++ + ISTS+ARG VE+WLL+++ VM+ S+ +VI  + EAY    R EWV  W GQ VLCVSQ +WT EVHEA+  G + L  Y  +CN QI E+V LVRG+L+ Q R+TLGALV +DVHARDV+  + +  +  ++DF WLSQLRYYWE+ +   R+ NA + Y YEYLGN+ RLVITPLTDRCYRTL GA +L+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGL S GAWACFDEFNRI+LEVLSVVAQQIL I R I    +T MFEGTEL+LN  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYAMI EI LYS+GF+ AR L+VKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYP ENE+IL+LRSI+DVNLPKFL+HD+PLF GI SDLFPGV LP+ DY + L+A+ E C K NLQ  DFF EKI+Q YEMMIVRHGFM+VGEPFGGKT    VLA A+  + E+      KV    +NPK+ITMGQL+GQFDA+SHEW+DG+ A ++R FA++ +PDRKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ++   +LIFE MDL  ASPATVSRCGMIY++P  +GWRP+  SWL ++P  L   +   ++  LFE  V  CL+FV K+ K + PT   +LV +L+NL+D  M    ++  +   ++R++  W +  +LF++ WS+G       +  FD   REL+ G            +E+   P E   F V  P  G VY+Y +  + +G W  W + L+         N  + +VPT+DT R+  +++M V H++ ++FVGPTGTGKSVY  + L+  L  + Y P  +NFSAQT+A QTQ IIM KLDRRRKGV+GP  GK  V+FVDD+NMPA+E YGAQPP+ELLRQ+ DH NWYDLKD + I L+++ ++GAMGPPGGGRN VT RFLRHFN V++  F D +M  IFS +M  +   +  F +D+  + + +VQ+T+EVYK A  NLLPTP KSHY+FNLRDFSRVI G+CL   E      +  RLWVHEVLRVFYDRL++D+DR WL   ++++I  + KE F  LF+H +    + V+++ LRSLMF D+   D+  + + Y EV ++     +VE  ++E+NN  K  M+LV+FR+ +EH+ RI RIL  P  +ALLVGVGGSGRQSLTRLAA MA+  +FQ EISK Y   EWREDLK +L+++    +  VFL TD+QIK ESFLEDI+NLLN+GE+PNLF  +EK E+ E +RQ  +  +KD   D SPLAL   FV+RCR++LHVV+A SPIG AFR RLR+FP+L+NCCTIDWFQ+WP DAL+ VA + LE V++ ++     + + K FHTS I LS++F     R NYVTPTSYLELI++F+ LL  K+ E MR K+RY  GL+KL  A  QV+ MQ +L  LQPQL++A       M  I RES         VKA+E + NE+A A+K + DEC ADLAEA+P L +AL+ALDTL   DIT+VKTM++PPAGVKLVME I I++ +KP+RV DP+  G+ + D WGP+K+LLGDM FL  L ++DKDNI   IM  IR ++ITN EFDP K+  AS+AAEGLC+W++AMESYD+VAKVVAPKK+KL QAE++L   M  L   Q+ L+ V+DKL  L+Q L+  + +K  L+ +V++C KKL+RA++LIGGLGGE+ RW +AA  L   Y++L GD L+S+G++AYLG F S +R
Sbjct:    1 RERFRTTLVKILTNQDNVLPGQLGQDTPPSPSPH------SAERDAMRYHYYIQHGIHTENVASMEEEWLQHVLALVPQTLRSHPSHLATIHGLSQEMRDDYLVSVKKAIVDFVLQDPKNKDLKKREDLPPHREELAVL--PKPWRERFFATRRRLQEELHSINPAMLAVLQLWHNTYCDLRLVNVEEIRGGTAALELSSFQKVVMRHVDLAKETLLSKWLSEIQTIYYQSNKKKLVPKLTNVTRLASYFNCAAALMTSLLQKLALNSIYDYTDLICSTQTGTVKH-PGFVLRLILSKDTIKFEPDFKDFQVVLLNVFDVMMKTLATVPRVETKLYSDWPMDKAHTHLQPVVL-----REVLEELQSHVRAEIIQQSLLPREHLRH-YE-PFEGLVGGQAERDVERFLSEEHTFSEHEQLVSHYRELSHSILYSSQLVVRLGMFELHCDELVAALAKRAENLGSRLLGRMSQEHQKFIQRLCEEFESIAEKALSTPINTKALMELKEYIQKVEVQEMSQLQVKLNEAKDHLLFLLDHASLSPSEMRHNNTAFQWCGRMPGIFTEHRRILTEKTEQYQESLKFRRRRFEEDLEAYAKQAEEFSTLGDLAD--VNKYLKKAQVLHTKLEAATEMIESFNAEEEAFAWPTSQYPQKKKIQDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQ--------------------------------------ALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLLTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEALDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAIRGGQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWEDGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPSENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARPPPLSAPHK-ALICALFERLVPCCLQFVRKSTKELSPTSDTNLVCSLMNLMDCQMDDFHDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAE--PFSVPFPAAGSVYEYRFIQEGKGRWELWTEALSLAPPIPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQ-VEDDDLRSLMFCDF--SDSKDDAKRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDVEVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFR 2803          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 2545.77 bits (6597), Expect = 0.000e+0
Identity = 1399/3271 (42.77%), Postives = 2007/3271 (61.36%), Query Frame = 2
Query: 2408 FKEKIPVIACLCKPGIKKRHWDKMSSIANRDIT-PNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRES-GISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF-----------DNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCE-WAGQVVLCVSQIYWTLEVHEALERG----VEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEE--NALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEG---HDEFEKVIYRTI-NPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQ---DKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYL-MGAM----GPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQA-----GNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDM-EDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLEN-KAANPATSWLSDKSWDEICRLND-LKEFKGFKESFSA--------------NLEGWRA-----FYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENT--NTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFF-NGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQL-SEIANDILGKMPASFDLEKAEIAYPVTYNE-----SMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL-----KTS---HMNVQP--------------NDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
             +EK+PV+A L  P +K RHW+ +  I    +    +  +LA ++ + +  Y E+   +S  AS E +LE  +KK+ + W+T EF +  +R+S  + ILA  D+IQ LLDD I+   T+  S ++ P ++ +  W+ +LL   +T+++W+  Q  WLYLE IFS+ DI +Q+P E ++F  VD++WKDIMR   R PN ++AA   G+L+  K +N LLE+I K L AYLE KR+ FPRF+FLSNDE+LEIL++T++P  VQPHL+KCF+ IA+LEF               DI AM S E EK+ + + +   +ARG VE WL +V++ M  S+R +   +   Y    R EWV      QVVL V+Q+ W  ++ + LE G    ++ +A + ++  ++++ +  LVRG L    R  + AL+T+DVHARD+V DM +++VE+ N+F W  QLRYYW+ E  N + R+  +   Y YEYLG   RLVITPLTDRCY  L+GA  L+L GAP GPAGTGKTETTKDLAKALA+QCVVFNCSDGLDY  MG+FF GLA SGAW CFDEFNRI++EVLSV+AQQ++ I  A    V  FMFEG E++L + C   ITMNPGYAGR+ELPDNLK LFRP+AMMVP+YA+I E+ LYS GF  +R LA K+   Y+LCSEQLS Q HYD+GMRAVK+VL  AG+LK + P   E+++L+R++ D NLPKFL+ D  LF GI+SDLFPGV +P  DY     ++        LQ V     K+IQ YE M+VRHG MLVG   GGKT V   L++A+  L+E G   H+ F + ++ T+ NPKSI+MG+L+G+ + ++ EW DG+ A + R   ++D+ D KW++ DGP+D LWIE++NTVLDDNK LCL + E I+++  + +IFE  DL  ASPATVSRCGM+Y+    + W P   +W+    +   +D G  +M  LFE  V + LRFV+K C   +P   I  V  L  L++ ++      +   E+  L       ++F   W++GG L  +   +FD F +      +++             LP +G ++ Y+ ++  +     W  +  N    +     E LVPT DT R+ ++++  +  + S++F G TG GKSV  +   DK+  E    +YVP ++NFSAQTS+ +TQ+II SKL+++RK + G P  K  +IFVDD+NMP  + YG+QPPIELLRQY D G +YD +      +QD     GAM     PPGGGRN VTPRF+RHF+++ + + S+ ++ +IF  +++ ++   +F      V   +V+A +E+Y    + LLPTPAKSHY+FNLRD S+ + GI       V D+    RL+ HE  RVF+DRLI + D+++   +L E   K F     V  E+    P           ++FGD+M       DRVYE++ ++ +   +++  +D+YN +   +M LV F+  +EH++RI R++    GNALLVGVGG+G+QSLTRLA  M     FQ E+S+ Y    + EDL+ L   AG E K TVFL TD+QI  E FLEDI+N+LN+GEVPNLF  +E  +V+   R  A+      GN+D       +  FF+NR R +LH+V+  SP+G AFR R R FP+++NCCTIDWF  WP +AL  V+      VD+  D+++ +  ++    H SV  L+E ++  L R+ Y TPTSYLELIN + ++L  K+ +    + R  NGL KL    E V  +Q++L  L+P L Q  +  E LM  ++ +   A+  R  V  +E +   KA+ ++A++ + + DL EA+PAL+AA  ALD+L  +DI+ V+   NPP GV+ VME ICI+   KP+               W  +K+LLGD  FL  L +YDK+NIS  ++ K+ K +I N +F P KV R S A + +C W+ AM+ Y RV K V PK+ +LA A+++L   M  LN+ Q++L+ VED++  L+ +   +  EK  L + + L   ++ RA KL   LG E+ RW ++    Q   +N+IG+V +++  +AY G FTS YR   +  W + C+   IP +  FSL   LG+P +I+ WN  GLPRD+ S +N ++V   RRWPLMIDPQ+QAN+WI+N E + GL +IKLTD +F+RTLENAI+ G PVLLE + E LDP+LEP+LLKQ F   G  ++RLG+S ++Y K FR Y+TTK+ NPHYLPE+ +KV+++NF +T  GLEDQLL  VV  EKPELE+ R ELI+    ++  LK  EDRIL  L  SEGNIL+NE  I+ L  SK  S  I  + + AE T++ I+ AR  Y P+A   ++++F I  L  IDPMYQYSL +F  L+  +I  S K   L +RL  L      + Y+N+ R LFE+ KL+FSF+LC +IL   G +   E+   L G  G++  +   P   WL++ +W+  C L D L  FKG K    A              N E W        + +++  + ++   W  +L  F+ L++++    +K+V A+T++V E LGK FIE PP DLA  +QD     PL+FVLS G+DP  A  +FA + G+   + ++ISLGQGQGPIA ++I EA + G WV LQNCHLA SWM AME+I + ++  N   +  +RL+L+S P+  FPVTVLQN VK+TNEPP GLR N++++F       P FF     G+   + K++FG+CFFHA++QER+KFGP+GWNI Y FNDSD   +   L +F  +  ++P+DA+ Y+TGE  YGGRVTD WD+RCL TIL  F++    ++  Y +S SG Y    +    ++ ++I+ LP   +PE+FGMHEN ++  + Q++  L+ ++L    + +  G G+S +++  E+A+ IL K+P   D+E A +    T +E     S+ TVL QE++RFN L   IR SL  L KAI G VVMS E+E + +S L  ++P +WS  +YPSLKPLG ++ DL  R  F+  W   G P +FW+SGF+F Q FLTG +QN ARKY +PID LGF ++ L     +TS    M  Q                DG  + GLF+D +RW+ E M + +     +   +PV+  +P +        + Y  P+YKTS R G LSTTGHSTNFV+ VF+P++    +W+ +G ALLCQL+D
Sbjct:  909 IREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGL---KARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIM-ALFENYVEDGLRFVNKKCTQAMPQVDISKVTTLSCLLESLLLGKGGPDLKMEHSRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVKHQFEENHDA------------KLPSSGDLWSYYMDYDSKRL-DPWERIVPNFRYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEA---QYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFLV--DFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQF--GVQVEAEYFVKHP-----------ILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDE------VLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPD---------------WASAKQLLGDSNFLKRLTDYDKENISEDVIQKL-KVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSENEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGY-SERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTE---ITPAFFEKNVLGQ--NWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQD-GRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKT-LEPGYLYSTSGIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGA-MESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQN--YQPDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALLCQLND 4111          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2541.92 bits (6587), Expect = 0.000e+0
Identity = 1269/2328 (54.51%), Postives = 1669/2328 (71.69%), Query Frame = 2
Query:   71 NLPPI-EEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVE-GLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIW--------FQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKT 7021
            +LPPI    S  S++  PK  KLL   R S+  R+ L ++++  A+ V +          P PP PQ PS M S ++  R+NY  LK  V++ P+ PM   W + +   + V L++    +     ++   ++  SM +S+VQ  L KPNV GLE++D+ P P EP GLDFS  W  SF   R+++   L I++  ++ +L + +T   +TL+ D+      G ++  A    V L  EK ++ +M  W+P+V+++F ++      E D  ESF+ C + LLSNQ+++L+ RT+EA+V +F+  + + LP  ++ L FD   M+ YP+ +DL   +  +   I +S+Q +P + + +  +  P  I       +L  A   L  +     + P+E+ ++ Y   Y +L+NG     +  F++E+ SFDE    +E+F+ + ++++ LP+V +F ++RL C +LK GL+ +      +LL+++   HR  N  I + FE ++Q    VPE S+E+ +L +Y++ AR +G+  L++KI+    R+ +LLD H  SPED+  NS+V  W R+I P FD N+++ E  + K E+ LL RRE+L+ EL K   RVD F E  E+D  M+ QYV D+R +  +L++A   +++IN EE L+K   + +PE++ I+ + DPF +LF L++++Q++E+KW+ G F +L  + +  E++E +RE++K  K F  + KKA  E+      ++   R    +      E+   +   ++++C                         + RHW +MS +   DITP+SGT+L KVL   L  Y+++F QISAAAS+E++LE  +  M E W+T+ F+   YRE+G+SIL+SVD+IQ  LDDQIVKTQTMRGS FIKPFETEIK+WEE+L+   ET+D+WLKVQAQWLYLEPIFSS+DIMQQMPEEGRLFQ VDRNW+++M+   RDP V+ A   +G+LE+L+  NGLL+KI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIA+L F   LDI AMFSSE E++++ + +STSEARGAVE+WLLQV+DVML S+RDVI  +R AY    R +WV EW GQVV+CVSQ++WT EVHEA++ G + GL  Y E+   Q+ +IV+LVRG L+ Q R+TLGALVTIDVHARDVV DM  K V +E DF WL+QLRYYWE E   VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTL+GA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AM KFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  + TF FEGTEL LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP ADYTLFL+A  E C++HN+Q V  F +K+IQ+YEMMIVRHGFMLVGEPF GKT+VL VLA+ ++ ++E G    E+V  RT+NPK+ITMGQLFGQFD VSHEWTDGI ANTFREFAS+DTPDRKWV+FDGPIDTLWIESMNTVLDD  +LCLMSGEIIQMS+ MSLIFE MDLSQASPATVSRCGMIY++PS +GW+P+  SWL + P  L++++  +++  LF W V   LR V K CK       + ++K  LN    +    + KE  +      I+         Q+++ F++ WS+G   D D R KFD F REL+ GK++  P+P  + ++E  L E GLVYDY YE K RG+W HWN+L KN   G+ G  +++ +VPT+DTARY +++D+C++H + L+FVGPTGTGKSVY ++KLMN L  +RY+P FVNFSAQTSANQTQ IIMSKLD+RRKGVFGPP+GK +VIFVDDMNMPA E +GAQPPIELLRQ+FDHGNWYDLKDT+KI L+D+ L+ AMGPPGGGRN VT RFLRHFN+ ++ +FSD+TM+ IFS++M+ Y++  +F  ++ +VG  +V ATLEVYK A+ NLLPTP KSHY FNLRDFSRVI G+ L+++E  + +R+  RL+VHEV RVF+DRL++D DR WLY L ++ ++ HFKE+FD +FE L      P+ +E +R LMFGDYMNPD + E+R+Y EV ++ +F  +VEQC++EYN THKN+M+LVIF YVLEHLSRI R+L  PGG+ALLVGVGGSGRQSLTRLA AM+   +FQPEISK+YG  EWRED+K 
Sbjct:   20 HLPPIIHPDSVMSREMTPKQRKLLHH-RRSESQRRLLQQIMLADALKVYEGTAKHNRQRVPSPPEPQLPSTMNSTQKKTRLNYLALKRHVESGPVAPMPPSWQEAMLCLVPVPLRQEELLKELLQEVDA--SYRSSMHKSMVQNILVKPNVKGLENEDISPPPREPEGLDFSNPWRDSFEAARKDIKGNLHIMHSALRSILDMGHTVLSQTLLLDLSGYRAMGPLELTAFSNNVTLQLEKGEEKLMHSWFPRVVSLFADKHK--STEADSTESFHGCVSTLLSNQLRDLIVRTIEAYVRLFDLADGRALPHFRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETIKVQTPEDVLTRASAALLHAVQANMQGPQEHLQS-YIDRYGWLVNGTAMERVHTFISEDRSFDECATLVEEFRALVRELQGLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMSFLLDVHILSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFAECSELD--MIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQER------QRDAPRKKRGDSAEAEMEEAQEQSDPSVQMC-------------------------RDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCK-------MLMLKLWLNTRTQLCPSDITKERYSNAPESCIFMHANSIYSLQASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEE-GRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVKV 2300          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003959.1 (pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2536.14 bits (6572), Expect = 0.000e+0
Identity = 1273/2328 (54.68%), Postives = 1673/2328 (71.86%), Query Frame = 2
Query:   71 NLPPI-EEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVE-GLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTG---SIHLVKNLLNLIDMIMKPHLEK------EDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLK 7018
            +LPPI    S  S++  PK  KLL   R S+  R+ L +++I  +V      +++     P PP PQ PS M S ++  R+NY  LK  V++ P+ PM   W + +   + V L++    +     ++   ++  SM +S+VQ  L KPNV GLE++D+ P P EP GLDFS  W  SF   R+++   L I++  ++ +L + +T   +TL+ D+      G ++  A    V L  EK ++ +M  W+P+V+++F ++      E D  ESF+ C + LLSNQ+++L+ RT+EA+V +F+  + + LP  ++ L FD   M+ YP+ +DL   +  +   I +S+Q +P + + +  +  P  I       +L  A   L  +     + P+E+ ++ Y   Y +L+NG     +  F++E+ SFDE    +E+F+ + ++++ LP+V +F ++RL C +LK GL+ +      +LL+++   HR  N  I + FE ++Q    VPE S+E+ +L +Y++ AR +G+  L++KI+    R+ +LLD H  SPED+  NS+V  W R+I P FD N+++ E  + K E+ LL RRE+L+ EL K   RVD F E  E+D  M+ QYV D+R +  +L++A   +++IN EE L+K   + +PE++ I+ + DPF +LF L++++Q++E+KW+ G F +L  + +  E++E +RE++K  K F  + KKA  E+      ++   R    +      E+   +   ++++CS                       I+ RHW +MS +   DITP+SGT+L KVL   L  Y+++F QISAAAS+E++LE  +  M E W+T+ F+   YRE+G+SIL+SVD+IQ  LDDQIVKTQTMRGS FIKPFETEIK+WEE+L+   ET+D+WLKVQAQWLYLEPIFSS+DIMQQMPEEGRLFQ VDRNW+++M+   RDP V+ A   +G+LE+L+  NGLL+KI KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIA+L F   LDI AMFSSE E++++ + +STSEARGAVE+WLLQV+DVML S+RDVI  +R AY    R +WV EW GQVV+CVSQ++WT EVHEA++ G + GL  Y E+   Q+ +IV+LVRG L+ Q R+TLGALVTIDVHARDVV DM  K V +E DF WL+QLRYYWE E   VR+ N  VKYAYEYLGNS RLVITPLTDRCYRTL+GA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AM KFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  + TF FEGTEL LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP ADYTLFL+A  E C++HN+Q V  F +K+IQ+YEMMIVRHGFMLVGEPF GKT+VL VLA+ ++ ++E G    E+V  RT+NPK+ITMGQLFGQFD VSHEWTDGI ANTFREFAS+DTPDRKWV+FDGPIDTLWIESMNTVLDD  +LCLMSGEIIQMS+ MSLIFE MDLSQASPATVSRCGMIY++PS +GW+P+  SWL + P  L++++  +++  LF W V   LR V K CK +       S    K L+  +D  +     K      E +     LK+W  +++ F++ WS+G   D D R KFD F REL+ GK++  P+P  + ++E  L E GLVYDY YE K RG+W HWN+L KN   G+ G  +++ +VPT+DTARY +++D+C++H + L+FVGPTGTGKSVY ++KLMN L  +RY+P FVNFSAQTSANQTQ IIMSKLD+RRKGVFGPP+GK +VIFVDDMNMPA E +GAQPPIELLRQ+FDHGNWYDLKDT+KI L+D+ L+ AMGPPGGGRN VT RFLRHFN+ ++ +FSD+TM+ IFS++M+ Y++  +F  ++ +VG  +V ATLEVYK A+ NLLPTP KSHY FNLRDFSRVI G+ L+++E  + +R+  RL+VHEV RVF+DRL++D DR WLY L ++ ++ HFKE+FD +FE L      P+ +E +R LMFGDYMNPD + E+R+Y EV ++ +F  +VEQC++EYN THKN+M+LVIF YVLEHLSRI R+L  PGG+ALLVGVGGSGRQSLTRLA AM+   +FQPEISK+YG  EWRED+K
Sbjct:   20 HLPPIIHPDSVMSREMTPKQRKLLHH-RRSESQRRLLQQIIISGSVYEGTAKHNR--QRVPSPPEPQLPSTMNSTQKKTRLNYLALKRHVESGPVAPMPPSWQEAMLCLVPVPLRQEELLKELLQEVDA--SYRSSMHKSMVQNILVKPNVKGLENEDISPPPREPEGLDFSNPWRDSFEAARKDIKGNLHIMHSALRSILDMGHTVLSQTLLLDLSGYRAMGPLELTAFSNNVTLQLEKGEEKLMHSWFPRVVSLFADKHK--STEADSTESFHGCVSTLLSNQLRDLIVRTIEAYVRLFDLADGRALPHFRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETIKVQTPEDVLTRASAALLHAVQANMQGPQEHLQS-YIDRYGWLVNGTAMERVHTFISEDRSFDECATLVEEFRALVRELQGLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMSFLLDVHILSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFAECSELD--MIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQER------QRDAPRKKRGDSAEAEMEEAQEQSDPSVQMCS-----------------------IRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKDIHEKELRLSEAFTKALIVSVDCRLSGLCLKGLWVSVEALLVLLMLKLW--ASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEE-GRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2305          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003938.1 (pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1774.22 bits (4594), Expect = 0.000e+0
Identity = 824/1203 (68.50%), Postives = 997/1203 (82.88%), Query Frame = 2
Query: 3770 VKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQ 7375
            VKYAYEYLGNS RLVITPLTDRCYRTL+GA++LNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AM KFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCI RAIQ  + TF FEGTEL LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+VKIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPG+ LP ADYTLFL+A  E C++HN+Q V  F +K+IQ+YEMMIVRHGFMLVGEPF GKT+VL VLA+ ++ ++E G    E+V  RT+NPK+ITMGQLFGQFD VSHEWTDGI ANTFREFAS+DTPDRKWV+FDGPIDTLWIESMNTVLDD  +LCLMSGEIIQMS+ MSLIFE MDLSQASPATVSRCGMIY++PS +GW+P+  SWL + P  L++++  +++  LF W V   LR V K CK ++ T   +LV +L  L +M++   L +E   +++N+++W  +++ F++ WS+G   D D R KFD F REL+ GK++  P+P  + ++E  L E GLVYDY YE K RG+W HWN+L KN   G+ G  +++ +VPT+DTARY +++D+C++H + L+FVGPTGTGKSVY ++KLMN L  +RY+P FVNFSAQTSANQTQ IIMSKLD+RRKGVFGPP+GK +VIFVDDMNMPA E +GAQPPIELLRQ+FDHGNWYDLKDT+KI L+D+ L+ AMGPPGGGRN VT RFLRHFN+ ++ +FSD+TM+ IFS++M+ Y++  +F  ++ +VG  +V ATLEVYK A+ NLLPTP KSHY FNLRDFSRVI G+ L+++E  + +R+  RL+VHEV RVF+DRL++D DR WLY L ++ ++ HFKE+FD +FE L      P+ +E +R LMFGDYMNPD + E+R+Y EV ++ +F  +VEQC++EYN THKN+M+LVIF YVLEHLSRI R+L  PGG+ALLVGVGGSGRQSLTRLA AM+   +FQPEISK+YG  EWRED+K LLK AG +G+ TVFL+TD+QIK E+FLEDIDNLLNTGEVPNLF A+E+ +++E VR  AQAGNK+ + SPLALFAFFVNRCRE LHVV+AFSPIG AFRTRLRQFP+LINCCTIDWFQ
Sbjct:    1 VKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKELVQTSDGNLVVSLTRLFEMLLCGLLGQE--PDSKNVRVWIMASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEE-GRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVKALLKSAGAKGRKTVFLITDTQIKQETFLEDIDNLLNTGEVPNLFAADERQDIMEAVRPVAQAGNKNVELSPLALFAFFVNRCRENLHVVVAFSPIGDAFRTRLRQFPSLINCCTIDWFQ 1200          
BLAST of Dynein heavy chain vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 344.354 bits (882), Expect = 9.875e-95
Identity = 276/986 (27.99%), Postives = 466/986 (47.26%), Query Frame = 2
Query: 2369 LEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKM-SSIANRDITPNS----GTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSE-DIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWL----LQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIV-KLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEE------NALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTP----DRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDI 5263
             E+     +Q++       ++  L    +K RHW+ +   I  R I  N       SL  V+ + L        +I   A +EF +E ++ ++++ W+  ++ + +   SG+ ++   D ++Q   + + +  +M+ S + K FE +    E KL    E    W++VQ  WL L  I     DI   +P E   F+++   +K I     +    ++          LK +   L+ I   L+ +LE++R  FPRF+FL ND++L+I+   K   +V   +KK F  I  + F     I  + S E E + +++ I   ++  A E WL     +++  +    RD +   ++    E     V ++  Q +L  +Q+ WT  V + L+      + Y ++ + +I  ++ KL +   N +++I   AL+   +H  +V+  +     + E    W    ++Y + +      +  +  +   ++Y +EY+G   RL+ TPL    + TL  + H    G   GPAGTGKTET K   + L    VVFNC D  DY  + +   G+   GAW CFDEFNR++ +VLS V+  I  I   +Q           E  L+ +  V IT+NPGY GRSELP+NLK  FR  +M  P    I E+ L   GF D++SLA KIV    L S + SS +HY +G+R +K VL     L  ++ +  + +  + S+  V LP     D  +F+  +S +F     P  +    ++ + +   +      + F +K +Q Y M   +   +LVG+   GKT     + +AM+    +GH     V+Y  I+ K +T   L+G     + EW DG+  +  R    + T      R WV+FD  +D  ++E+MN+VLDDNK L L +GE + +     ++FET +L   +PAT++RCG+++               L    E L  DN L M ++
Sbjct: 1282 FEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEV-IEHSSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDF-ITGVRSVEGEVLNLNEKIELKDSIQAQE-WLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVV---VSKYIFQAILLSAQVMWTELVEKCLQ--TNQFSKYWKEVDMKIKGLLDKLNKSSDNVKKKIE--ALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKTV--VESLKRVILPSLGDTDELVFKDELSKIFDSAGTP-LNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIF--DGH---ANVVY-VIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEAL--DNKLSMFEL 2246          

HSP 2 Score: 314.694 bits (805), Expect = 1.033e-85
Identity = 329/1459 (22.55%), Postives = 660/1459 (45.24%), Query Frame = 2
Query: 5711 EFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRR------RKGVFGPPIG--KCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGG-GRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQ-EFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGI-CLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNIN--EFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDME-------------------DDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTL--LNSKQDETMRGKKRYVN-GLDKLAFAAEQVSDMQIKLEELQPQLVQAKKA-----NELLM----VDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTK-IRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQK----LKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANAR-RWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINS-IHDSNKSKLLDKRLRYLSDHFTYSLYSNV-CRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKS------WDEICRLNDLKEFKGFKESF 9913
            + ++PT+DT +++ I    +  ++ ++  GP G+GK++   + L N   +  Y    +NFS  T    T + I+S L R        KG+   P    K  V+F D++N+P  + YG+Q  +  LRQ  +   ++   +   + ++ I+++GA  PP   GR  ++ RF RH  ++ +   S  ++ +I+     IY K   +   ++ +  +   +A++ +Y    +    T  +SHY+F+ R+ +R++ G+   I     +  R+  RLW +E  R+F DRL+   ++    +LL E++ K+               PN+ +          G+  +   +    +  + K +N  +    +E+    + +  + ++ +VI   +++H+ RI R L    G+ +L+G   +G+  LTR  A +    + QP+I ++    ++   LK  +     +   T  ++ +S I + +FLE ++ LL   ++P+LF  EE  +++  +R   ++     D +   L+ +FV    + LHVV       +   + +   PAL N C I+W   W    + +VA   ++ + ME                     +R+  V I+ HF          F++ +  K  V P S    I+  R L  L + + + ++  +R+VN GL+KL  +  +V+++   L +   +L + +K      +++LM     +  +E+     + LKV+ EE+I   K    K++ D          P +  A   +  ++   +T +++M NPP+GVK+VME +C +   +                 W   ++ +    F+  +  YD      P + K + +EF+++P F    ++RAS A   L +W+ A  ++ +V + V P + ++ + E +  +    L   ++  Q +E  +   K+K    ++D E     ++ E+      L+R+  L+  L  EK+RW             LIG+ ++S+    Y G      R   L+    L   + +   V +     L    +   W   GL ++ + ++N  IV N++   P ++DP +     I N      + ++   +  F++ LENAI+FG  V++++ GE  DP +  L+ ++         + +G+  ++ S +F+L+I +   +      +  +V L++F+   E +E ++  I + +E  E++  R++LI  +   +  LK  E R+L  L+ S+GN+LEN+  +  L++ K  + +I KK   +EE   + D    +Y+ I +HS  +F  +         Y  S+  F++ +    I  S +++    R+    D   + LY  V C+     DK     +  +   + K D+ES +Y   +   +G+ +++++       D +      WD +   + +     FK  F
Sbjct: 2389 DIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALRN---SSLYDVVGINFSKDT----TTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYE----IYYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYL--------------PNQDL----------GNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKTFCD-EELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLD-TEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHF-------DRNFYQKM--KVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQ-EEDIRKRKEVVMKSIQD--------IEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQ--------------FSNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVE----AIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTV-LLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRV----DEILWLLYQEVYCQFSTALDKKFKMIMAMTMFCLYKFDIESEQYKEAVLTMIGVLSESSDGVPKLTVDTNNDLRYLWDYVTTKSYISALNWFKNEF 3767          

HSP 3 Score: 79.337 bits (194), Expect = 1.295e-14
Identity = 51/186 (27.42%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 10283 AAQMISEAKREGTWVMLQNCHLAVSWM-TAMEKICEEMTPENTNTEFRLWLTSY-PSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQ--MFVNEYEQVPFDAIRYLTGECNYGGRVTDDWD 10828
            A + IS++K EG W++LQN  +++SW+ T + K  EE      + +F++++T +    K P  +LQ   +   E   G+   ++     DL     F     G  S +    F L +FHAL+  R +  P G++  Y FND D + ++  L+  +  N    +P+  +R       YGG++ ++ D
Sbjct: 3825 AQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVK-----DLWGSQFFTGKISGVWSVY--CTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKD 4003          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 3999.51 bits (10371), Expect = 0.000e+0
Identity = 2068/3938 (52.51%), Postives = 2745/3938 (69.71%), Query Frame = 2
Query:  254 PPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLD-FSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALH-NEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK--ESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFL----PILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINS--NPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLP-NVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNC-KGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAE--NRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIG-----KNESFPIPKEIN----RFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSK-GEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKG----QEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQ--AAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKK---IKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCS-VKFS--LTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            PP  +  S   +E+ ++R  YY++ + +    + PM++ WL ++   +   LK G +  ++ +  E+K+++  S+K+++V   LK P     +  + V   E  I LD   + W+ S++     + + L +  P M  +L L + TFG   + D   +     A++    +  V    E   + ++K W+P+V NI+   N+RK VP   Q+ K  E+F+N  ++L++NQ++ L   ++  + ++F   ++       P   M L  + + ++F P++ D E ++  + + + +++  +P +++ + S  +     +  +++  I+  AK ++ +        PKE+ K  +   Y  LI  + EA++ +FL E H F+ + + +EKF  +  +I+     V    +  L C++L   L K    L   LL R+++DH+  N  + E++E I + A T P  ++ L +L  Y+E+   + +  L +++  +K RL +L+D   FSP D++LN+ VF W  ++  +F+ + KI  + + + E  L  RRE+ + EL+ +  +++EF  FG+M    + +Y++  + L  +L+ A +++   N+EEE F    + +P+ +++    +P+++L++  +++Q   ++W+ G +  +  DK+E+E    +R L+K++KQ                                          P A  I  +   ++ EFKE +P++  +  PG++ RHW++MS I    + P+   +LAK+  M L+ Y+ +F  IS AAS+EF+LE  M+KM  EW+ VEF +  YRE+G  IL+S+DDIQ LLDDQIVKTQTMRGSPFIKPFE EIK WE KL+ T E ID+WLKVQA WLYLEPIFSS DIM QMPEEGR F  VD+NW++ M+  V D +V+       +L +LK+SN LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L+F + LDI  M SSE E + +  VISTS+ARG VE+WLL++Q+ M+ S+R VI  + EAY  E R +WV +W GQ VLCV+Q YWT EVH+A+  G + L  Y ++ N QI +IV LVRGKL+ Q R TLGALV +DVHARDV+  +C   + SE+DF WL+QLRYY+EEEN + R+ +A + Y YEYLGNSGRLVITPLTDRCYRTL GA  L+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL I   I+   +T +FEGTE++L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVP+YAMI EISLYSYGF++ARSLAVKIVTTY LCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYPDENE+IL+LRSI DVNLPKFL+HD+PLF GI SDLFPGV LP+ DYT+   A  EVC   NLQ VD F  KI+Q YEMMIVRHGFM+VGEPFGGKT    VLA+A+S + E+G  E  KV    INPKSITMGQL+GQFD VSHEW+DG+ A  +R FAS+ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCL SGEIIQ++   +LIFE MDL  ASPATVSRCGMIY++P  +GW+P+  SWL + P+ L ++N  E++  LF+      L+F+ K   K + PT   +LV + +N++D +M    +++   E   R +  W +  +LF+  WS+G  LD + R+ FD   RE++ G         + I + ++     F    P    VYDY +  +  G W  W +  K+     +     E ++PT+DT RY ++++  V H +  +FVGPTGTGKSVY  + L+ +L  + Y P  +NFSAQT+A QTQ IIMSKLD+RRKGV+GPP+GK  V+FVDD+NMPA+E+YGAQPPIELLRQ+ DH  WYDLKDT+ I L DI ++ AMGPPGGGRN +TPRFLRHFN +S+T F D TM++IFS +M+ ++      + F+ D+  +G  +V  TLE+Y+ AI NLLPTPAKSHY+FNLRDF+RVI G  L   +++ +     RLW HEV RVFYDRL++  DR+WLY  L+E  K H    FD LF+ L    +  VKE+ LRSL+F D+ +  A P  + Y EV+++++   +VE  +DE+NN  K  M+LV+FR+ +EH+SRI R++  P G+ LLVGVGGSGRQSLTRLAA MA+  +FQ EI K Y   EWRED+K +L+K        VFL TD+QIK+ESFLEDI+NLLN GEVPNLF  +EK E+ E +RQ    +  +K  D SP+ALF +F+ R R++LH+V+A SPIG AFR RLR+FP+L+NCCTIDWFQ+WP DAL+ VA + LE  ++E D++   V++ K FHTS  +LS  +   L R NYVTPTSYLELI++F+ LLN KQ E ++ K+RY  GL+KL  A  QV+ MQ +LE LQPQL+QA K  + +MV I R+SI        VKA+E + NE+A A+KA+ DEC  DL EAIP LE+AL+AL+TL PADIT+VKTM++PPAGVKLVME ICI++ +KP+R+ DP+  GKK+ D+W PSK++LGDM FL  L+ YDKDNI  P + +IR+++ +NPEFDP K+  AS+AAEGLCRW++AM+SY++   +    K   + L     D +     LN+ +  L+ V+DKL  L++K +    +K  L+++V+LC+KKL+RA+KLIGGLGGEK RW + A  L   Y NLIGDVL+S+GV+AYLG FT+ +R          C++Y      V++   L A +  PVKI+ W IFGLP DSFSI+N +I+ NA RWPLMIDPQ QANKWIKNMEK+  L+VIKLTD D++RTLEN IQFG PVLLENVGEELDP LEPLLLKQ FKQ G   +++G+S+IEYSK+FR YITTKLRNPHYLPE AVKV+LLNFMIT EGLEDQLLGIVVA+E+PELE+ +  LI+ SA N+R LKE ED+IL  LS SEGNILE+ETAI +L SSK ++++I +KQ  AEET++KID  RM Y PIA HSAILFFSI DL NI+PMYQYSL+WF+NL+I SI +S KS+ LDKRL  L +HFTYSLY NVCRSLFEKDKLLFSFLLC  ILM  G++   E+ FLLTGGVGL+N  +NPA SWL  +SWDEICRL+D+ +FKGF++ F   LEGW+  YDS +PQ   +P  W  K D F+ +++LRC+RPDKI P + N+V  KLGKK+IEPPPFDL ++F DS  CAPLIFVLSPG+DPT ALLKFA+D+GF GSK +S+SLGQGQGPIA +MI +A ++GTWV+LQNCHLA SWM  +EK+CEE+ P+ T+ +FRLWLTSYPSP FPVTVLQNGVKMTNEPP G+R N+ +S++ D IS+PEFF G   K   F+K+LFGLCFFHALVQERR+FGP+GWNIPY FN++DLRIS +QL MF+N+Y++V ++A++YLTGECNYGGRVTDD DRR L+TIL+ FY   VI D +YKFSPSG Y  P   +Y  YIE+ ++LP I +PE+F MH NV   R       +L     T   L S GG S +  ++ ++ DIL KMP  FD + A   +P TY +SMNTVLVQEM RFN+L   +R SL N+ KAIKGLVVMS ELE + S +L GKIP +W K SYPSLKPLGSY+NDL+ RL FLQ W++ G PS FW+SGF+FTQAFLTG  QNFARKYTIPIDLL FDFEVL+       P DG Y+ GLF++GARW+ +T  +GE + KVL++++PV+WL P K + I    + Y  PVYKTSER+G LSTTGHSTNFV+ + LP+++P  HWV RG ALLCQLDD
Sbjct:   67 PPLERTGSPTAAEKDILRY-YYYIHNGIDTEHVAPMEDSWLDHVLSLVPSRLKDGLEVCIENLSDEMKEDYLLSVKKAIVDFVLKDPREKEEDKKEEVL--EHRIELDQVPKPWYKSYLMASAAIEQDLFVTNPTMAGVLDLWHKTFGTLRLVDKNDIQMRPEALELAMFQNVVMRHIEIAKETLLKRWFPEVQNIYYQGNKRKQVPS-NQNAKRLEAFFNSASVLMTNQLQMLALNSISDYTELFCPPSSSIRVLEHPGFIMRLVLEGDTVKFEPDFKDFEVVLLNVYDVMIKAVMVVPRVETKLYSEWSGTKKTLKPIISEEIVNEAKAKVHAVIEHEMAGPKEHLK--FYDKYKDLITRKAEADVDQFLLEGHKFNRFSKEVEKFAKLVDEIQYNSRKVIRVGMFELHCDELIRALAKRGDGLRTKLLQRMSKDHQVLNKMLCEEYEKIAEKALTSPANTEHLMELKNYIEQVENETIFDLEKRLVETKSRLGFLVDYASFSPADMRLNNSVFQWHFRMPEVFEEHKKIVNANRVQYENSLKMRRERFVEELESYSKQLEEFQTFGDMSE--VPRYLKKAQALHQRLETAAEKIVTFNVEEEAFGWDTTSYPQRQQLINTLNPYLKLYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTE--------------------------------------VPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRETGTHILSSIDDIQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFTDTLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYWTAEVHKAIRGGQKQLDQYLQQNNSQIDDIVTLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEEENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPDENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEENKVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWLHTLPKTLNEENK-ELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTLMDEFHDEQRFKELNEREVAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCPFPSKATVYDYRFIKEGMGKWELWTEEIKDAPPIPKDMAFNEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTGTGKSVYITNFLLKKL-EETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAPDRITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADP--KPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLEECEIEADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIEVAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDMKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTTTFKSIDLLLMSVLCDFQ----GLNKKRAALKEVQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFR-------QGTCRAYSSSGRLVEYGRVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLLTGGVGLDNPHSNPA-SWLPSRSWDEICRLDDMSKFKGFRQKFPRTLEGWKKIYDSNEPQTMPLPGEWEEKFDFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQGFSGSKLSSLSLGQGQGPIALRMIEKAVKDGTWVVLQNCHLATSWMPTLEKLCEELNPDTTHPDFRLWLTSYPSPNFPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQFKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAPDDGDYETYIEYARSLPLINHPEIFDMHANVFSLRTSMRHISVLTHQTCTQCVLLSGGGRSDDEIVASVSEDILSKMPQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDWYDNGAPSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVLEDKKYETPPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPH-YVTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVALLCQLDD 3941          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 3697.9 bits (9588), Expect = 0.000e+0
Identity = 1901/3546 (53.61%), Postives = 2493/3546 (70.30%), Query Frame = 2
Query: 1367 IEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAIL--LQRREKLISE-LQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIM-----KPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRF-EVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNI-------REFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEE-MTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSH-MNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            I++FQ ++++I  L      +++ L C+++   L    ++L+  +++ V   +R +N  I  +++ +    + +P+ +++L  L  ++E+A    ++ L   +  +  RL +LLD      ED+KLNS VF W   IQ IF+ +   +  +  + +  +  L+ R K+  E L  +   V+ F +   M +E MK+ V+ +  L + L  AR E+  +N EEEL +   + FP ++ + A  +P+ +L++  + +Q     WL+G F ++ A+ +E E+  ++R + K+ K F +                                       PA   +     ++I +FK  +P++  +C PGI++RHW +MS +   DI P + TSL  +L   L  +++   +IS +AS+EF LE  M+KM+ EW  + F    YR++G+SIL++VDDIQ LLDD IVK QTM GSPFIKPFE EIK W EKL+   + ID WLK QA WLYLEPIFSSEDIM QMPEEGR F  VD  WKDIM  +V+D  V+ A     +L RL+ESN LLE+I KGLNAYLEKK+LFFPRFFFLSNDE+LEILSETKDPLRVQPHLKKCFEGIA+LEF  + ++  M S+ENE +  S  I  ++A+G VE+WL+QV++VM+ S++ V   +  AY    R +WV EW GQ                           Y EK NKQI EIV LVRGKL+   R+TLGAL  IDVHARDV   M    V S  DF WLSQLRYY+EE+  +VR+   ++ Y YEYLGNSGRLVITPLTDRCYR          +GAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLD+ AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  I +AI  H + F+FEGTEL LN  C + ITMNPGYAGR ELPDNLKVLFR VAMMVPDYA+I EISLYS GF++ARSLA KIV TY LCSEQLSSQSHYDYGMRAVK+VL+AAGNLKL+YPD++E  L+LR++++VNL KFLS D+PLF GIISDLFPG   P  DY + + ++ E C++ NLQ  D++ +KIIQ YEMMIVRHGFM+VG+P GGKT    VL+EAM+ LN+ G+  F+KVIY+ INPKSITMGQL+G FD VSHEW+DG+ AN+FR+FAS+ T DRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS   SLIFE  DL QASPATVSRCGMIY++P  +GW+P+  S+L + PE L K++  E + +LF+W +  CL F+  +CK  + +  +HLV     L   +M     + H E  D   ++ +  W    ++F+M WSIGG L+ DSR+KFD FFR LI G ++  P PKEI    + + P+ G VYDY++  +  G W +W +L       +GK++        E  + T DTAR  F ++  + H   ++FVGPTGTGKS  T   L+ +LP ++Y+P  +NFSA+TSA QTQ IIM KLDRRRKGV+GPP GK  V+FVDD+NMPAKE YGAQPPIELLRQ  DHG+WYD KDT+K+ L D+  + AMGPPGGGRND+T RF+RH NV+S+ +F D+TM +IF+++   +   + F + +  +G+ +V AT++VYK+A+   LPTP+KSHYVFNLRDF+RV+ G  L+    + +     RLW+HEV RVFYDRLI+D+DR+  ++++K++IK+ FK   D L  HL  T  + +K+EH+R+L FGDYM P++   D++Y+EV ++      +E  +DEYN   K  MSLV+F++ +EH+SR+ R+L    G+ LLVG+GGSGRQS TRLA  MA+  +FQ EI+KNY K EWR+DLK +L KAG +GK TVFL +D+QIK+ESF+EDI+ +LNTG+VPN+F A+EK +VIE ++  A+   K  D +PLA++ FF++R R  LHVV+A SPIG AFR RLR FP+LINCCTIDWFQAWPEDALE VA K LE VD+  +++   V + K+FH SV  LSE ++++L R NYVTPTSYLELI +F+TLL+ K++E +  K RY+ GL+KL FAA QVS MQ +L +LQP+L+Q     E LMV I ++++  E ++  V A+E + NE A  ++ + +EC  DLAEA+PALEAAL ALDTL+P+DI++VK+M+NPP  VKLVME +CIM+ +KPER  DP+  G+ + DYWG S+K+LGDM FL  L+ YDKDNI  P+M KIR++++TNPEF+P  +   SSA EGLC+W+ AME YDRVAKVVAPKK KLA AE++L   M KLN  + +L+ V DKL  L  +      +K  L+  ++LC KKL+RA+KLIGGLGGEK+RW + A  L+  +  + GDVLLS+G +AYLGPFT  +R++C+  W   C + KIPCS  FSL A LG+ VKI+AWNI GLP D+FS+DN +IV NARRWPLMIDPQ QANKWIKNMEKE  L+VIKL+D +++RTLEN+I FG PVLLEN+GE+LDP LEPLLLKQ FKQ GV+ L+LGE+ IEYS++F+ Y+TT+LRNPHYLPEI+VKV+LLNFMIT  GLEDQLLGIV AKEKPELE+ + ELI+ SA+N++ LKE ED+IL  LS SEGNILE+ETAI++L SSK +S++I  KQE A  T+K+ID  R  Y P+A HS++LFF I+DL +I+PMYQYSL+WF+NLY+ SI +S +S  L +R+ +L+DHFT S+YSNVCRSLFEKDKLLFSF+L   IL  +  ++   + FLLTGGV L+N   NP   WL DK+W EI R +DL   KG K+  +    GW+ FYDS  PQ   MPDPW   L     ++VLRC+RPDKIVPA+ +++ E +G+ +IEPP F+L  S+ DS CCAPLIFVLSPGADP   LLKFA DKGFGG++  +ISLGQGQGPIAA MI +A ++GTWV+LQNCHLA SWM  +EKICEE + P++T+ +FRLWLTSYPSP FPV++LQNGVKMTNEPP GLR N+ +S++ND IS+ EFF  C  K + +EKLLFGLCFFHALVQERRKFGP+GWNIPY FN+SDLRIS RQLQMF+N+Y+++P DA+ YL G+CNYGGRVTDD DRR L+ +L       ++ + K                                      H+N            L D +L+TL + +  GG S    + E+A DIL K P  FDLE     YPV Y +SMNTVL QE+ RFN+L+  +  +L+NL KAIKGLVVMSGELE + +++L+GK+PA+W+  SYPSLKPLGSY+ DL++RL F Q W + G P+ FW+SGFYFTQ+FLTG  QNFARKYTIPID +GF+F V+K    M+ +P DG Y+ GLFL+GARW+ ETM + E  PK+L++ +PV+W+ P ++    +  N Y CPVYKTS R+G LSTTGHSTNFV+ V LP+++   HWV RG ALLCQLDD
Sbjct:  575 IDEFQSLSREIASLHLTVPLNMLCLNCQEVNQELSLRASKLADTMIHYVVDQNRDKNRGICRQYDEVSDKVQEMPDNTKDLVTLTQFLEKASTVMVVQLQSHVDDAGERLLFLLDYATLPYEDIKLNSTVFHWPEHIQKIFELS---KNRIGHRKDLAMDDLKHRVKMYEEKLNGYNKEVEAFRKKEIMAAEEMKKNVEKLDELGTALDAARDELMDLNTEEELLQWEPTQFPILQSMMAYKEPYEKLWRTALNFQNKHEAWLNGPFVEINAEDVEEEIGGMFRTVIKLSKTFGDS--------------------------------------PAPRRVAESVRSKIDKFKVHLPLLQVICNPGIRERHWTQMSEVVGFDIKPEASTSLCNMLEYNLHKHLDRLEEISGSASKEFGLEKAMEKMKVEWNDMFFEFVPYRDTGVSILSAVDDIQMLLDDHIVKAQTMSGSPFIKPFEAEIKSWCEKLILMQDIIDAWLKCQATWLYLEPIFSSEDIMAQMPEEGRKFGIVDSYWKDIMTESVKDTKVLVATGQPNMLGRLQESNQLLEEIQKGLNAYLEKKQLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIARLEFTEEQEVVGMVSAENETVPFSTKIVPAKAKGMVEKWLIQVEEVMMDSLKKVAGDAVAAYVNTVRGKWVQEWPGQE--------------------------YLEKSNKQIDEIVALVRGKLDPGVRVTLGALTVIDVHARDVTAQMAHDGVHSLEDFQWLSQLRYYFEEKRVIVRMITTSINYGYEYLGNSGRLVITPLTDRCYR----------HGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDFKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHTIQKAIAEHKKKFIFEGTELVLNPTCTMFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYALISEISLYSMGFLNARSLAQKIVATYTLCSEQLSSQSHYDYGMRAVKSVLTAAGNLKLRYPDDDEAELMLRAVLEVNLAKFLSQDVPLFEGIISDLFPGTKWPNPDYGVLMDSLRENCSRRNLQATDWYMKKIIQVYEMMIVRHGFMIVGDPLGGKTMAFKVLSEAMTDLNKAGY-PFQKVIYKIINPKSITMGQLYGCFDPVSHEWSDGVLANSFRDFASSTTEDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQSLIFEPADLEQASPATVSRCGMIYMEPYQLGWKPLMESYLNTLPESLSKEHR-ETVRLLFDWLMEPCLNFIRHDCKFFLTSSDMHLVTCFQRLYSCLMDEIRAQDHAEGADRMSSQQITNWLMGLYIFSMVWSIGGTLNGDSRKKFDAFFRLLISGTDKDHPKPKEIKMSKQNVFPDRGTVYDYYFVKQASGSWGNWIELTH-----KGKSVIPKTAKASELTIETDDTARQIFFLETFLTHEVPMLFVGPTGTGKSAITNSYLV-KLPKEKYLPVNINFSARTSAGQTQDIIMGKLDRRRKGVYGPPPGKKCVMFVDDLNMPAKEKYGAQPPIELLRQLLDHGHWYDPKDTSKLELLDLLFVSAMGPPGGGRNDITGRFVRHANVISIDSFDDNTMNKIFTSIADWHF-AKGFDATFQRLGKIVVMATMQVYKSAVDKFLPTPSKSHYVFNLRDFARVMFGTLLVPSTHLNEGDKLIRLWIHEVYRVFYDRLIDDTDRQMFFEVIKDTIKQQFKLEMDRLVGHLVPT-GQKLKDEHIRNLFFGDYMAPES--PDKIYDEVSDLKALTTQMEAYLDEYNQMSKTPMSLVMFKFAIEHISRVSRVLKQDNGHCLLVGIGGSGRQSATRLATFMADYDLFQIEITKNYTKTEWRDDLKKMLIKAGVDGKPTVFLFSDNQIKEESFVEDINMILNTGDVPNIFAADEKADVIEKMQTVARVEGKKIDATPLAMYNFFIDRVRCNLHVVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEEVDISLEVKKQCVFMCKYFHESVRMLSERYYETLRRHNYVTPTSYLELIMTFKTLLDIKRNEILALKNRYLTGLEKLEFAASQVSVMQKELSDLQPELIQTSAETEKLMVKIEQDTVEVEAKKEIVAADEAVANEAAGVAQGIKEECEGDLAEALPALEAALKALDTLKPSDISMVKSMKNPPGAVKLVMEAVCIMKSVKPERKPDPSGSGRMIEDYWGSSQKILGDMKFLDSLKAYDKDNIPVPVMKKIREKYVTNPEFNPDNIRTVSSACEGLCKWVRAMEVYDRVAKVVAPKKEKLAAAEAELAIQMEKLNLKRAELKEVADKLQALNDEFDAMTTKKKELEANIDLCEKKLDRAEKLIGGLGGEKERWTETARLLEDRFFKVTGDVLLSSGEVAYLGPFTVDFRNECIDGWVKECTTRKIPCSESFSLNATLGDAVKIRAWNICGLPVDAFSVDNGIIVDNARRWPLMIDPQGQANKWIKNMEKENKLSVIKLSDANYVRTLENSITFGTPVLLENIGEDLDPILEPLLLKQTFKQGGVEYLKLGENSIEYSRDFKFYMTTRLRNPHYLPEISVKVTLLNFMITPLGLEDQLLGIVAAKEKPELEEKKNELILESAHNKKQLKEIEDKILEVLSSSEGNILEDETAIKVLSSSKVLSEEISAKQEIATATEKEIDETRNGYKPVATHSSVLFFCISDLASIEPMYQYSLTWFINLYLQSILNSERSPELSERIEFLNDHFTQSIYSNVCRSLFEKDKLLFSFILTIGILKGRNKVDDQVWRFLLTGGVALDNPYPNPCPEWLGDKNWSEIVRASDLPNLKGLKDDLAN--PGWKKFYDSSTPQSESMPDPWDL-LSGLDRMVVLRCLRPDKIVPAVQDFIVENMGRSYIEPPTFNLQLSYDDSHCCAPLIFVLSPGADPMAGLLKFANDKGFGGNRIQTISLGQGQGPIAAGMIDQALKKGTWVVLQNCHLATSWMPKLEKICEEVINPDDTHQDFRLWLTSYPSPDFPVSILQNGVKMTNEPPKGLRSNILRSYLNDPISDSEFFTAC-NKPAAWEKLLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQLQMFLNDYDEIPLDALTYLIGQCNYGGRVTDDKDRRLLVCLLSICVCRDIVDNEK--------------------------------------HKN------------LFDCILLTLPRQSGGGGKSPAEMIEELAADILSKFPPLFDLEMVIKKYPVIYTDSMNTVLRQELIRFNRLTAVVISTLRNLQKAIKGLVVMSGELEDVFNNMLLGKVPAVWAAKSYPSLKPLGSYVTDLLDRLKFFQDWIDHGPPNVFWMSGFYFTQSFLTGARQNFARKYTIPIDHVGFEFNVMKEERDMDHKPEDGVYVNGLFLEGARWDRETMLVAESLPKILFDTLPVMWIIPGEKSKFKSKPN-YPCPVYKTSARRGTLSTTGHSTNFVMFVDLPSDKTERHWVNRGVALLCQLDD 3976          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO37961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE81])

HSP 1 Score: 3224.88 bits (8360), Expect = 0.000e+0
Identity = 1613/2516 (64.11%), Postives = 1938/2516 (77.03%), Query Frame = 2
Query: 3746 LVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLS-KGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVR--QAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQ---------NGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNK 11257
            +VR+ NA+VKY  EYLGNSGRLVITPLTDRCYRTL+ A+HLNL GAPEGPAGTGKTETTKDLAKALA+QCVVFNCSDGLDY+ MGKFFKGLAS GAWACFDEFNRIELEVLSVVAQQILCI RAI  H + F+FEGT+L LN NCYV ITMNPGYAGRSELPDNLKVLFR VAMMVPDYA+IGEI LYSYGF+DAR+L+VKIVTTY LCSEQLSSQ HYDYGMRAVKAVL+AAGNLKLKYP+ +EN+LLLRSIMDVNLPKFLSHDIPLF GIISDLFPG+ LP+ADY  FL  V EVCAK N+Q VDFF EKIIQ+YEMM+VRHG    G      +Q    LA  +                               QF      WTDGI ANTFRE+A++   +  W                                                    PATVSRCGMIYL+PSS+GW P+  SWL   PEVLK+ + L  +D LF+W +  CL FV K+CK  +     +L ++L+NL+++++K     E+ A+ ++LKIW  S++LF++ WS+G  +D +SR KFDVFF++L+ GK +  PIP  + + E  +P  G+VYDY +E K RG W  W  L K+ S  G+G  I + +VPTMDTARY +++D+ + + + L+FVGPTGTGKS Y +DKLMN LP D Y+P+FVNFSAQTSANQTQ IIMSKLD+RRKGVFGPP+GK  VIFVDD+NMPA E YGAQPPIELLRQY DH NWYD KDTTKI L D+  + AMGPPGGGRN V+PRFLRHFNVVS+ TF+D+TM RIFS+++  Y +  +F +D L  G  +V AT+E+YK A+ NLLPTPAKSHY FNLRDFSRV+LG+ LIKK+ + DK+T TRLWVHEV RVFYDRL++D DR+WL          H     D L      T      E+ +RSLMF D++NPDA+ EDR+Y+EV  I+E Y IVE C+DEYN THK  M+LV+FRYVLEHL RI R+L  PGGNALLVGVGGSGRQSL+RLAA +A   VFQPEISK+YG  EWRED+KTLLK AG + K T+FL+TD+QIK+ESFLED+D+LLNTGEVPNLF  +EK E+IE VR    AQA +K+A+FSPLALF FFVN C+EKLH+++  SPIG AFR RLRQFPALINCCTIDWFQ WPEDALE VA K LE   + D+ R + V + K+FHTS  NLSE++ + LGR NYVTPTSYLELI+SF+TLL  KQDE +R K+RY  GL+KLAFAA QV+ MQ++LEELQPQLV A   N+ +M+ I +ES   E     V+ +E   N +A  ++AL DEC ADLAEAIPALEAA+SAL+TL+PADITIVK+M NPPAGVKLVM  +C+M++IKPE+VNDP   GKK+LD+WGPSKKLLGDM FLT L+EYD+DNIS  IM KIRKE+I NP+FDP KV  ASSAAEGLC+W++AME YDRVAKVVAPKK  LA+AE+ L E M  LN  +++L  VE KL  LK + ++  ++K  L+ +V+LC+KKL RA+KLIGGLGGEKDRW+ AA  LQ  +DNL GDVL+S+GVIAYLG FT+ +R +C  +W+ +C+S  IPCS  F L+  LG  +KI+AWNI GLP DSFSIDN VIV  ARRWPLMIDPQ QANKWIKN EKE  L+VIKLTD D++RTLEN+IQFG PVLLENV EELDPSL+P+LL +  K+          GV  +RLGES+IEYS +FR YITTKLRNPHYLPE++ KV+LLNFMIT EGL+DQLLGIVVAKE+P+LE+ RQ LI+ SA N++ LKE ED+IL TLS SEGNILE+ETAIQILDSSK +SD+I KKQ+ A+ET+ KI+ +R  Y PIA H+++LFFSITDLPNIDPMYQYSL+WFVNL++NSIHDSNKSK+L++RLRYLSDHFTY+LY NVCRSLFEKDKLLFSF+LC+ IL SK +L+ TE++F LTGG+GLENK  NP  SWLSD+SWDEICR+ DL  FK F++SFS     WR  YDSK+P  A +P PW  +L  F+ ++V+RC+RPDK+VP +TN+V++KLGKKFI+PPPFDLA+S+ DS  CAPL+F+LSPGADP   L+KFA+DKGF G KFN+ISLGQGQGP+AA++I EA + G+WV+LQNCHLAVSWMTA+EKICE++ PE T+T+FRLWLTSYPS KFPVTVLQNGVKMTNEPPTGLRQNL QS++ D IS+PEFFNGC  K   +EKLLFGLCFFHALVQERRKFGP+GWNIPYGFN+SDLRIS RQLQMF+NEYE+ P+DA+ YLTG CNYGGRVTDD DRRCLM+IL DF+N  ++ D+KYKFS SG Y  PPK  Y EY+EFI+ LP  Q+PEVFGMH+NVDI+++ + +R+L    L         GG  SE+ L EIA DIL K+P +FDLE A   YPVTY ESMNTVLVQEMERFNK
Sbjct:    1 MVRIINASVKYGCEYLGNSGRLVITPLTDRCYRTLMSAFHLNLGGAPEGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYLQMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILCIQRAIAAHQDRFIFEGTDLNLNPNCYVAITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIGEIMLYSYGFVDARNLSVKIVTTYTLCSEQLSSQFHYDYGMRAVKAVLAAAGNLKLKYPNNDENVLLLRSIMDVNLPKFLSHDIPLFEGIISDLFPGIKLPKADYDTFLDTVQEVCAKKNIQFVDFFREKIIQTYEMMVVRHGCG-TGSLTPSPSQWYSFLASLI-------------------------------QFRI--RYWTDGIVANTFREYAADHDGNPMW----------------------------------------------------PATVSRCGMIYLEPSSLGWDPVLQSWLGELPEVLKEHDKL--IDALFKWALPACLTFVRKSCKEAVHCSDSNLARSLMNLVEIMLKE--ASEEGADIKHLKIWVVSSFLFSVVWSVGACVDTESRAKFDVFFKDLMGGKLDDHPIPTLVGKIESPIPPEGMVYDYLFERKNRGNWLQWTKLIKSTSLGGKGTRINDIIVPTMDTARYSYLMDLMIHNNKPLLFVGPTGTGKSAYVKDKLMNGLPKDLYLPAFVNFSAQTSANQTQDIIMSKLDKRRKGVFGPPVGKRFVIFVDDVNMPALEKYGAQPPIELLRQYLDHRNWYDRKDTTKISLIDLQFICAMGPPGGGRNPVSPRFLRHFNVVSVATFNDETMQRIFSSIVQFYFRNNDFPTDALCAGNQVVSATMEIYKEAMINLLPTPAKSHYTFNLRDFSRVVLGVLLIKKDALADKKTITRLWVHEVYRVFYDRLVDDKDRDWL----------HTTCNCDFL-----CTLFSQASEDDMRSLMFCDFLNPDAMAEDRLYQEVTEIDELYKIVEACLDEYNQTHKTGMNLVVFRYVLEHLVRISRVLKQPGGNALLVGVGGSGRQSLSRLAADIAGFAVFQPEISKSYGMTEWREDVKTLLKSAGCQMKPTIFLLTDTQIKEESFLEDVDSLLNTGEVPNLFPTDEKAEIIEAVRPHAQAQAEDKNAEFSPLALFNFFVNSCKEKLHIMLCMSPIGDAFRNRLRQFPALINCCTIDWFQPWPEDALEMVANKFLEDAVLTDNERKEIVTLCKYFHTSSRNLSEKYLEVLGRHNYVTPTSYLELISSFKTLLGRKQDEVLRSKRRYEVGLEKLAFAASQVAKMQVELEELQPQLVVAAAENDKMMIIIEKESKEVEATSELVRKDEAAANIQAAEAQALKDECEADLAEAIPALEAAMSALNTLKPADITIVKSMANPPAGVKLVMSAVCVMKDIKPEKVNDPGGTGKKILDFWGPSKKLLGDMTFLTSLKEYDRDNISPHIMAKIRKEYIPNPDFDPSKVKTASSAAEGLCKWVIAMEIYDRVAKVVAPKKESLAKAEASLAETMSLLNAKRRELAEVEAKLAALKSQFQEMTEKKENLEFQVDLCSKKLVRAEKLIGGLGGEKDRWSLAAKTLQDTFDNLTGDVLISSGVIAYLGAFTAGFRKECTHEWTKICQSKNIPCSDDFLLSKTLGEAIKIRAWNIAGLPTDSFSIDNGVIVDCARRWPLMIDPQGQANKWIKNSEKENQLSVIKLTDGDYIRTLENSIQFGNPVLLENVEEELDPSLQPMLLGRDSKKPYHVKITLVGGVVCIRLGESVIEYSSDFRFYITTKLRNPHYLPELSTKVTLLNFMITPEGLQDQLLGIVVAKERPDLEEERQALILQSAANKKQLKEIEDKILETLSSSEGNILEDETAIQILDSSKVLSDEISKKQKIADETEAKINESRRGYNPIAAHASVLFFSITDLPNIDPMYQYSLTWFVNLFLNSIHDSNKSKILERRLRYLSDHFTYNLYCNVCRSLFEKDKLLFSFVLCANILKSKSELDMTEFMFFLTGGIGLENKLENPDPSWLSDRSWDEICRMCDLSGFKDFRKSFSNTTHEWRKIYDSKEPHRAPLPSPWSEQLTDFQKMIVIRCLRPDKVVPLVTNFVEDKLGKKFIQPPPFDLAKSYVDSNACAPLLFILSPGADPMAGLMKFADDKGFSGDKFNAISLGQGQGPVAARLIQEAVQNGSWVVLQNCHLAVSWMTALEKICEDLNPETTHTDFRLWLTSYPSNKFPVTVLQNGVKMTNEPPTGLRQNLLQSYITDPISDPEFFNGCGEKAPVWEKLLFGLCFFHALVQERRKFGPLGWNIPYGFNESDLRISVRQLQMFINEYEETPYDAVTYLTGACNYGGRVTDDNDRRCLMSILADFFNPDIVHDSKYKFSLSGNYYAPPKSTYDEYVEFIQELPQSQSPEVFGMHDNVDISKDCKHTRVL----LTQAQGAGGGGGKKSEDTLLEIATDILSKLPKNFDLEAALAKYPVTYEESMNTVLVQEMERFNK 2407          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 2520.73 bits (6532), Expect = 0.000e+0
Identity = 1480/3766 (39.30%), Postives = 2173/3766 (57.70%), Query Frame = 2
Query:  995 PILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTI--DSIINSNPQPVF-----------IPALLA----NHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFS--PEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSK---------LKEARQEMSWINIE-------EELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIAN---RDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRES-GISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKL-------------------------DIHAMFSSENEKIKMSQVISTS--EARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEE--NALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDE--FEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDV-AENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQ-AAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDM-EDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSF-SIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLEN-KAANPATSWLSDKSWDEICRLND-LKEFKGFKESFS--------ANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMT--PENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLS-EIANDILGKMPASFDLEKAEIAYPVT-----YNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVL-----------KTSHMNVQ-----------PNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            P+    L  +   + FYP  +D +E +  +      ++  +  +  DS  ++  +P+             P+L      +  L    + +R + +  F+   +Y  N +E PY       E  ++       H  + +   +EK+    ++   +   +   +I  +   LK+ L+    +  +++ + + +  +K   ++ +  ++ Q   E VP ++ +    + +++E   Q  I   E    +   L  L+DN++    PEDL +   +   +  ++ + D      +S+  ++  I     +K  + + K  V++ +       D + +KQ  QD + L S          LKE + +M  ++         ++ FK+  + F E+EE+ A+      L+  ++++ +S++ W    F +L  + +   V +  + + +++K         ++++                                          ++   + K+PVI  L  P +K+RHWD++  I N   +D  P +   L K+ A     + E   ++S  AS E +LE  +KK+ + W++ EF +  +R+S  + IL  VDDIQ +LDD ++   T+ GS  + P    ++ W+ +L    ET+D+W+  Q  WLYLE IFS+ DI +Q+P E ++F  VD++WK+IMR   R PN ++AA   G+LE  + +N LL++I K L AYLE K + FPRF+FLSNDE+LEILS+T++P  VQPHL+KCF+ IAKLEF + +                         DI  M S E EK+ + +V  +   E       WL  + +  L   + +   S   Y   +R       +   +  +   +++L +   +                 ++ +  LVRG L    R  LGAL+TIDVHARD+V  M   +V+SEN+F W+ QLRYYW+ +  N +VR++N+   Y YEYLG S RLVITPLTDRCY  L+GA  L+L GAP GPAGTGKTETTKDLAKALA QCVVFNCS+GLD+  MG+FF GLA SGAW CFDEFNRI++EVLSV+AQQ+L I  A       FMFEG E++L  +C   ITMNPGYAGR+ELPDNLK LFRP+AMMVP+YA+I E+ LYS GF  +++LA K+   YRLCSEQLS Q HYD+GMRAVK+VL  AG LK   PD  E+++L+R++ D NLPKFL+ D  LFR I++DLFPG  +P  DY      + +      LQ +    +K+IQ YE MIVRHG MLVG    GKT    +L + ++ L+E+  D   +  V    +NPKS+TMG+L+G+ + ++ EW DG+ A   R+     TPD KW++ DGP+D LWIE+MNTVLDDNK LCL + E I+++  + ++FE  DL+ ASPATVSRCGM+Y+ P+ +GWRP   SW+    + +K++   E +  LF+  V+  L+F SK C   +    I  V  +  L D    P     D   +   L     +A+LF   WSIGG L     + FD F R+L              +  +V +P +G +Y Y+ +   R     W  +             + LVPT+DT R+ F++D  +   +S+++ G TG GKSV  +  L +      Y+   +NFSAQTS+ +TQ++I +KL+++RK + G P GK  VIFVDD+NMP  + YG+QPPIELLRQY D   +YD +      + D+ +  A  PPGGGRN VTPRFLRHF++  + + ++ T+  IF +++S ++   +F ++       +V A++E+Y    ++LLPTPAKSHYVFNLRD S+ I G+       + DK    RL+ HE  RVF DRLI   D+ +   ++ E   KHF++               P K E    ++FGD+M   A P D++YEE+ ++ +   ++   +D+YN     +M LV F   +EH+SRI R++  P GNALLVGVGG+G+QSLTRLA  M+    FQ E+++ Y    +REDLK L   AG +G+ TVFL TD+QI  E FLEDI+N+LN+GEVPNLF  EE   V+   R  A +AG  + D     +F +F++R R  LH+V+  SP+G AFRTR R FP+L+NCCTIDWF  WP +AL  V+    E VD+  + +++   ++    HTSV  +++ F+  L R+ Y TPTSYLELI  + ++L+ K+ + +  + R  NGL KL    + V  MQ++L  L+PQL Q     E LM  +  +   A+  R  V+AEE +  EKAD + A++ E + DL EA+PALEAA  ALD+L  +DI+ ++    PP  V  VME ICI+  +KP+               W  +K +LGD GFL  L +YDKD I    + K++K +I NP+F    V + S A   +  W+ AM+ Y RV + V PK+ KLA A+++L+  M  L E Q  L  VE K+  L+     +  EK  L + +   A +L+RA KL   LG E+ RW +     +    N++G+V ++A  +AY G FTS+YR + +  W   CK   +P S  FSL   L +P +I+ WN  GLPRDS  +I++ ++     R  L +    +AN+WI+  E + GL +IKLTDN+F+RTLEN I+ G PVLLE VGE LDP+LEP+LLKQ F Q G  ++RLG+S I+Y K FR Y+TTKL NPHYLPE+ +KV+++NF +T  GLEDQLL  VV  E+P+LED R +LI+   +++  LK  EDRIL  L  SEGNIL++E  I  L+ SK  S  I  + + AE T++KI  AR  Y P+A   ++++F +  L  +DPMYQYSL +F  L+   I  S K+  LD+RL  L ++ T S+Y NV R LFEKDKL+FSF+LC  I+  +  +   E+ F L G  GL+  + A P   WL+D  W+  C L D L  FKGFK  F          NL+      +  D   A+ P  W  +L SF+ L+ ++  + +K+V A  ++V E LGK F+E P  DL   F++     PLIF+LS G+DP  A L+FA D  +   +  +ISLGQGQGP+A ++I+ A + G WV LQNCHLA SWM AME   +++T      + +FRL+L+S P+  FPVTVLQN VK+TNEPP GLR N +++F  +L+++P F +   G    + KL+FG+CFFHA++QER+KFGP+GWNI Y FNDSD   +   L+MF+ + E +P+DA+ ++TG+  YGGRVTD+WD+RCL TIL  F++  ++ D  YKFS SG Y  P      +Y E++  LP    PEVFGMHEN +I  + Q++  L+ +VL    +L SSGGG + +++  E+A+ ILGK+    D+EKAE +   T     YN S+ TVL QE++RFN L   I+ SL  L KAIKGLVVMS EL+ + +S L  ++P MW+  SYPSLKPLGS++ DL+ R  F+++W   G P +FW+SGF+F Q FLTG +QN ARKY +PID L F + VL           +T+ +              P+DG  + GL+LDGARW+ ++M LG+ +   +   +P++ ++P    V   ++  Y  P+YKTS R GVLSTTGHSTNFV+ V+LPT+ P + W+++GTALLCQL++
Sbjct:  277 PLFTTELLMEPQALLFYPGLEDFDEGLGEVTKRFQDAVLSVSNLVPDSYFDAFTRPIINGKVEEKTAGEGPSLATMFEDDRHLQGVIQSIRDAISNAFDMAWKY-ANTFE-PYRKFYQENESLDLEAIREGEHDVEFFATSLEKYNSEHEQAVGIMAKKPIGMILADLRKLKEVLIPSPLKCLEVINDILPKLAKKRTDDLMKFCQDAQFELEVVPSSTNDYVKSLTFLDE--IQEKIDDIEAESMTIKELYDLIDNYKVPTPPEDLAVYQTLRPTVTAVRNVID------KSLAERDSNI-----DKFCTCMDKDIVQLGK-------DVKEVKQKAQDPKILDSSSKSESIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKFEELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTVMQLEKGLPPNSVVPILKE------------------------------------------KLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFKDEEPLTLGLLDKIEAF---EHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDSKDVFILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEFGSTVQAPSTPQDQPVTPTGERRKMRYATNDILGMISPEGEKVSLGKVSYSHSIETLTLCFSWLKDMSNHPLNLHKKISLFSSLMYITWSRSPQYIITSSTTINALFPSHYSLCIVFPM----------------NLNNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLEEDVVLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQAEDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDKMKEETR-EYLWNLFDHYVDAGLKFASKKCTQAMQQVDISKVTTMCCLFDSFFFPAKGGPDFNLDPTKLHPLICTAFLFVFLWSIGGNLVETCNESFDTFTRDLF------------ADTHDVRIPGSGDLYSYYVDFDTR-RMEPWEKIIPAFKYSSEVPYFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQKSNYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVSGFL--LDFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKHFQQA------------RSPEKFES-NPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRPLAKEAGIPEGDRD--GVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFEEVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPD---------------WPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKK-YIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVPWLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITISMGNLQQ----SEVGDDDQAEKPRSWQDRLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDMNY-TERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAF-GELMADP-FESHVLGVR--WRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLVD-ENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKILED-NYKFSESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRYN-SLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEPQMNLVPDPSQ--YMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTALLCQLNE 3894          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2281.91 bits (5912), Expect = 0.000e+0
Identity = 1253/3064 (40.89%), Postives = 1848/3064 (60.31%), Query Frame = 2
Query: 1931 EMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANR--DITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLE-------FDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAY--CFEARDEWVCEWAGQVVLCVSQIYWTLEVHEAL----ERGVEGLAIYHEKCNKQISEIVK---LVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEE--NALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDV------AENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWND-LNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYD-LKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYN-NTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQ--AGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDD-MRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLD-WSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGL--ENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENV 11017
            E + QY + V  L+S+    R+ ++       +FKI ++L  +++ ++   +   Q++ +  ++++    W  G+F +L    +E +   +++ L KI ++  +++                                         EIC    ++I +FK  +P+I  L    ++ RHW ++ +   +  D T +  T L K++ +GLD + E+  +IS AAS+E ++E  +  +   W+ V   +  Y++ G   L   D++ Q L+D  V   TM+ S ++K FE E+  WE  L   LE ++  L VQ QW+YLE IF  EDI +Q+P E   F  V+ NWK IM+   +DPN ++   + G+LE L + N  LE+I K L+ YLE KR  FPRF+FLSND++LEIL ++K+P  VQPHLKKCF+ I  L+       FD K +   M+S+E E ++    +      G VE WL  V+  M  ++++++   R         RD+WV EW GQ+ +  SQ+ WT + ++AL    ERG            KQ+S + K   ++RG L   QR+ + ALVTI+VH RDV+E + +        F WLSQLR YW+++  + +VR TN   +Y YEYLGNSGRLVITPLTDRCY TL  A HL+  G+P+GPAGTGKTET KDL KAL    +V NCS+GLD+ +MG+ + GLA +GAW CFDEFNRI +EVLSVVAQQIL I+ A+      F+FEG E+ L  +C + ITMNPGYAGR+ELPDNLK +FRP++M VPD  MI EI L++ GF + + LA K+ T Y L  +QLS Q HYD+G+RA+ +VL  AG  K   PD ++  +LL S+ D+N+ K  + D PLF GI+SDLFPG+  P  DY     A+         Q       KIIQ YE    RH  ++VG+   GK+    VL  AM++L  +G   F  V    INPK++++G+L+G+FD  ++EWTDG+ ++  R+  S++ P+ KW++FD P+DTLWIESMN+V+DDNK L L++GE I M  ++SL+FE  DL+ ASPATVSRCGM+Y     +GW+P   SWL  + +       +E +  LFE  V + L F   +CK  +PT  ++ V +L  L D +     E+  V      +  R L++WF    LF + WS+   +D DSR+K D F REL                 E   P    VY+Y  + K +  W  W D L             + ++PT+DT RY F++   ++ ++ ++  GP GTGK+   Q K++ +L    Y    +N SAQTS+N  Q+II SK+++R KGV+ P  GK  + F+DD NMPAK+ +G+QPP+EL+R + D+G WYD +K T K V +D++L+ +MGPPGGGR  ++ R    FN+++MT   +  + RIF T+  I  K Q+F  D   +G  M QAT+E+Y T ++ +LPTP + HY+FNLRD S++  G+    K+  + K   +RLWVHE  RVF DRLI+++DRE    LL + +       FD+ F +L      P+         FG++M  D + ED V  + K I  +   +E  M++YN       ++LV+FR  +EH++RI R++  P GN LLVG+GGSGRQSLTRLA+ +    VFQ E++K+Y +QE+R+DLK L  +AG + K TVFL  D+Q  +E FLED++N+L++GEVPNL+  +E     E VR A    A  +D   +P ++F FF+ R R  LH+V+  SP+G  FR R+R +PA +NC TIDWF  WP DAL  VA + LE +++ D+  + +  +I    H SV+++S      L R NYVTPT+YLEL++ +++LL  K+ E      +  NGLDK+     +V  M ++LE+   ++ + +K  E  +V I ++   A++Q+  V+A  E +  + D  + +++  + DL EAIPAL+ A+ AL++L   D+T +K+   PPA V+ VME + I+R+ +P                W  +K+ LGD  F+  L  YDKDN++  I+ KI   +   P+F P  + R S AA+ LC W+ AME Y R+ +VV PKK +L QA + L+E    L E + +L+ V D++  LK++  +   +K  L+ + EL   KL+RA KL+ GL GE+DRW  +   L+     L+GD L++A  ++Y GPF S YRD+ +L  W A  +   + C+  FS +  L  P  ++ WNI GLP D+FS +N V+V    RWPLMIDPQ QA KWIKNME ++GL +I L  +D++RTLENA+QFG PVLL+NV EELDPSL P+L K V K  G  +++LG+  +EYS +FR YITTKL NPHY PEI+ K +++NF +  +GLE QLLGIVV +E+PELE+ +  L+I  A  ++ L+E ED IL  L  ++G++L++E  +  L+SSK  S ++ ++   +E+T+ KIDAAR  Y P A+ ++ILFF + D+  IDPMYQ+SL  +++L+ NSI  S +S  LD R++ L+++ TY++Y   CR LFE+ KLLFSF +CSKIL + G L   EY F L GGV L  E +  NP T WL+D SWD +  L+ L  F G   SF      W  +Y S +P++  +P  W    +  + +LV+R +RPD++    T+++   LG KF+EPP  D++    DS    PLIFVLSPG DPT ALL+ AE+ G   ++F+++SLGQGQ PIA +MI E  ++G WV L NCHL++SWM  ++K+ E++  E+ + +FRLWL+S P P+FP+++LQ G+KMT EPP GL+ N+++ +   LI+E + F+ C  K+  ++KLLFGLCFFH+++ ERRKF  +GWNI YGFNDSD  +S   L ++++EYE+ P+DA++YL    NYGG VTDD+DRR L + +++ +N+  I    YK S   TY VP     + Y   +  L  IQ   +F  H ++
Sbjct: 1004 EQVTQYHEQVVNLKSQETSLRRGLN-------IFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDKN----------------------------------------WEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFT-LEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFD-KTEAVGMYSAEGEYVEFGHSVLLE---GPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERG--DKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVD----KQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALAT---EENGVRMSNGESYARMLELWF----LFCLIWSVCASVDEDSRKKMDNFLREL-----------------EGQFPAKDTVYEYHVDIKQKT-WASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQ-KVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYV-KDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTM--INQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGS----MFDLTFHNLCPNKQSPI---------FGNFMKDDTMYEDLV--DFKAIKRY---MEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDE----FEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPT---------------WAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKI-GTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGM-SNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLY--QLITEQQ-FSRC-HKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVPKDGPLSTYRVSVILLMYIQASPLFARHSSL 3937          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 4318.07 bits (11198), Expect = 0.000e+0
Identity = 2162/3756 (57.56%), Postives = 2775/3756 (73.88%), Query Frame = 2
Query:  734 GAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSE----------RKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGE-GKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLK-TLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLR-PADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAA--RMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITL-GQLTXXXXXXXENQLSEIANDILG-KMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            G MD ++L+  + L+C++ +D++M  W+P+++ +FN  K+        + SFYNC + L+SNQ++++L + +E +V +F+      LPI +M L FD  +M+ YP   D+E+ +  I+N IT + QK+ T+ S +  +  P F+ A +      +A+  ++S+  +  E P ++F++ Y+  YS+L+NG  +  +  FL E HSF+EY + +E F  +A++I  LP   YF +++L+CE+LK GL  +                     +I  +FE I+Q    +P+ ++E+  +  Y++  +   +  L+ +++ +   + YLL+ H    ED+KLNS V+ W   I   F+ ++++ +S + K E  L+ RRE+L  +L+K +  +  F  + E+   ++++Y+ DVRT   +L+EA + +  IN EE  +K   + +PE++ +K Q +P+ ++F+ ++K+Q +E          ++W+ G F DL  + +E +VDE YRE++K+ K F  +  KA  E A+   + + +                       + +CS  + QI +FK+ IPV++ LC PG++ RHW+KMS IA  D+TPN GTSL K+L + L+ ++EEF  IS AAS+EF+LE  M+ M + W+ V F    ++++G+SI  ++DDIQ +LDDQIVKTQTM GSPF+KPF++E+K WEE+LLH  E+ID+WLK+QAQWLYLEPIFSS+DIMQQ+PEEGRLFQ VDRNW++IM + V+D  V++A    G+LERL++SN LLEKI KGLNAYLEK                                 K+ F                M+SSE E++++ Q ISTSEA GAVE+WLLQ++D M+ S+RD+I  SR AY   AR++WV EW GQVVLC SQI+WTLEVH+AL     GL  Y+++   Q++EIV+LVRG+L  Q R TLGALVTIDVHARDVV+D+  K V  E DF WL+QLRYYW  +N  V + N  VKYAYEYLGNS RLVITPLTDRCYRTLIGA+HLNL GAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDY+AMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQ+LCI RAI   +E F FEGT L+LN NC+V ITMNPGYAGRSELPDNLKVLFR VAMMVP+YA+I EISLYSYGF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVKAVL AAGNLKLK+P+ENE+ILLLRSI DVN PKFLSHDIPLF GI SDLFPGV LP ADY LFL+A  E C  HN+Q    FT+K+IQ+YEMMIVRH FMLVGE F GKT+VLHVLA+ +S +NE GH E EKVI+RT+NPKSITMGQLFGQFD VSHEWTDG+ ANTFREFA  +TPDRKWV+FDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMS  MSLIFE  DLSQASPATVSRCGMIY++PS +GW+P+  SW+ + P+ L+  +   ++  LF W +   L+ + ++C+ V+PT + H V  L  L  MI+   ++     ++ +++ W  +A+  ++ WS+GG  D DSR+KF+ F R+ + GKN+  PIP+ I R+E  + E GLVYDYFYE K +G W HWND  +N++ GE     +E +VPT+DT RY +++D+C+  +  L+FVGPTGTGKSVY +DKL+N L  D Y+P F+NFSA TSANQTQ IIMSK+D+RRKGVFGPP+GK  V+FVDD+NMPA+E +GAQPP+ELLRQ+ DHG+ YDLKDT+KI L D+  + AMGPPGGGRN VT RFLRH N++S+  FSDDTM+ IFS++++  MK   F+ +++ VG  +V A +EVYK A++NLLPTPAKSHY FNLRDFSRVI G  L+KK  +E K+T  RL+VHEV RV++DRL++D DR WLY+L+   +K HF   FD +F  L     + ++E+ +++L+FGDYMNPD   ++R+Y EV +I  F  +V+ C++EYN  HKN+M+LVIF Y+LEHLSRI R+L  PGGNALLVGVGGSGRQS+TRLA +MA+  +FQPEISKNYG  EWR+DLK  LL+ AG +G+ TVFL+TD+QIKDE+FLEDID++LNTGEVPNLF  +EK E+IE +R  AQAG K  + SPL LFAFFV RC+E LHVV+AFSPIG AFR RLRQFP+LINCCTIDWFQ WPE+ALERVA   LE+++M ++ R + + I K FHTS   LS +F   LGR NY+TPTSYLELI +F+ L++ K++  M  K+RY+NGLD+LAFA  +V+ M+ +L +LQP+L QAK  N  +M  I  ESI  E +   V  +EE    KA+ ++AL  EC  DLAEA+PALEAAL+ALDTL+ P+DI+IVK M+NPP+GVKLVM  +C+M+ +KP+R+ DP   GKK+LDYWGPSKKLLGDM FL  L+EYDKDNI  P+M  IR EF+TNP+FDP KV+ ASSAAEGLC+WI AME YD+VAKVVAPKK KLA+A+  L      L++ + +L+ VED+LT L++  ++  +EK RL+ +VE CA+KLERA+KLIGGL GEK  W++AA +LQ  YDNL GDVL+SAGVIAYLGPFTS +R  C   W+ LC+S  IP S  FSL+  LGNP++I+AWNI GLP DSFSIDN VIV N+RR PLMIDPQ QANKW+KN+EK+  LNVIKLTD D+MRTLEN IQFG P+LLENVGEELDPSLEPLLLKQ FKQ GV+ ++LGE +IEYS +FR Y+TT+L+NPHYLPE+A KVSLLNFMIT EGLEDQLLGIVVAKE PELE+ R  LI+ SANN+R LKE ED IL TL  S+GNILE+E+AIQILDS+K +S++I KKQ+     + ++  A  R  Y  +A+HS+ILFFSI DL NIDPMYQYSL WFVNLYINSI D  KSK+L +RL YL DHFTY+LY NVCRSLFEKDKLLFSFLLC  +L  K ++E ++ +FLLTGG+GL+N  ANP  SWL DKSWDEICR ++L  F+G  E+F  N E ++  YDS++P    +P PW  KL   + +++ RC+RPD +VPA+T +V   LGKKF++PP FDL +SF DS    PL+FVLSPGADP MALLKFA DK   GS+F SISLGQGQGPIAA+MI  A + G+WV LQNCHLAVSWM+ +EKICE+ +    + +FRLWLTSYPSPKFPV +LQNGVKMTNE PTGLR NL QS++ D +S+P FFNGCP K+  +EKLLFGLCFFHALVQER+KFGP+GWNIPYGFN+SDL IS RQLQ FVNEY++VPF+AI YLTGECNYGGRVTDDWDRR LMT L DFY E +I   +Y  SPSG Y  PPK  Y +YI+FI+ LP  Q PEVFG+HENVDI+++LQ ++LL DS+L+T  G          +N L +IAN+IL  ++P +FD E   + YPV Y ESMNTVLVQEMER+N L + I  SLQNLLKA+KGLVVM  ELEA+A +L+VGK+P  W+K+SYPSLKPLGSYI D + RL FLQ W+  G+P  FW+SGF+FTQAFLTGVMQNFARKY IPIDLL FDFEVL        P DG Y+ GLFLDGARW+ E + L EQ P++L++++P+IW+KP K+++I  T++ Y CP+YKTSERKG LSTTGHSTNFV+ + L T++   HW+KRG A+L QLDD
Sbjct:   37 GPMDCKSLQNKLVLECKRKEDSVMNTWFPQILKLFNNEKTPESTGDQKQASFYNCASTLISNQLRSVLHKGIEEFVSVFDPSRQHCLPIFQMALTFDDEKMEMYPTPRDVEKSVLEILNVITNTFQKVQTVQSWL-GHASPSFVNAKVTGDYFLWAQSTVKSAVLKNMEGPGKHFQS-YD-SYSWLVNGTAQTQVDTFLKEEHSFEEYTKKVETFHNLAKEISSLPPKVYFTMVQLDCEELKQGLTNKA--------------------KICSEFEAIKQKVLDIPKNTEEIAQMEKYIDFTKKNIVPELNNEVKEANSHIIYLLETHVAKSEDIKLNSTVYLWPHNILLAFEQSEEVLQSSRQKEEKELIARRERLTVQLEKLEHNIKTFPLYSELG--LIQEYIADVRTTGKRLQEAEENIVGINKEEAFYKWEITCYPEVKAMKEQMEPYQKVFECILKWQHTESINLTFHTLLKRWMDGSFLDLNGETMETQVDEFYREIYKMLKFFQQKQSKAAQEVAKTYGKAEGQPDEKNSSKQEC----------PTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEK---------------------------------KRLF--------------FPMYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSR-AYEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKAL-----GLKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLIEK-VSDETDFEWLAQLRYYWMNDNVRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTG--PDDESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIENINLGEINTKGQEIIVPTIDTVRYTYLMDLCIS-QGPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDHGH-YDLKDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQ--GDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIF-YLLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENERQEVITICKTFHTSANQLS-DFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEK-IWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQ-GVESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDI-KSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARK-EIEHSDLMFLLTGGIGLQNTVANPDPSWLQDKSWDEICRASELPGFQGL-EAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADP-MALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSETPPEDGVYVNGLFLDGARWDKEGV-LTEQHPRILFDSMPIIWVKPEKKNMIQ-TDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQLDD 3682          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1764.59 bits (4569), Expect = 0.000e+0
Identity = 1098/3241 (33.88%), Postives = 1782/3241 (54.98%), Query Frame = 2
Query: 2399 IHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGT-SLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILA--SVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAA----DFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKL--DIHAMFSSENEKIKMSQVISTSEARGAVERWL----LQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEAL-----ERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEEN--ALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMF-EGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNL--SKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLK---DTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQE-FTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREW----LYKLLKESIKKHFKETFDV----LFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHK-NKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDME--DDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDIS---RESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIM--REIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAA--NPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTA-MEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSF---MNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQ---VPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVL-ITLGQLTXXXXXXXENQLSEIANDILGKMPAS---FDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFAR-KYTIPIDLLGFDFEVLKTSHMNV--QPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQL 11944
            I EF E  P++  +    +  RHW +++ +   ++   S    L  ++      Y EE   I  +A +E  +E  +K++  EW+   F+   ++  G  +L   S  ++   L+D ++   ++  + +  PF+ +I+ W + L +T + I+ W+ VQ  W+YLE +F   DI +Q+P+E +LF ++D++W  IM      PNV+++         +L  L E    L+   K L  YLEKKRL FPRFFF+S+  +LEIL +  D   +Q HL   F+ I  ++F  K+   I A+ S E E +++ + I+   A G VE WL     + Q  + + IR   A + +   FE  D ++  ++ QV L   Q+ WT +  EAL     +RG+  ++  ++     ++ ++ +    L A +R     L+TI VH RD+ +D+CR  +++ +DF WL Q R+Y+ E++    + +T+ +  Y  E+LG + RLVITPLTDRCY TL  A  + + GAP GPAGTGKTET KD+ + L    VVFNCSD +D+  +G+ FKGLA SG+W CFDEFNRIEL VLSV AQQI  ++   +   +TF+F +G  + +N    + +TMNPGYAGR ELP+NLK+ FR V+MMVPD  +I  + L S GF+D   LA K  T Y+LC EQLS Q HYD+G+R + +VL   G  K   P + E+ ++ R + D+NL K +  D  LF  +I DLFPG+ L +  Y     A+ +   +  L     +  K+IQ YE   VRHG M +G    GKT  + +L +AM++  +  H E        +NPK+IT  Q+FG+ D  +++WTDGI +  +R+       +  W++ DGP+D +WIE++N+VLDDN+ L L +G+ I M+    ++FE  ++  ASPATVSR GM+++  S +GW P+   WL  +       N  E++  LF    +E  RF  ++ +  +      ++   +N++  ++ P  E+       +L    +  ++FA+ WS G LL+ + R+K +++FR   + +     IP    R E M       +DY+      G+W HW+   +               LVP +D  R  F+ID   +  ++++ +G  GT K+V  +   M++   +  +   +NFS+ T+    Q+ + S +D+R    +GPP GK   I +DD+NMP    +G Q   E++RQ  +   +Y+L+   + T IV  D+  + AM  PGGGRND+  R  R F++ + T  S+ ++ +IF  +   +   Q  F  +       +V  T  +++     +LPTPAK HY+FNLRD SR+  G+     E +        LW HE  RV  DR     D EW    L KL+++ + +  K+  D      F      P E   EE   S    D+  P      +VYE +++       +   + +YN++ + N M +V F+  + HL ++ RI+ +PGGNALLVGVGGSG+QSLTRLA+ +A   +FQ  +++ Y      EDLK+L + AG +GK   F+ TD++IK+ESFLE ++N+L++GEV NLF   E  E++  +    +        +   L+ +F++R R  LHVV+ FSP+G  FR R  +FPALI+ CT+DWF  WP+DAL  V+   L A D++    ++++ V+ +  F   V     ++F    R  +VTP SYL  I  ++T+   K+ E M        GL KL  A+E V+ +  +LE  + +L  A +  ++++ +++     S L + +  KVK + + + +   A KA+++E    L  A PALE A +AL T++P+DI  V+T+  PP  +   M+ + ++  R + P  +N   N    +   W  S  L+    FL+ L+++ KD I+   + ++ + +   P ++  +   ASS   GL  W  AM S+  + K V P K  LA  E+ L    L L + Q +L   + +L  ++ + ++   EKL L E+ + C +K++ A  LI GL GEK+RW + +    A    L+GDVLL+   ++Y GPF   +R   L +W    K   IP      +T  L +   +  WN+ GLP D  SI N +IV  A R+PL+IDPQ Q   WIKN E +  L +  L    F   LE ++  G P+L+E+VGEELDP L+ +L K   K      +++G+  ++  K F+LY+TTKL NP Y PEI+ + S+++F +T+ GLEDQLLG V+  EK E+E  R +L+     N+R +KE ED +L  L+ ++G+++++E+ I +L ++K  ++++ +K + A +TQ +I+AAR +Y P+A   +IL+F IT++  ++ MYQ SL+ F+ L+  S+  S+KS    +R++ + ++ T+ +Y    R L+E+ K LF+ LL  KI M   ++   E+L L+ GG  L+ K     PA  W+ D SW  +  L+ L +F    +  S + + W++++D + P++  +P+ + + LD F+ LL++RC  PD+ +     Y+++ +G+K+ E    D+  ++++S    PLI  LS G+DPT +++   +       +   +S+GQGQ   A +++ +    G W +LQNCHL +++M   M+ + E    E  N  FRLW+T+     FP+T+LQ  +K TNEPP GL+  L++++     DL+             + ++ +L+ + F H+ VQERRKFGP+GWNIPY FN +D   + + +Q  +++ +    V ++ ++Y+ GE  YGGRVTDD+D+R L T    ++N+++    +  F+    Y +P      +Y+ +I+ LP+   PEVFG+H N DIT + + ++ +LD++L I     +S GG + E  +S +A+D+L K+P     F++++ +   P+   + MN  L QE++R  ++   +R +L +L  AI G ++MS  L      +   +IPA W K S+ S   LG +  +L+ER    Q W  +G+P+ FW++GF+  Q FLT + Q  AR      +D +    EV K    ++   P  G Y+ GL+L+GA W+    +L E KPKVL+E +PVIW+  A+ +V+      Y CP+YK   R  +        N +  V L T +P  HWV RG ALLC +
Sbjct:  970 IDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQ---LDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPIT---AEGNVEVWLNALLKESQRSLHLVIRQA-ALAIQNEGFELID-FLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGI--MSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQP-HREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQR-----SPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLI-PLKEQCGELPREHL----ERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPP--GREETM-------FDYYV--TAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKS-FMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIV--DVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEES----DFDMP------KVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVMN------TGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEE---KLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETN---FITSSWQESLNLMTSGSFLSELKQFPKDTINEETV-ELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPA-EWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKI---ETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIE---TECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLD--------VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMF---ERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMK-SWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMY-AENNVVKDPR-LYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCDV 4112          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1592.02 bits (4121), Expect = 0.000e+0
Identity = 1098/3607 (30.44%), Postives = 1837/3607 (50.93%), Query Frame = 2
Query: 1280 YSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVK-ETTRLSKI--LLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDY----LLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPN-SGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF----DNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEG----LAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYW--EEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFREL----IIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKI-VLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKE-QVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLD-WSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGL-NVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDL--KEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNE-YEQ----VPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIM-----------DAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFD--LEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKW-FNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDG----AYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLD 11947
            Y  L+  +    I +F  +N S   Y   ++ F+ + Q++K     +  H+I +    L   L     +R+S +   LN+ A   ++E   + +KF  +Q+     P+T ++L  ++  + + R    + L  +IR + I+  Y    + D  E      ++ S +F   R++           +S+K   E     + E++ +  Q   +  + FN  G        + +  +   + +L +   +   +    +L  +  + +PEI  I+       Q++ +   +++++ KW    + +     ++  +D     L ++ K                                              L +     + + EF+  + ++  L    ++  HW+K+     +    N    +L  + ++ L  Y  +  +I  +A +E ++EM  K+ +     ++  L V +E  + +L +VD+I   LD+ ++K Q M GS F  PF   I+ WE+ L    ETI+ WL+VQ +W+ LE IF  EDI  Q+PEE +  + + + + +IM++T  +PN+ K     G L  L      LE+I K L  +L+ KR  FPRFF +S+DE+L +L    DP  +Q H+ K ++ I  L        +  + AM S+E E ++  + +   EAR  VE W++ V   M  + R +   +   Y      +W+  +   +VL  ++++WT EV  A++   +G    L  Y E+ ++QI E+V  +        R+ +  ++  DVHARD+V++   + ++  +DF W SQLR+YW  E ++  VR  N ++ Y YEY+G +GRL ITPLT R Y TL  A  + L GA  GPAG GKTET KDLAKAL + CVV +C++ +D I +GK   GLA  G W CFDEFNRI   VLSVV+ QI  I  A+  H + F FEG ++ L+++  + ITMNP Y  R ELP+++KV FRPV ++ PD   I EI L+S GF+ A+ LA K+   Y+    QLS Q HYD+G+ + K+VL  AG +K    + +E+++L+R++ D+NLPK +S D+P+F G+ISD+FPG+   +  +  F + V E+  K N   +    +K++Q YE+M+ +   M+VG+  GGK+ V++ L +A +             +Y  +NPK+ ++ +L+G FD  + +WTDGI +  FRE   +     ++++FDG +D+ W+E+MN+VLDDNK L L +G+ I++    +L+FE  DL  ASPATVSRC ++++ P  + + P +  W+ ++            ++ LFE  V  C+  V+ N + ++P   +++V  L  ++D++++      +V E           +L A+  S+G  L    R KFD   + L     +   ++   P EI       P    +YD+ ++ + +  W  W+ L             + L PT+DT R  +I++  V+ ++ ++ VG  GT K+   Q+ L N    D  +   +NFS++T++   Q+ + + +++R K  +GPPIGK  ++F DD+NMP  + +G Q P+ LLR   D G  YD K       ++D+  + AM   GGGRN+V PRFL  F+V ++   + +++  I+++++  + +   F +    V QT+ + TL+++ T I++L PTP+K HY F+ R+ SR+  G+ L K +        + R+W +E LR F+DRL +++D+     L+   IKK  +E F+   E +   P           ++FGDY       E RVYE++ + +    I +                 +F   +EHL+R+ RIL S  G+ALL+G  GS  Q+LT+LAA  A+  VF+  + + Y +  +R DLKTL  K G E + TVFL TD+ I +E FLE I+N+L    VP LF  +EK  +I+ +   ++A  + A  S  +++ +F+ +    LH+V+  S  G A +TR R FP + N   IDW+  W   AL  VA   LE   +        +  +   H S+ + S++      R NY T  S+L+ I+S+ TLL  +++E +   K     L++L  A E       +++EL  +L   K              +LA+         EEI     D ++ +S                                     PP  V++V E I ++R             GKK L+ W  +KK++ + GFL  L + D D+IS   ++ I+  F+ N +    ++   S A  G+ +++ +  SY  +AK V PKK ++ + E +  ++  +L   +  L  ++ + ++LK+K +D   EK    +E +L  ++L  A KL+ GL  E++ W +    L+  ++ L+GD L++A  ++Y G F   +R+  + D W+   K   IP S  F +   L N ++I +W   GLP D  S+ N ++     R+PL IDPQ QA  WIKN EK+  L  V  L D DF++ LE +I++GYP LL++V E++DP +  +L + V    G  ++ LG+  + Y   F+L++ T L NP Y P +  K  ++N+  TL GLEDQLL +     +   +     L+   + N+ +LK   D +L  L  S GN+L+N   IQ L+ +K  + + +KK   A+    +    R  Y P+A+  A+LFF+++D+  ++ MYQYSL+ +++L+  S+ +S     L +RL  + +  TY    NV   LF K KLLFS  +  KI  ++G +   E  FL+    G   K   P   W+ D++W +I +L +L  ++F         N   W++++D + P+ A  P  +   L +F+ LL+LRC+R D++  A+ +YV   +G   + PP  +    ++ S   +P++F++S G+DPT  L+KFAE     G+KF  I++GQGQ  +  +++ +A   G+W++LQNCHL V W+  +EK  E++T  N N  FR+W+T+     FP+ +LQ   K+  EPP  ++ N++ ++    IS+ +  + C  +   F  L++ L FFHA+VQER K+G  GW++P  FNDSD   S   L  ++ + +EQ    +P+++++YL GE  YGGR  D +DRR L   +D+++ + +             D  YK  P G      K  YTE    I+ +P I  PEV G+   V+I    Q    +   + +   +     G   +  +S IA DI  ++P  FD  L   E+   ++     + VL+QE+ RFNKL   +++S+  LL+A+ G V MS E + +A +     +PAMW + +  +LK L  +++ L  R      W   EG+P   W+SG +  +++L  V+Q   RK   P+D   F  EV  T +      D      Y++GLFL+GA W+ E   L   KPKVL   +P++ + P +++ +    N  + PVY TS R+            V    L T    SHWV  G  L    D
Sbjct:  835 YKLLLKMKVATEIERFAKKNPSCAMYDNKLQYFENLNQEVKQEVLCKTEHIIHVNMMPLVSSLRNIAESRISTLCSFLNKPA---KEELFILRDKFMQLQEKMHQRPDTFEDLKSILGTISDIR---DMSLDVEIRVADIKERYRMMAMYDELELVANIGQIWSNLFAESRQVD----------QSLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVGNDLEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQ------------------------------------------TLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWKRTKF---NMQPQLKVNQER-VFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPL-EAR--VEDWIMAVLQEMKRTSRLITKEAVYHYV-----DWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTL-------GLCTKLY-PLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR------------LNRLFEKYVPSCID-VTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSSAEVLE---------CYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEI-------PYLPTLYDFHFD-ETQEKWVPWSSLVPEYIHNPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNT-STDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGHTR--PFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDK----ALVHGHIKKLVEEYFETDSEAVLADP-----------ILFGDYRAAREECEQRVYEDIGDYDVSKAIFQ-----------------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNML-ISMVPTLFADDEKESIIKQIN--SEALQEGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFPLMSNT-VIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLL-EEKNEHVLQCKCLEGSLNRLREARE-------QIDELNLKLADQK-------------VVLAKKTATCTAFLEEI-----DKNQTIS----------------------------------FAKPPKQVQVVCECILVLR-------------GKKELN-WLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK--FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSERE-WTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEI-SWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTY----NVHNYLFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSGDGTKVQKPH-EWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMG-NCVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEK---SGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKIT--NPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSK--ISQ-QTLSSC--QHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGR-----KHVYTE----IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGTDLS---PTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEV--TRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLR-LRNTLRTPVYTTSLRRN-----ASGAGLVFEADLFTTMHTSHWVLSGVCLYLNSD 4176          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1545.79 bits (4001), Expect = 0.000e+0
Identity = 945/2763 (34.20%), Postives = 1518/2763 (54.94%), Query Frame = 2
Query: 3818 TPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMF-EGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCK-------GVIPTGSIHLVKNLLNL-IDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNL--SKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLK---DTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQE-FTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILG-ICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREW----LYKLLKESIKKHFKETFDV----LFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHK-NKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDME--DDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDIS---RESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIM--REIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAA--NPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTA-MEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSF---MNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQ---VPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVL-ITLGQLTXXXXXXXENQLSEIANDILGKMPAS---FDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFAR-KYTIPIDLLGFDFEVLKTSHMNV--QPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWL------KPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQL 11944
            T L   CY TL  A  + + GAP GPAGTGKTET KD+ + L    VVFNCSD +D+  +G+ FKGLA SG+W CFDEFNRIEL VLSV AQQI  ++   +   +TF+F +G  + +N    + +TMNPGYAGR ELP+NLK+ FR V+MMVPD  +I  + L S GF+D   LA K  T Y+LC EQLS Q HYD+G+R + +VL   G  K   P + E+ ++ R + D+NL K +  D  LF  +I DLFPG+ L +  Y     A+ +   +  L     +  K+IQ YE   VRHG M +G    GKT  + +L +AM++  +  H E        +NPK+IT  Q+FG+ D  +++WTDGI +  +R+       +  W++ DGP+D +WIE++N+VLDDN+ L L +G+ I M+    ++FE  ++  ASPATVSR GM+++  S +GW P+   WL  +       N  E++  LF    +E  RF  ++ +         +    I++++ L+ L + + +  HLE+                ++FA+ WS G LL+ + R+K +++FR   + +     IP    R E M       +DY+      G+W HW+   +               LVP +D  R  F+ID   +  ++++ +G  GT K+V  +   M++   +  +   +NFS+ T+    Q+ + S +D+R    +GPP GK   I +DD+NMP    +G Q   E++RQ  +   +Y+L+   + T IV  D+  + AM  PGGGRND+  R  R F++ + T  S+ ++ +IF  +   +   Q  F  +       +V  T  +++     +LPTPAK HY+FNLRD SR+  G +C     +    +    LW HE  RV  DR     D EW    L KL+++ + +  K+  D      F      P E   EE   S    D+  P      +VYE +++       +   + +YN++ + N M +V F+  + HL ++ RI+ +PGGNALLVGVGGSG+QSLTRLA+ +A   +FQ  ++++   +     LK+L + AG +GK   F+ TD++IK+ESFLE ++N+L++GEV NLF   E  E++  +    +        +   L+ +F++R R  LHVV+ FSP+G  FR R  +FPALI+ CT+DWF  WP+DAL  V+   L A D++    ++++ V+ +  F   V     ++F    R  +VTP SYL  I  ++T+   K+ E      R   GL KL  A+E V+ +  +LE  + +L  A +  ++++ +++     S L + +  KVK + + + +   A KA+++E    L  A PALE A +AL T++P+DI  V+T+  PP  +   M+ + ++  R + P  +N   N    +   W  S  L+    FL+ L+++ KD I+   + ++ + +   P ++  +   ASS   GL  W  AM S+  + K V P K  LA  E+ L    L L + Q +L   + +L  ++ + ++   EKL L E+ + C +K++ A  LI GL GEK+RW + +    A    L+GDVLL+   ++Y GPF   +R   L +W    K   IP      +T  L +   +  WN+ GLP D  SI N +IV  A R+PL+IDPQ Q   WIKN E +  L +  L    F   LE ++  G P+L+E+VGEELDP L+ +L K   K      +++G+  ++  K F+LY+TTKL NP Y PEI+ + S+++F +T+ GLEDQLLG V+  EK E+E  R +L+     N+R +KE ED +L  L+ ++G+++++E+ I +L ++K  ++++ +K + A +TQ +I+AAR +Y P+A   +IL+F IT++  ++ MYQ SL+ F+ L+  S+  S+KS    +R++ + ++ T+ +Y    R L+E+ K LF+ LL  KI M   ++   E+L L+ GG  L+ K     PA  W+ D SW  +  L+ L +F    +    + + W++++D + P++  +P+ + + LD F+ LL++RC  PD+ +     Y+++ +G+K+ E    D+  ++++S    PLI  LS G+DPT +++   +       +   +S+GQGQ   A +++ +    G W +LQNCHL +++M   M+ + E    E  N  FRLW+T+     FP+T+LQ  +K TNEPP GL+  L++++     DL+             + ++ +L+ + F H+ VQERRKFGP+GWNIPY FN +D   + + +Q  +++ +    V ++ ++Y+ GE  YGGRVTDD+D+R L T    ++N+++    +  F+    Y +P      +Y+ +I+ LP+   PEVFG+H N DIT + + ++ +LD++L I     +S GG + E  +S +A+D+L K+P     F++++ +   P+   + MN  L QE++R  ++   +R +L +L  AI G ++MS  L      +   +IPA W K S+ S   LG +  +L+ER    Q W  +G+P+ FW++GF+  Q FLT + Q  AR      +D +    EV K    ++   P  G Y+ GL+L+GA W+    +L E KPKVL+E +PVIW+         K+  I      Y CP+YK   R  +        N +  V L T +P  HWV RG ALLC +
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQP-HREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQR-----SPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQHLER---------------LYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPP--GREETM-------FDYYV--TAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKS-FMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIV--DVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEES----DFDMP------KVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEE---KLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETN---FITSSWQESLNLMTSGSFLSELKQFPKDTINEETV-ELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPA-EWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKI---ETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIET---ECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLD--------VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMF---ERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCDV 2686          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1484.93 bits (3843), Expect = 0.000e+0
Identity = 1017/3238 (31.41%), Postives = 1658/3238 (51.20%), Query Frame = 2
Query: 2399 IHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISIL---ASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAA----DFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLD-IHAMFSSENEKIKMSQVISTSEARGAVERWL----LQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEAL-----ERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEEN--ALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMF-EGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKN--LSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLK---DTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREW----LYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRS-------LMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHK-NKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDAL-ERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIM--REIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGG-VGLENKAANPATSWLSDKSWDEICRLNDLKEFKG-FKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDK-IVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTA-MEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSF--MNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQ---VPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVL-ITLGQLTXXXXXXXENQLSEIANDILGKMPAS---FDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFAR-KYTIPIDLLGFDFEVLKTSHMNV--QPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQL 11944
            I EF E  P++  +    +  RHW +++                                I  +A +E  +E  +K++  EW+   F+   ++  G  +L   ++ + I  L D  +V    M  S +  PF+ +I+ W + L +T + I+ W+ VQ  W+YLE +F   DI +Q+P+E +LF ++D++W  IM      PNV+++         +L  L E    L+   K L  YLEKKRL FPRFFF+S+  +LEIL +  D   +Q HL   F+ I  ++F  K D I A+ S E E +++ + I+   A G VE WL     + Q  + + IR   A + +   FE  D ++  ++ QV L   Q+ WT +  EAL     +RG+  ++  ++     ++ ++ +    L A +R     L+TI VH RD+ +D+CR  +++ +DF WL Q R+Y+ E++    + +T+ +  Y  E+LG + RLVITPLTD                           ET KD+ + L    VVFNCSD +D+  +G+ FK LA SG+W CFDEFNRIEL VLSV AQQI  ++   +   +TF+F +G  + +N    + +TMNPGYAGR ELP+NLK+ FR V+MMVPD  +I  + L S GF+D   LA K  T Y+LC EQLS Q HYD+G+R + +VL   G  K   P + E+ ++ R + D+NL K +  D  LF  +I DLFPG+ L +  Y     A+ +   +  L     +  K+IQ YE   VRHG M +G    GKT  + +L +AM+    + H E        +NPK+IT  Q+FG+ D  +++WTDGI +  +R+       +  W++ DGP+D +WIE++N+VLDDN+ L L +G+ I M+    ++FE  ++  ASPATVSR GM+++  S +GW P+   WL       +  N  E++  LF    +E  RF  ++ +  +      ++   +N++  ++ P  E+       +L    +  ++FA+ WS G LL+ + R+K +++FR   + +     IP    R E M       +DY+   +   +W HW+   +               LVP +D  R  F+ID   +  ++++ +G  GT K+V  +   M++   +  +   +NFS+ T+    Q+ + S +D+R    +GPP GK   I +DD+NMP    +G Q   E++RQ  +   +Y+L+   + T IV  D+  + AM  PGGGRND+  R  R F++ + T  S+ ++ +IF      +   + F  +       +V  T  +++     +LPTPAK HY+FNLRD SR+  G+     E +        LW HE  RV  DR     D EW    L KL+++ + +  K+  D   E            + LR            D+  P      +VYE +++       +   + +YN++ + N M +V F+  + HL ++ RI+ +PGGNALLVGVGGSG+QSLTRLA+ +A   +FQ  ++  Y      EDLK+L + AG +GK   F+ TD++IK+ESFLE ++N+L++GEV NLF   E  E++  +    +        +   L+ +F++R R  LHVV+ FSP+G  FR R  +FPALI+ CT+DWF  WP+DAL E     +   +D    ++++ V+ +  F   V     ++F + G +     +   E + +    L  K+ E              L  A E+ +DM +K      ++    +A+EL+ V++ +    A+     + A++ I  EK +A++   +E                +AL T++P+DI  V+T+  PP  +   M+ + ++  R + P  +N   N    +   W  S  L+    FL+ L+++ KD I+   + ++ + +   P ++  +   ASS   GL  W  AM S+  + K V P K  LA  E+ L    L L + Q +L   + +L  ++ + ++   EKL L E+ + C +K++ A  LI GL GEK+RW + +    A    L+ DVLL+   ++Y GPF   +R   L +W    K   IP      +T  L +   +  WN                                             L +  L    F   LE ++  G P+L+E+VGEELDP L+ +L K   K      +++G+  ++  K F+LY+TTKL NP Y PEI+ + S+++F +T+ GLEDQLLG V+  EK  L D  + LI+   N ++  +E   ++           +  +T IQ                         I+AAR +Y P  R S IL+F IT++  ++ MYQ SL+ F+ L+  S+  S+KS    +R++ + ++ T+ +Y    R L+E+ K LF+ LL  KI M   ++   E+L L+ G  + L+     PA  W+ D SW  +  L+ L +F     +  S + + W++++D + P++  +P+ + + LD F+ LL++RC  PD+ I      Y+++ +G+K+ E    D+  ++++S    PLI  LS G+DPT +++   +       +   +S+GQGQ   A +++ +    G W +LQNCHL +++M   M+ + E    E  N  FRLW+T+     FP+T+LQ  +K TNEPP GL+  L++++    DL+             + ++ +L+ + F H+ VQERRKFGP+GWNIPY FN +D   + + +Q  +++ +    V ++ ++Y+ GE  YGGRVTDD+D+R L T    ++N+++    +  F+    Y +P      +Y+ +I+ LP+   PEVFG+H N DIT + + ++ +LD++L I     +S GG + E  +S +A+D+L K+P     F+++  E    +   + MN  L QE++R  ++   +R +L +L  AI G ++MS  L      +   +IPA W K    +   LG +  +L+ER    Q W  +G+P+ FW++GF+  Q FLT + Q  AR      +D +    EV K    ++   P  G Y+ GL+L+GA W+    +L E KPKVL+E +PVIW+  A+ +V       Y CP+YK   R  +        N +  V L T +P  HWV RG ALLC +
Sbjct: 1197 IDEFSECCPLLELMTSKAMMARHWKRITE------------------------------DICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLM--SNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQ---LDSCQKSL-TYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRILAVSSREKETMELDRPIT---AEGNVEVWLNALLKESQRSLHLVIRQA-ALAIQNEGFELID-FLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGI--MSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT--CGQPHREMR------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRK-TLKAKKEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQ-----RSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLI-PLKEQCGELPREHL----ERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPP--GREETM-------FDYYVTAE---HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMK-SFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIV--DVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFV--------DFLRDPPEATEEPEESDFDMP------KVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVESHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFMNTGLQKLKEAS---ESVAALSKELEVKEKE--------------LQIANEK-ADMVLK------EVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAE--------------AALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETN---FITSSWQESLNLMTSGSFLSELKQFPKDTINEETV-ELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWN---------------------------------------------LQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKRSLVDD-ESLIVVLGNTKQTAEEVNQKLQ----------IAGDTQIQ-------------------------INAAREEYRPATRGS-ILYFLITEMSMVNVMYQTSLTQFLGLFDLSLA-SSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCPQKPA-EWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKI---ETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIE---TECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGINQDLLD--------VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMF---ERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMY-AENNV--KDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCDV 4158          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 7972.46 bits (20685), Expect = 0.000e+0
Identity = 3956/3963 (99.82%), Postives = 3962/3963 (99.97%), Query Frame = 2
Query:   62 MPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            MPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALH+EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTID+IINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLI+ELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEG+DEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCV+ECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWS LCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPA+SWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD
Sbjct:    1 MPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHHEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDAIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLIAELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGNDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVDECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSTLCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPASSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 3963          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 7953.97 bits (20637), Expect = 0.000e+0
Identity = 3956/4010 (98.65%), Postives = 3962/4010 (98.80%), Query Frame = 2
Query:   62 MPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDS-----------------------------------------------NKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            MPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALH+EGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTID+IINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLI+ELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEG+DEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCV+ECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWS LCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDS                                               NKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPA+SWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD
Sbjct:    1 MPRNLPPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQYPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDFSQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHHEGAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIFNERKSVPKIEQDLKESFYNCTTILLSNQIKNLLGRTVEAWVDIFEEGNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDAIINSNPQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLIAELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAERDREKKKKTRTDTDEPLPPPEEDDTPKPPAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVDDIQQLLDDQIVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGNDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVDECLRFVSKNCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAENRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKNESFPIPKEINRFEVMLPETGLVYDYFYEHKVRGYWHHWNDLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRADLAEAIPALEAALSALDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSTLCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGEELDPSLEPLLLKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILKKQETAEETQKKIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKILERRSRYLKDHFQYSIYENVCRSLFARDKLLFSFKLCADLMINKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPASSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 4010          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3976.02 bits (10310), Expect = 0.000e+0
Identity = 2068/4005 (51.64%), Postives = 2757/4005 (68.84%), Query Frame = 2
Query:   77 PPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQ--YPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDF-SQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNE-GAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNLLGRTVEAWVDIFEE----GNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSN---------PQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNEN---HSFDEYGEYIEKFQVIAQKIKCLPNVEY-FHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSK-NCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAE--NRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKN-----------ESFPIPKEINRFEVMLPETGLVYDYFY--EHKVRGY--WHHWNDLNKNL-SKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNK--DADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKL-DSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            PP +    K +D   + ++L K       +R+K  K L+D  +  E +   +       PP  Q   P  M + E+ I   YY++ + +    +  M++ W+ N+K+ +   LK    + ++++  E+K+++  S+K+++V   LK+P     E+DD  P PE    L    + W  SF+   +   K L +  P M ++L L + +F    + DV     +  A++ +  + T     E   + +MK W   V NI+   N++K VP ++     E F+NC + L+++ ++NL   ++  + ++        N    P   + L  +   ++F P+ +D E L+  + + + + +  +  I+S + S+           P+ +P ++  H     K  +R+        P E+ K   +  Y  LIN E +  I   L+E    HSF+E+ +Y++ +  + +KI+          +  L+C++L   L K    + + LL+RV + HR+ N E+ +++E I + A  +P  ++++ +LI ++ +     M+ L +K+  S  RL +L+D   F+  D+ LN  VF    ++  IFD N K  E  K + +  L  +RE+ I EL  ++ +V+EF   G+M+   + +Y++  + L +KL+ A   +   N EEE F    + +P  +E++    P+++L++  +++    + W+ G    ++ D+++A+V   YR LFK++KQF N   K + +K                                   I +K   ++ EFKE +P+I  L  PG++ RHW ++S I    +    G  L+K++ M L+ ++ +F  IS AA +EF LE  M+KM+ EW  +EF +  YRE+G  IL+SVDDIQ +LDD IVKTQTMRGSPFIKPFE EIK WE KL+   + +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F +VD+ WK+IM+  + D  V+       +L++LK+SN LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSENE + +  VISTS+ARG VE+WLL+++  M+ S+R  I+     Y    R EWV +W GQ VL +S  YWT+ V +A++ G E L  Y +  N QI EIV LVRG+L+ Q R TL AL+ +DVHARDV+ ++ +++V +ENDF WL QLRYYW E N + ++ N+ +KY YEYLGN+ RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL I RAI    +T MFEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYA+I EISLYS GF++AR LAVKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYPDE+E+IL+LRSI+DVNLPKFL+HD+PLF GI SDLFPGV  P  DY +  K + E C K NL++  FF EKI Q YEMMIVRHGFM+VGEPFGGKT    VLA A+  + E+G  E  KV Y  +NPK+ITMGQL+GQFD VSHEW+DG+ A ++R FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+Y++P+S+GWRP+F+SWL   P  +  D   +M   +FE  ++  +  + K   K + PT  I++VK+LLNLID  +    ++  +++   R++  W +  + FA  WSIG   + + R+ FD   REL+ G             E+ P P  +  ++ + P  G +YDY +  E +  G+  W HW++L K   S  +     E +VPT DT +Y +++++ + H +  +FVGPTGTGKS Y  D L+N++  D Y P+ +NFSAQTSANQTQ IIMSKLDRRRKGVFGPP+GK  ++FVDD+NMP +E YGAQPPIELLRQ+ DH NWYDLKDTT I L D+  +GAMGPPGGGRN +TPRFLRH N +++  F D+TMI IFS++++ ++  Q F+ D+      ++QATL+VYK+A++NLLPTPAKSHY+FNLRDFSRVI G+ L     +E+     RLW HE+ RV+YDRL+ D DREW +  ++E   KH  E FD+LF+HL    +  V E+ +RSL++ D+   DA   ++ Y EV ++      VE  +DEYN   K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQSLTRLAA+MA+  +FQ EISK+Y   EWREDLK +L+K+       VFL +D+QIK ESFLEDI+NLLN GEVPNL+  +EK EV E +RQ  +  +K    D SP+AL+ FFV R R++LH+V+A SPIG AFR RLR+FP+L+NCCTIDWFQ WPEDAL  VA + LE V+++  +++  + + K FHTS   LSE++   L R NYVTPTSYLELI++F+ LL+ K+ E  + K+RY  GL+KL  AA  +S MQ +L + QP+LV+A K  +  M+ + ++S  A  Q   VK EE I N++A A++A+ +EC  DLAEAIP LE+AL AL+TL PADITIV+TM +PP GV+LVME +C+++ IKP+RVNDP+  GKK+ D+WGPSK+LLG+M FL  L+ +DKDNI  PIM  IR++++TN +F P +++ AS+A EGLC+W+ A+E YD+VAKVVAPKKI L +A ++    M  LN+ +  L+ V+DKL  L ++L+  +  K+ L+ +V+LC+KKL RA++LIGGLGGEKDRW QAA +L   + NL GD+LLS+GV+AYLG FTS +R +    W        IPCS KFSL   LG+PV+I++WNI+GLP D FSI+N +I++N+RRWPLMIDPQ QANKWIKNMEK+  L VIKLTD DF+R LEN IQFG PVLLEN+GEELDP LEPLLLKQ FKQ G   ++LG+SIIEYS +FR YITTKLRNPHYLPE +VKV+LLNFMIT EGL+DQLLGIVV++E+PELE+ + +LI  SANN++ LKE ED IL  LS SEGNILE+E+AI++L+SSK +S++I +KQ   EET++KID AR+ Y PIA HS ILFFSI DL NIDPMYQYSL+WF+NL+  SI +S KS+ L +RL+ L  +FTYSLY NVCRSLFEKDKLLFSF+LCS IL     ++  E+ FLLTGGVGL+N   NP ++WL  KSWDE+CRL+DL  F G ++ F    + W+  YDS +P + ++PD W  +L DSF  + VLRC+RPDKIV AI N+V+E++GKK+IEPPPFDL  SF DS C +PL+F+LSPGADP  ALLKFA+D+GFGG KF S+SLGQGQGPIA +MI    +EGTWV+LQNCHLA SWM  +EK  EE+ PE T+ +FRLWLTSYPS  FPV +LQNGVKMTNEPP GLR N+ +S+++D IS+ EFF G     S ++KLLFGLCFFHA+VQERRKFGP+GWNI Y FN++DLRIS +QL MF+++Y+ V +DA++YLTGECNYGGRVTDDWDRR L+TIL  FY   V  D  YKF  SG Y  PP ++Y  YIE+IK LP    P VFGMH+N DIT++ Q+++LL DS+L+T  + +S GG S+++ + E++ D+L ++P +FD E     YP  Y +SMNTVLVQEM RFN L + IR SLQN+ KAIKGLVVMS +LE +  S+L  KIP MW K SYPSLKPLGSY+ND + RL FL  WF+ G P  FW+SGFYFTQAFLTGV QN+ARKYTIPIDLL FD+E+L   + +  P DGAY+ GLFLDGARW+ +   + E  PKVL + +PVIWLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LPT++P  HW+ RG ALLCQLDD
Sbjct:   67 PPTKPRKLKGEDLAFERSQLRK-------DREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREK--ETDD-TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKH-----KSTVRNVLIDESVGPTEHIKEFDK--YRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNE--INKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFEN---KPIPKK-----------------------------------IATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAI-TDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPP--LQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENP-SAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPS-YLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4006          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3970.62 bits (10296), Expect = 0.000e+0
Identity = 2070/4028 (51.39%), Postives = 2758/4028 (68.47%), Query Frame = 2
Query:   77 PPIEEGSTKSQDKDPKSNKLLKKFRMSDENRKKLHKLLIDQAVNVEQKIYDQFCTVPPKPPAPQ--YPSCMMSEERLIRMNYYFLKSCVQNSPIPPMQEKWLQNIKDKISVHLKKGRDKEMDEILIEVKQNFYDSMKRSLVQMSLKKPNVPGLESDDLVPFPEEPIGLDF-SQEWHPSFVKNREELSKKLMILYPHMQKLLSLCNTTFGETLVTDVYALHNE-GAMDFEALRTTVQLDCEKHDDNMMKVWYPKVINIF---NERKSVPKIEQDLK-ESFYNCTTILLSNQIKNL--------------LGRTVEAWVDIFEE-------------GNAKFLPILKMYLNFDSNQMQFYPNYDDLEELIYFIINCITQSMQKIPTIDSIINSN---------PQPVFIPALLANHILAYAKERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNEN---HSFDEYGEYIEKFQVIAQKIKCLPNVEY-FHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIPKSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLNQIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGKLNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYWEEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLASKPEVLKKDNGLEMMDILFEWCVNECLRFVSK-NCKGVIPTGSIHLVKNLLNLIDMIMKPHLEKEDVAE--NRNLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFRELIIGKN-----------ESFPIPKEINRFEVMLPETGLVYDYFY--EHKVRGY--WHHWNDLNKNL-SKGEGKNIREFLVPTMDTARYKFIIDMCVEHRQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYMKGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKKEQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIPEDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNK--DADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTACLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETGLNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKL-DSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENTNTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKWFNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNVQPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPTEEPVSHWVKRGTALLCQLDD 11950
            PP +    K +D   + ++L K       +R+K  K L+D  +  E +   +       PP  Q   P  M + E+ I   YY++ + +    +  M++ W+ N+K+ +   LK    + ++++  E+K+++  S+K+++V   LK+P     E+DD  P PE    L    + W  SF+   +   K L +  P M ++L L + +F    + DV     +  A++ +  + T     E   + +MK W   V NI+   N++K VP ++     E F+NC + L+++ ++NL                R +E+   +  +              N    P   + L  +   ++F P+ +D E L+  + + + + +  +  I+S + S+           P+ +P ++  H     K  +R+        P E+ K   +  Y  LIN E +  I   L+E    HSF+E+ +Y++ +  + +KI+          +  L+C++L   L K    + + LL+RV + HR+ N E+ +++E I + A  +P  ++++ +LI ++ +     M+ L +K+  S  RL +L+D   F+  D+ LN  VF    ++  IFD N K  E  K + +  L  +RE+ I EL  ++ +V+EF   G+M+   + +Y++  + L +KL+ A   +   N EEE F    + +P  +E++    P+++L++  +++    + W+ G    ++ D+++A+V   YR LFK++KQF N   K + +K                                   I +K   ++ EFKE +P+I  L  PG++ RHW ++S I    +    G  L+K++ M L+ ++ +F  IS AA +EF LE  M+KM+ EW  +EF +  YRE+G  IL+SVDDIQ +LDD IVKTQTMRGSPFIKPFE EIK WE KL+   + +D+WLKVQA WLYLEPIFSS DIM QMPEEGR F +VD+ WK+IM+  + D  V+       +L++LK+SN LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGIA L F   LDI  M SSENE + +  VISTS+ARG VE+WLL+++  M+ S+R  I+     Y    R EWV +W GQ VL +S  YWT+ V +A++ G E L  Y +  N QI EIV LVRG+L+ Q R TL AL+ +DVHARDV+ ++ +++V +ENDF WL QLRYYW E N + ++ N+ +KY YEYLGN+ RLVITPLTDRCYRTL GA HL+L GAPEGPAGTGKTETTKDLAKA+A QCVVFNCSDGLDYIA+GKFFKGLAS GAW+CFDEFNRI+LEVLSVVAQQIL I RAI    +T MFEGTEL+L+  C V ITMNPGYAGRSELPDNLK LFR VAMMVPDYA+I EISLYS GF++AR LAVKIV TYRLCSEQLSSQ HYDYGMRAVK+VL+AAGNLKLKYPDE+E+IL+LRSI+DVNLPKFL+HD+PLF GI SDLFPGV  P  DY +  K + E C K NL++  FF EKI Q YEMMIVRHGFM+VGEPFGGKT    VLA A+  + E+G  E  KV Y  +NPK+ITMGQL+GQFD VSHEW+DG+ A ++R FA++ TPDRKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQ+S   +LIFE MDL  ASPATVSRCGM+Y++P+S+GWRP+F+SWL   P  +  D   +M   +FE  ++  +  + K   K + PT  I++VK+LLNLID  +    ++  +++   R++  W +  + FA  WSIG   + + R+ FD   REL+ G             E+ P P  +  ++ + P  G +YDY +  E +  G+  W HW++L K   S  +     E +VPT DT +Y +++++ + H +  +FVGPTGTGKS Y  D L+N++  D Y P+ +NFSAQTSANQTQ IIMSKLDRRRKGVFGPP+GK  ++FVDD+NMP +E YGAQPPIELLRQ+ DH NWYDLKDTT I L D+  +GAMGPPGGGRN +TPRFLRH N +++  F D+TMI IFS++++ ++  Q F+ D+      ++QATL+VYK+A++NLLPTPAKSHY+FNLRDFSRVI G+ L     +E+     RLW HE+ RV+YDRL+ D DREW +  ++E   KH  E FD+LF+HL    +  V E+ +RSL++ D+   DA   ++ Y EV ++      VE  +DEYN   K  M+LV+FR+ +EH+SRI RIL  P  +ALLVGVGGSGRQSLTRLAA+MA+  +FQ EISK+Y   EWREDLK +L+K+       VFL +D+QIK ESFLEDI+NLLN GEVPNL+  +EK EV E +RQ  +  +K    D SP+AL+ FFV R R++LH+V+A SPIG AFR RLR+FP+L+NCCTIDWFQ WPEDAL  VA + LE V+++  +++  + + K FHTS   LSE++   L R NYVTPTSYLELI++F+ LL+ K+ E  + K+RY  GL+KL  AA  +S MQ +L + QP+LV+A K  +  M+ + ++S  A  Q   VK EE I N++A A++A+ +EC  DLAEAIP LE+AL AL+TL PADITIV+TM +PP GV+LVME +C+++ IKP+RVNDP+  GKK+ D+WGPSK+LLG+M FL  L+ +DKDNI  PIM  IR++++TN +F P +++ AS+A EGLC+W+ A+E YD+VAKVVAPKKI L +A ++    M  LN+ +  L+ V+DKL  L ++L+  +  K+ L+ +V+LC+KKL RA++LIGGLGGEKDRW QAA +L   + NL GD+LLS+GV+AYLG FTS +R +    W        IPCS KFSL   LG+PV+I++WNI+GLP D FSI+N +I++N+RRWPLMIDPQ QANKWIKNMEK+  L VIKLTD DF+R LEN IQFG PVLLEN+GEELDP LEPLLLKQ FKQ G   ++LG+SIIEYS +FR YITTKLRNPHYLPE +VKV+LLNFMIT EGL+DQLLGIVV++E+PELE+ + +LI  SANN++ LKE ED IL  LS SEGNILE+E+AI++L+SSK +S++I +KQ   EET++KID AR+ Y PIA HS ILFFSI DL NIDPMYQYSL+WF+NL+  SI +S KS+ L +RL+ L  +FTYSLY NVCRSLFEKDKLLFSF+LCS IL     ++  E+ FLLTGGVGL+N   NP ++WL  KSWDE+CRL+DL  F G ++ F    + W+  YDS +P + ++PD W  +L DSF  + VLRC+RPDKIV AI N+V+E++GKK+IEPPPFDL  SF DS C +PL+F+LSPGADP  ALLKFA+D+GFGG KF S+SLGQGQGPIA +MI    +EGTWV+LQNCHLA SWM  +EK  EE+ PE T+ +FRLWLTSYPS  FPV +LQNGVKMTNEPP GLR N+ +S+++D IS+ EFF G     S ++KLLFGLCFFHA+VQERRKFGP+GWNI Y FN++DLRIS +QL MF+++Y+ V +DA++YLTGECNYGGRVTDDWDRR L+TIL  FY   V  D  YKF  SG Y  PP ++Y  YIE+IK LP    P VFGMH+N DIT++ Q+++LL DS+L+T  + +S GG S+++ + E++ D+L ++P +FD E     YP  Y +SMNTVLVQEM RFN L + IR SLQN+ KAIKGLVVMS +LE +  S+L  KIP MW K SYPSLKPLGSY+ND + RL FL  WF+ G P  FW+SGFYFTQAFLTGV QN+ARKYTIPIDLL FD+E+L   + +  P DGAY+ GLFLDGARW+ +   + E  PKVL + +PVIWLKP K+  I    + Y  P+YKTSER+G LSTTGHSTNFV+ + LPT++P  HW+ RG ALLCQLDD
Sbjct:   67 PPTKPRKLKGEDLAFERSQLRK-------DREKFRKALVDMILQGEDRPIKESIETVRLPPLTQEKTPVGMSATEKDILRYYYYIHNGIDTEHVAKMEDDWMNNMKNLLDNDLKAEHPELLEDLEDEIKEDYLLSVKKAIVDFVLKEPREK--ETDD-TPIPEHRKELSVVPKPWCRSFINAYKFCQKHLYVTNPCMNQVLELWDISFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNKKKLVPSVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPEIIEKH-----KSTVRNVLIDESVGPTEHIKEFDK--YRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQNLGDMNE--INKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFEN---KPIPKK-----------------------------------IATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPDEDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKVLPPAI-TDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQMDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPP--LQDYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKDSISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDF--SDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKIRQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENP-SAWLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELNPETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFF-GTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPS-YLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4029          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000013737.1 (SMESG000013737.1)

HSP 1 Score: 3055.39 bits (7920), Expect = 0.000e+0
Identity = 1635/3432 (47.64%), Postives = 2251/3432 (65.59%), Query Frame = 2
Query: 1202 KERLRSSATRCFEEPKEYFKNIYEIPYSYLINGEEEANITKFLNENHSFDEYGEYIEKFQVIAQKIKCLPNVEYFHLIRLECEDLKDGLVKETTRLSKILLNRVAQDHRKENIEISEKFENIQQHAETVPETSQELYDLIAYMEEARCQGMIGLSEKIRTSKIRLDYLLDNHEFSPEDLKLNSEVFTWIRKIQPIFDHNDKIQESVKSKNEAILLQRREKLISELQKHKVRVDEFNEFGEMDSEMMKQYVQDVRTLQSKLKEARQEMSWINIEEELFKIP-KSLFPEIEEIKAQSDPFMQLFQLVMKYQKSERKWLHGEFNDLKADKIEAEVDEIYRELFKIQKQFNNQHKKALMEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALEICSKTLN-QIHEFKEKIPVIACLCKPGIKKRHWDKMSSIANRDITPNSGTSLAKVLAMGLDSYMEEFAQISAAASREFTLEMNMKKMREEWETVEFSLTVYRESGISILASVXXXXXXXXXXXVKTQTMRGSPFIKPFETEIKIWEEKLLHTLETIDQWLKVQAQWLYLEPIFSSEDIMQQMPEEGRLFQAVDRNWKDIMRNTVRDPNVMKAADFSGILERLKESNGLLEKINKGLNAYLEXXXXXXXXXXXXSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFDNKLDIHAMFSSENEKIKMSQVISTSEARGAVERWLLQVQDVMLMSIRDVIAASREAYCFEARDEWVCEWAGQVVLCVSQIYWTLEVHEALERGVEGLAIYHEKCNKQISEIVKLVRGK-LNAQQRITLGALVTIDVHARDVVEDMCRKRVESENDFNWLSQLRYYW--------EEENALVRLTNATVKYAYEYLGNSGRLVITPLTDRCYRTLIGAYHLNLNGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYIAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIIRAIQGHVETFMFEGTELRLNENCYVCITMNPGYAGRSELPDNLKVLFRPVAMMVPDYAMIGEISLYSYGFMDARSLAVKIVTTYRLCSEQLSSQSHYDYGMRAVKAVLSAAGNLKLKYPDENENILLLRSIMDVNLPKFLSHDIPLFRGIISDLFPGVVLPQADYTLFLKAVGEVCAKHNLQTVDFFTEKIIQSYEMMIVRHGFMLVGEPFGGKTQVLHVLAEAMSKLNEEGHDEFEKVIYRTINPKSITMGQLFGQFDAVSHEWTDGITANTFREFASNDTPDRKWVIFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSKVMSLIFETMDLSQASPATVSRCGMIYLQPSSMGWRPMFHSWLAS-KPEVLKKDNGLEMMDILFEWCVNECLRFVSKNCKGVIPTGSIHLVKNLLNLI-------------------------------DMIMKPHLEKEDVAENR-NLKIWFQSAWLFAMPWSIGGLLDYDSRQKFDVFFR---ELIIGKNESFPIPKEIN-RFEVMLPETGLVYDYFYEHKVRGYWHHWN------DLNKNLSKGEGKNIREFLVPTMDTARYKFIIDMCVEH-RQSLMFVGPTGTGKSVYTQDKLMNELPADRYVPSFVNFSAQTSANQTQQIIMSKLDRRRKGVFGPPIGKCAVIFVDDMNMPAKEIYGAQPPIELLRQYFDHGNWYDLKDTTKIVLQDIYLMGAMGPPGGGRNDVTPRFLRHFNVVSMTTFSDDTMIRIFSTLMSIYM-KGQEFTSDYLAVGQTMVQATLEVYKTAISNLLPTPAKSHYVFNLRDFSRVILGICLIKK------EQVEDKRTYTRLWVHEVLRVFYDRLIEDSDREWLYKLLKESIKKHFKETFDVLFEHLTTTPNEPVKEEHLRSLMFGDYMNPDAIP-------------EDRVYEEVKNINEFYPIVEQCMDEYNNTHKNKMSLVIFRYVLEHLSRICRILLSPGGNALLVGVGGSGRQSLTRLAAAMANQVVFQPEISKNYGKQEWREDLKTLLKKAGGEGKATVFLMTDSQIKDESFLEDIDNLLNTGEVPNLFTAEEKGEVIELVRQAAQAGNKDADFSPLALFAFFVNRCREKLHVVMAFSPIGSAFRTRLRQFPALINCCTIDWFQAWPEDALERVALKALEAVDMEDDMRNDTVKIVKHFHTSVINLSEEFFKSLGRKNYVTPTSYLELINSFRTLLNSKQDETMRGKKRYVNGLDKLAFAAEQVSDMQIKLEELQPQLVQAKKANELLMVDISRESILAEDQRLKVKAEEEIVNEKADASKALSDECRXXXXXXXXXXXXXXXXXDTLRPADITIVKTMQNPPAGVKLVMEGICIMREIKPERVNDPNNPGKKMLDYWGPSKKLLGDMGFLTYLREYDKDNISTPIMTKIRKEFITNPEFDPIKVSRASSAAEGLCRWILAMESYDRVAKVVAPKKIKLAQAESDLKENMLKLNETQKQLQYVEDKLTNLKQKLKDTEDEKLRLQEEVELCAKKLERAKKLIGGLGGEKDRWAQAAVNLQAIYDNLIGDVLLSAGVIAYLGPFTSVYRDKCLLDWSALCKSYKIPCSVKFSLTA--CLGNPVKIQAWNIFGLPRDSFSIDNSVIVANARRWPLMIDPQNQANKWIKNMEKETG-LNVIKLTDNDFMRTLENAIQFGYPVLLENVGXXXXXXXXXXXXKQVFKQNGVDMLRLGESIIEYSKEFRLYITTKLRNPHYLPEIAVKVSLLNFMITLEGLEDQLLGIVVAKEKPELEDARQELIITSANNRRMLKETEDRILATLSESEGNILENETAIQILDSSKAISDDILXXXXXXXXXXXXIDAARMDYAPIARHSAILFFSITDLPNIDPMYQYSLSWFVNLYINSIHDSNKSKLLDKRLRYLSDHFTYSLYSNVCRSLFEKDKLLFSFLLCSKILMSKGDLESTEYLFLLTGGVGLENKAANPATSWLSDKSWDEICRLNDLKEFKGFKESFSANLEGWRAFYDSKDPQDAKMPDPWGTKLDSFKHLLVLRCIRPDKIVPAITNYVKEKLGKKFIEPPPFDLARSFQDSQCCAPLIFVLSPGADPTMALLKFAEDKGFGGSKFNSISLGQGQGPIAAQMISEAKREGTWVMLQNCHLAVSWMTAMEKICEEMTPENT--NTEFRLWLTSYPSPKFPVTVLQNGVKMTNEPPTGLRQNLQQSFMNDLISEPEFFNGCPGKESTFEKLLFGLCFFHALVQERRKFGPMGWNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVP-PKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTXXXXXXXENQLSEIANDILGKMPASFDLEKAEIAYPVTYNESMNTVLVQEMERFN 11254
            KE+LR       E P +Y   IY   + YL+N   E +  +F+N +    +Y   +EK + ++ +   LP     HL  L+CE +   L+  + +L  I LN +    R  N  I  ++++I +      ET+ +L +L  Y+E+ R   +I L  K+  +   + +LL+      +D+ LN+  FTW  +I PI D +       + +    L + +++ +  L   K ++ EFN+  +++  +  +  Q++  +  KL E  +E   IN EE L     ++ + +++EI    +PF +L++  + + K   KW++G   ++ A+++EAE   +++  +++ K F++   K  M                                      C+ T+  ++ +FK  +P+I  LC PG+K+RHWD MS+    DITP   T L+ +LAMGLD ++E+  ++S+ AS+EF+LE    +M+ +W+ + FS T Y+E+G++IL +VDDIQ LL+D IVKT TMR SPFI PFE+EI  W++ L    + ++ WLKVQA WLYLEPIF S DI +Q+P EG  F+ VD  W+ IM     D  VM    F  +LE L+ S  LLE+I KGLN YLEKKRL+FPRFFFLSN+E+LEILSETKDPLRVQPHLKKCFEGI+KL+F  +  I  M S+E+E++K +  I   EA G VE+W+LQV+  M  S+RDV+  +   Y   +R +WV +W GQVVL  S ++WT +   A++     L  + +K ++QIS IV+LVR + L +  RITL A + +DVHARDVV  +    V SE+DFNW+SQ+RYYW          +N ++R+    V Y YEYLGN+ RLVITPLTDRCYRTL+GA  LNL GAPEGPAGTGKTET+KDLAKA+A QCVVFNCSDGLDY +MGKFFKGLA SGAWACFDEFNRIELEVLSV+AQQI  I RAI+  +E F+FEGTELRL+++C + ITMNPGYAGRSELPDNLKVLFR VAMMVPDYA+I EISLYS GF++AR+LA KIV  YRLCSEQLSSQ HYDYGMRAVK+VL+AAG LK K     E  ++L+SI+DVNLPKFL  DIPLF GIISDLFPGV  P  DY    + + E      L+ V +F +KIIQ YEM++VRHG M+VG+ F GKT     L+ A+  LN+E + E   VI+  INPK+I++G L+G+FD VSHEW+DGI A TFRE AS+++ +RKW+IFDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQM+   ++IFE  DL QASPATVSRCGMIY++P  +G  P+   W+    PE L  D     + +LF W +   L F+ + CK  +  GS+ LV N+L L                                D++ K   E E + E R N  I   + +  ++ WS G +LD DS+ KFD FFR   E+    N+ +P PK +     +M+P+ G ++D+ +  K  G W  W       DL++ +   E  NI   L+PT+DT R +F +   +++ R+ +MFVG TGTGKS   +  +++ LP   ++   + FSAQTS++Q Q    SKLDRRR+G++ PP  K  V+F+DD++MP KE YGAQPP+E+LRQ  DH  W+D KD T ++++D+ +  AM  P   R  VT R LRHFN++++  F D+TM  IF  +M  +   G E T   L+  + +V AT +++++ +++ LPTPAKSHYVFNLRDFSRVI G  L+K        Q +      RLWVHE  RVF+DRLI   D +  ++L+K+ ++  FKE F VLF   +T    P   E +R LMFGD++     P             E ++Y E+ +    +  ++  +DEYN   K  M LV+FR+ +EH++RICR+L  P G++LLVG+GGSGRQS  +LA  + +  +FQ E+++ Y   +WR+D++ L++  G +G  T FL  D QIK+  FLEDI+ LLN+G++PNLF  E++ E+IE ++Q  Q  N   + + + ++  F+ R R+ LH+V+ FSPIG AF +RLR FP+LINCCTI+WFQ WPEDAL+ VA K+L+ V+++ D+R   V + +HFH SV +LS++F++ +GR NYVTPTSYLELI +F  LLN KQ E +  K+RY  GL+KL F+  Q+S MQ++L+  QPQL++  K  E L+  I  E++  E  R  VK EE     KA+ +K++ D+C ++LAEA+P + AA+ ALDTL+  DI+IVK MQNPP GVKLVME +CI++ +KPE+  DP+  GK M DYW  +KKLLGD+ FL +L+ YDKD I    M KIR ++I NP FDP+K+   SSA EGLC W+ A+E YDR+ KVV+PKK KLA AES  +  M +L   Q +L  VE KL  L++  ++ + EK  L+  +EL   K+ERA+KLI GLGGEK RW +   +L   +DN+IGDVLL AG++AYLGPFT  YR +C+  W   CKS  IP S + + +    LG+PV+++ W I+GLP DSFS+DN+VIV +  RW L+IDPQ QANKWIK ME E   L VIKL+D  ++R LEN +QFG P LLENVGEELD  LE +LLKQ FKQ+ V+ +RLG+ ++EYS++FR YITT+LRNPHYLPE +VKV+L+NFMIT  GLEDQ+LGIV AKEKPELE  R +LII SA+NRR LKE ED+IL  LS S+GNILE+E AI+IL SSK +S+ I  KQE A +T+ +I+  R  Y P+A H +ILFF+I+DL ++DPMYQYSLSWF+NLYI+SI +S  S  ++ RL+ L+ HFT ++Y N+CRSLFEKDKLLFSFLLC  I   +  ++   + FLLTGG+ L++   NP   WLS+KSW+E+  L++L+ FKG+ + F  N++ W++  DSK P   K P  W  +L   + L+V+RC+ P+K++PA+ +Y+   LG +++EPP FDL  SF++S    P+IFVLSPG DP   L +FAE K    +    +SLGQGQGPIA   I E+ +   W++LQNCHLA SW+  + KICEE+  + +  N  FRLWLTSYPS  FPV VLQN VKMTNEPP GLR NL +S+    IS+ +FF     +   FEKLLF LCFFHA+VQERR +G +GWNIPY FNDSDL+IS RQLQMF+++YE V  +A+ YLTGECNYGGRVTD+ DRR +M++L   Y++ +++   +  + SGTY+VP    +   Y+  IK  P    PEVFG+H N ++ +E Q++  L +S+L+TL +  S    SS+  + ++A+DIL K+P  F +E+  + YPV Y E MNTVL+QE+ RFN
Sbjct:   12 KEKLRDYVKLNSEAPIKY-SQIY-TNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRVTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRNQLNDAVENE--QELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMR-------------------------------------CAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINQWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRFFFLSNEELLEILSETKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLRDVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIKS--HTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQIQTIQRAIRDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQLKRKLRLLTEERVVLKSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNIE-NSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLD-DEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSDDADDEDIEELAGEDEEDILNKITNENEILKEERTNFLI---AHFFLSLIWSFGAILDKDSKLKFDDFFRDLCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNI---LIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLS--KVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTE-MRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLEIIEKMQQIVQQQNIQIEITAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLIETSKETEKLIKIIETETVEVEKVRKVVKEEEAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPS--GKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKSRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVSSESTFSLSSVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKMESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGEELDSVLESVLLKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKAS-KRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFIDDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFN 3386          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH120.000e+060.77dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH70.000e+051.86dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH30.000e+051.08dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
DNAH10.000e+045.11dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH120.000e+056.50dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-10.000e+027.63Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+027.63Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+027.64Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-30.000e+026.78Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-37.217e-5437.35Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc36C0.000e+048.03gene:FBgn0013810 transcript:FBtr0304742[more]
Dhc62B0.000e+046.13gene:FBgn0013811 transcript:FBtr0303106[more]
Dnah30.000e+043.06gene:FBgn0035581 transcript:FBtr0289982[more]
kl-20.000e+036.37gene:FBgn0001313 transcript:FBtr0346722[more]
Dhc98D0.000e+034.20gene:FBgn0013813 transcript:FBtr0301302[more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+060.09dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah120.000e+060.35dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
CR450723.10.000e+060.14dynein, axonemal, heavy chain 12 [Source:NCBI gene... [more]
dnah70.000e+052.67dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah30.000e+050.71dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xpo70.000e+062.15exportin 7 [Source:Xenbase;Acc:XB-GENE-491338][more]
xpo70.000e+066.75exportin 7 [Source:Xenbase;Acc:XB-GENE-491338][more]
xpo70.000e+066.00exportin 7 [Source:Xenbase;Acc:XB-GENE-491338][more]
xpo70.000e+065.47exportin 7 [Source:Xenbase;Acc:XB-GENE-491338][more]
olfm40.000e+053.40olfactomedin 4 [Source:Xenbase;Acc:XB-GENE-5725072... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah120.000e+060.79dynein, axonemal, heavy chain 12 [Source:MGI Symbo... [more]
Dnah120.000e+060.79dynein, axonemal, heavy chain 12 [Source:MGI Symbo... [more]
Dnah7b0.000e+052.41dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7b0.000e+052.41dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
Dnah7a0.000e+052.38dynein, axonemal, heavy chain 7A [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WXX0|DYH7_HUMAN0.000e+051.86Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|Q63170|DYH7_RAT0.000e+052.37Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
sp|Q8BW94|DYH3_MOUSE0.000e+050.09Dynein heavy chain 3, axonemal OS=Mus musculus OX=... [more]
sp|Q8TD57|DYH3_HUMAN0.000e+051.08Dynein heavy chain 3, axonemal OS=Homo sapiens OX=... [more]
sp|Q9P2D7|DYH1_HUMAN0.000e+045.09Dynein heavy chain 1, axonemal OS=Homo sapiens OX=... [more]
back to top
BLAST of Dynein heavy chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L7030.000e+067.60Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1I8JJN80.000e+067.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J2660.000e+066.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1QKQ90.000e+064.35Dynein heavy chain 7, axonemal OS=Crassostrea giga... [more]
A0A074ZF620.000e+067.50Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+060.84dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah20.000e+039.26dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+036.65dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.20.000e+035.21pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah50.000e+032.03dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001140.10.000e+047.05pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
DNAH60.000e+042.77dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000003955.10.000e+054.51pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000003959.10.000e+054.68pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 g... [more]
ENSPMAT00000003938.10.000e+068.50pep scaffold:Pmarinus_7.0:GL495754:984:26133:-1 ge... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN19.875e-9527.99Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458060.000e+052.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347270.000e+053.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379610.000e+064.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318000.000e+039.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340770.000e+040.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+057.56dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
dnah50.000e+033.88dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
si:dkeyp-86b9.10.000e+030.44dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
dnah50.000e+034.20dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah50.000e+031.41dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein heavy chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5