Epithelial discoidin domain-containing receptor

Overview
NameEpithelial discoidin domain-containing receptor
Smed IDSMED30000553
Length (bp)4065
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Epithelial discoidin domain-containing receptor (SMED30000553) t-SNE clustered cells

Violin plots show distribution of expression levels for Epithelial discoidin domain-containing receptor (SMED30000553) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epithelial discoidin domain-containing receptor (SMED30000553) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epithelial discoidin domain-containing receptor (SMED30000553) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000553

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30000553SMESG000069322.1 SmedASXL_013985SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30000553SMESG000069322.1 SMED30000553smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx musculatureSMED30000553SMESG000069322.1 dd_Smed_v4_12571_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Human
Match: PTK7 (protein tyrosine kinase 7 (inactive) [Source:HGNC Symbol;Acc:HGNC:9618])

HSP 1 Score: 147.902 bits (372), Expect = 2.750e-35
Identity = 101/320 (31.56%), Postives = 160/320 (50.00%), Query Frame = 3
Query: 2295 DQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM--LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            ++ +S S+    P SSL PI  + + EFG + +     L EG  +T     VK+L    +      F  +L++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     S+D KL +S P S     +L   +   A GM+HL      H+DLA RNC++  +  VK+   GL     N +Y            PLRWM+PE+I+ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW      RP F+++   L   T +S
Sbjct:  650 NKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLV--LVKSLQSKDEQQQLD-FRRELEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----SKDEKL-KSQPLSTKQKVALCTQV---ALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFR----QAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDS 938          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Human
Match: PTK7 (protein tyrosine kinase 7 (inactive) [Source:HGNC Symbol;Acc:HGNC:9618])

HSP 1 Score: 148.288 bits (373), Expect = 2.801e-35
Identity = 101/320 (31.56%), Postives = 160/320 (50.00%), Query Frame = 3
Query: 2295 DQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM--LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            ++ +S S+    P SSL PI  + + EFG + +     L EG  +T     VK+L    +      F  +L++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     S+D KL +S P S     +L   +   A GM+HL      H+DLA RNC++  +  VK+   GL     N +Y            PLRWM+PE+I+ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW      RP F+++   L   T +S
Sbjct:  724 NKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLV--LVKSLQSKDEQQQLD-FRRELEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----SKDEKL-KSQPLSTKQKVALCTQV---ALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHF----RQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDS 1012          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Human
Match: PTK7 (protein tyrosine kinase 7 (inactive) [Source:HGNC Symbol;Acc:HGNC:9618])

HSP 1 Score: 148.288 bits (373), Expect = 3.190e-35
Identity = 101/320 (31.56%), Postives = 160/320 (50.00%), Query Frame = 3
Query: 2295 DQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM--LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            ++ +S S+    P SSL PI  + + EFG + +     L EG  +T     VK+L    +      F  +L++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     S+D KL +S P S     +L   +   A GM+HL      H+DLA RNC++  +  VK+   GL     N +Y            PLRWM+PE+I+ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW      RP F+++   L   T +S
Sbjct:  788 NKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLV--LVKSLQSKDEQQQLD-FRRELEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----SKDEKL-KSQPLSTKQKVALCTQV---ALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHF----RQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDS 1076          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Human
Match: PTK7 (protein tyrosine kinase 7 (inactive) [Source:HGNC Symbol;Acc:HGNC:9618])

HSP 1 Score: 147.902 bits (372), Expect = 3.263e-35
Identity = 101/320 (31.56%), Postives = 160/320 (50.00%), Query Frame = 3
Query: 2295 DQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM--LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            ++ +S S+    P SSL PI  + + EFG + +     L EG  +T     VK+L    +      F  +L++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     S+D KL +S P S     +L   +   A GM+HL      H+DLA RNC++  +  VK+   GL     N +Y            PLRWM+PE+I+ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW      RP F+++   L   T +S
Sbjct:  780 NKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLV--LVKSLQSKDEQQQLD-FRRELEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----SKDEKL-KSQPLSTKQKVALCTQV---ALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHF----RQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDS 1068          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Human
Match: PTK7 (protein tyrosine kinase 7 (inactive) [Source:HGNC Symbol;Acc:HGNC:9618])

HSP 1 Score: 147.902 bits (372), Expect = 3.421e-35
Identity = 101/320 (31.56%), Postives = 160/320 (50.00%), Query Frame = 3
Query: 2295 DQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM--LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            ++ +S S+    P SSL PI  + + EFG + +     L EG  +T     VK+L    +      F  +L++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     S+D KL +S P S     +L   +   A GM+HL      H+DLA RNC++  +  VK+   GL     N +Y            PLRWM+PE+I+ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW      RP F+++   L   T +S
Sbjct:  740 NKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLV--LVKSLQSKDEQQQLD-FRRELEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----SKDEKL-KSQPLSTKQKVALCTQV---ALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHF----RQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDS 1028          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 131.724 bits (330), Expect = 6.733e-31
Identity = 87/301 (28.90%), Postives = 149/301 (49.50%), Query Frame = 3
Query: 2343 LIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPC----PQNCPKDIY-DLMNRCWNWDESARPKFADVHKFLQ 3230
            LI + ++ +GEFG + +C +          +  VK L+  S++   S F  ++++L S+   N+V  E + V +    I             IM+Y+   +LK ++        SQ   +   +                 A G+ +LE     HRD+A RNC++D   +VKI   G+  +  +++Y  +E        P+RWMA E+++ G F+T SD+W F VT+WEIF+LCS  PY  +T++ +++ +   ++T  L      P+ CP  +Y + +  CWN++ S RP F +VH  LQ
Sbjct:  497 LICVSRIGQGEFGEVDLCQL-------ENRKVAVKKLHGISQADEFS-FHREIRVLGSLKHPNVV--EVVGVCTIQKPI-----------LCIMEYMENGDLKSYILKNPTIQTSQCISICTQL-----------------AAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYYKVE---GKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHLHLQ 756          

HSP 2 Score: 98.5969 bits (244), Expect = 1.390e-20
Identity = 86/286 (30.07%), Postives = 143/286 (50.00%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNL-RTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGT--LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHN--IYLSGLITVTISDRD 1265
            MS + + D+Q SASS  +  Q +  +    H +SG     AWCP   I+S  +EW+++ F    +I  + T GR  DG   +Y     I+Y R + N W +Y +      +  N D    +R +L R IIA+RIRI P+++  S+   C++    GC  +D  V Y+  QGDL +   IS+   D+ YDG +  +  L  G+G L D    +N  ++F  VN  K   + GW    R ++  + + F F + R+   I +++  +FK +   + S  +  +I+ +D
Sbjct:    1 MSNRKIRDEQISASS-SFDLQSTGPQHARAHQESG---SGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSN--STRTVCMRVEVFGCPFDDSLVFYNVDQGDLQS--GISY--HDFSYDGNLANSPHLTGGIGKLYDGEVGKN--NVF--VNHHK---WVGW---RRKRNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKD 266          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 131.724 bits (330), Expect = 6.733e-31
Identity = 87/301 (28.90%), Postives = 149/301 (49.50%), Query Frame = 3
Query: 2343 LIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPC----PQNCPKDIY-DLMNRCWNWDESARPKFADVHKFLQ 3230
            LI + ++ +GEFG + +C +          +  VK L+  S++   S F  ++++L S+   N+V  E + V +    I             IM+Y+   +LK ++        SQ   +   +                 A G+ +LE     HRD+A RNC++D   +VKI   G+  +  +++Y  +E        P+RWMA E+++ G F+T SD+W F VT+WEIF+LCS  PY  +T++ +++ +   ++T  L      P+ CP  +Y + +  CWN++ S RP F +VH  LQ
Sbjct:  497 LICVSRIGQGEFGEVDLCQL-------ENRKVAVKKLHGISQADEFS-FHREIRVLGSLKHPNVV--EVVGVCTIQKPI-----------LCIMEYMENGDLKSYILKNPTIQTSQCISICTQL-----------------AAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYYKVE---GKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHLHLQ 756          

HSP 2 Score: 98.5969 bits (244), Expect = 1.390e-20
Identity = 86/286 (30.07%), Postives = 143/286 (50.00%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNL-RTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGT--LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHN--IYLSGLITVTISDRD 1265
            MS + + D+Q SASS  +  Q +  +    H +SG     AWCP   I+S  +EW+++ F    +I  + T GR  DG   +Y     I+Y R + N W +Y +      +  N D    +R +L R IIA+RIRI P+++  S+   C++    GC  +D  V Y+  QGDL +   IS+   D+ YDG +  +  L  G+G L D    +N  ++F  VN  K   + GW    R ++  + + F F + R+   I +++  +FK +   + S  +  +I+ +D
Sbjct:    1 MSNRKIRDEQISASS-SFDLQSTGPQHARAHQESG---SGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSN--STRTVCMRVEVFGCPFDDSLVFYNVDQGDLQS--GISY--HDFSYDGNLANSPHLTGGIGKLYDGEVGKN--NVF--VNHHK---WVGW---RRKRNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKD 266          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 131.339 bits (329), Expect = 9.372e-31
Identity = 87/301 (28.90%), Postives = 149/301 (49.50%), Query Frame = 3
Query: 2343 LIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPC----PQNCPKDIY-DLMNRCWNWDESARPKFADVHKFLQ 3230
            LI + ++ +GEFG + +C +          +  VK L+  S++   S F  ++++L S+   N+V  E + V +    I             IM+Y+   +LK ++        SQ   +   +                 A G+ +LE     HRD+A RNC++D   +VKI   G+  +  +++Y  +E        P+RWMA E+++ G F+T SD+W F VT+WEIF+LCS  PY  +T++ +++ +   ++T  L      P+ CP  +Y + +  CWN++ S RP F +VH  LQ
Sbjct:  527 LICVSRIGQGEFGEVDLCQL-------ENRKVAVKKLHGISQADEFS-FHREIRVLGSLKHPNVV--EVVGVCTIQKPI-----------LCIMEYMENGDLKSYILKNPTIQTSQCISICTQL-----------------AAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYYKVE---GKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHLHLQ 786          

HSP 2 Score: 98.5969 bits (244), Expect = 1.684e-20
Identity = 86/286 (30.07%), Postives = 143/286 (50.00%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNL-RTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGT--LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHN--IYLSGLITVTISDRD 1265
            MS + + D+Q SASS  +  Q +  +    H +SG     AWCP   I+S  +EW+++ F    +I  + T GR  DG   +Y     I+Y R + N W +Y +      +  N D    +R +L R IIA+RIRI P+++  S+   C++    GC  +D  V Y+  QGDL +   IS+   D+ YDG +  +  L  G+G L D    +N  ++F  VN  K   + GW    R ++  + + F F + R+   I +++  +FK +   + S  +  +I+ +D
Sbjct:   31 MSNRKIRDEQISASS-SFDLQSTGPQHARAHQESG---SGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSN--STRTVCMRVEVFGCPFDDSLVFYNVDQGDLQS--GISY--HDFSYDGNLANSPHLTGGIGKLYDGEVGKN--NVF--VNHHK---WVGW---RRKRNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKD 296          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 125.176 bits (313), Expect = 1.407e-28
Identity = 79/244 (32.38%), Postives = 117/244 (47.95%), Query Frame = 3
Query: 2487 FIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVH 3218
            F+ +  I+  ++  NLV+L             L        FYII +++   NL ++LR T  S +     L Q              + +Q+A+GM +LE     HRDLA RNC++     VKI   GL      + Y +    +    FP++W APE +    F++KSD+W+F V LWEI T   + PY  +    +  L+    N  R+  PQ CP  +Y LM +CWNW  S RP+F D+H
Sbjct:  337 FLAEAAIMKDLHHKNLVRL-------------LGVCTHEAPFYIITEFMCNGNLLEYLRRTDKS-LLPPIILVQ--------------MASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKEDTYTA----HAGAKFPIKWTAPEGLAFNTFSSKSDVWAFGVLLWEIATY-GMAPYPGVELSNVYGLLE---NGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIH 544          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 125.176 bits (313), Expect = 1.446e-28
Identity = 79/244 (32.38%), Postives = 117/244 (47.95%), Query Frame = 3
Query: 2487 FIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVH 3218
            F+ +  I+  ++  NLV+L             L        FYII +++   NL ++LR T  S +     L Q              + +Q+A+GM +LE     HRDLA RNC++     VKI   GL      + Y +    +    FP++W APE +    F++KSD+W+F V LWEI T   + PY  +    +  L+    N  R+  PQ CP  +Y LM +CWNW  S RP+F D+H
Sbjct:  352 FLAEAAIMKDLHHKNLVRL-------------LGVCTHEAPFYIITEFMCNGNLLEYLRRTDKS-LLPPIILVQ--------------MASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKEDTYTA----HAGAKFPIKWTAPEGLAFNTFSSKSDVWAFGVLLWEIATY-GMAPYPGVELSNVYGLLE---NGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIH 559          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344771)

HSP 1 Score: 150.214 bits (378), Expect = 3.344e-36
Identity = 104/327 (31.80%), Postives = 171/327 (52.29%), Query Frame = 3
Query: 2283 FPRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGY-NLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPN--EDYCSMEILNHLVT--FPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMS--HRNNTPR--LPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFK 3236
            F  +++  ++  ++  P  SL+ ++++  G FG + +C    E +        V  L   +   ++  F    K L+ ++  N+ +L             + + ++     I+ DY +   +L  FL+     +V++   L   M    +S   L+ I TQ+A+GMKHLE++   HRDLA R+C+I   + VK+   G V  +     DYC +E      +   P+RWMA ES++ G FTTKSD+WSFAV LWEI T     PY  L+++++++ +   +R+      LP P NCP++IYDLM  CW  DES+RP F ++H +LQ K
Sbjct:  739 FADINEERANCQVQEFPRQSLVIVEKLGSGVFGELHLC----ETNVLNATLVAVATLRPGANDHLRKEFRSKAKQLAQLSDPNVARL-------------VGACLRDEPICIVQDYSHCLGDLNQFLQE----HVAETSGL---MAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQSQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRK 1041          

HSP 2 Score: 98.5969 bits (244), Expect = 2.268e-20
Identity = 90/348 (25.86%), Postives = 161/348 (46.26%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFE--YKFQPSAARL-IEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLR-TIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILG-TLQNGLGLLMDNIAWRNKFDLFNNVNG-EKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHN--IYLSGLITVTISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSI 1442
            M    + D Q +ASS        P  ARL I+       ++G AWCP   +     E+++VD   + ++  I T GR   G  Q+YT   +I+Y R    +W  + +L  + VL  N +  +++ + L+ ++ A ++R+YP +    ++  CL+   +GC  E+  VSY  P+G       +  DL D  YDG   G    NGLG L+D    R K +   ++NG  K   + GW   +    P  II F FE  R+  ++ +++   F  +  +++   +  +I  R  +   +  +        +   VT++L+H  G    +++      ++++SEI   SA  +
Sbjct:  112 MESGAIADFQITASSAHDMGNVGPQHARLKID-------NNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTV--CLRAEIVGCAWEEGIVSYSIPKG---MQRGMDIDLSDKTYDGYEEGDHYVNGLGQLVD--GQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEII-FEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFSGEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFA-ARWMMISEITFISAPVV 443          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344770)

HSP 1 Score: 150.214 bits (378), Expect = 3.344e-36
Identity = 104/327 (31.80%), Postives = 171/327 (52.29%), Query Frame = 3
Query: 2283 FPRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGY-NLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPN--EDYCSMEILNHLVT--FPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMS--HRNNTPR--LPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFK 3236
            F  +++  ++  ++  P  SL+ ++++  G FG + +C    E +        V  L   +   ++  F    K L+ ++  N+ +L             + + ++     I+ DY +   +L  FL+     +V++   L   M    +S   L+ I TQ+A+GMKHLE++   HRDLA R+C+I   + VK+   G V  +     DYC +E      +   P+RWMA ES++ G FTTKSD+WSFAV LWEI T     PY  L+++++++ +   +R+      LP P NCP++IYDLM  CW  DES+RP F ++H +LQ K
Sbjct:  739 FADINEERANCQVQEFPRQSLVIVEKLGSGVFGELHLC----ETNVLNATLVAVATLRPGANDHLRKEFRSKAKQLAQLSDPNVARL-------------VGACLRDEPICIVQDYSHCLGDLNQFLQE----HVAETSGL---MAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQSQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRK 1041          

HSP 2 Score: 98.5969 bits (244), Expect = 2.268e-20
Identity = 90/348 (25.86%), Postives = 161/348 (46.26%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFE--YKFQPSAARL-IEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLR-TIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILG-TLQNGLGLLMDNIAWRNKFDLFNNVNG-EKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHN--IYLSGLITVTISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSI 1442
            M    + D Q +ASS        P  ARL I+       ++G AWCP   +     E+++VD   + ++  I T GR   G  Q+YT   +I+Y R    +W  + +L  + VL  N +  +++ + L+ ++ A ++R+YP +    ++  CL+   +GC  E+  VSY  P+G       +  DL D  YDG   G    NGLG L+D    R K +   ++NG  K   + GW   +    P  II F FE  R+  ++ +++   F  +  +++   +  +I  R  +   +  +        +   VT++L+H  G    +++      ++++SEI   SA  +
Sbjct:  112 MESGAIADFQITASSAHDMGNVGPQHARLKID-------NNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTV--CLRAEIVGCAWEEGIVSYSIPKG---MQRGMDIDLSDKTYDGYEEGDHYVNGLGQLVD--GQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEII-FEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFSGEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFA-ARWMMISEITFISAPVV 443          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330132)

HSP 1 Score: 132.88 bits (333), Expect = 9.692e-31
Identity = 78/237 (32.91%), Postives = 118/237 (49.79%), Query Frame = 3
Query: 2541 LETIAVDSDMSNIDLFSVI----KSTRFYIIMDYLNGYNLKDFLRSTYYSN---VSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            LE  A+  +M + +L  +I    +   FYII ++++  NL DFLRS        V+  +  TQ                  +A+GM +LE     HRDLA RNC++     VK+   GL     ++ Y +    +    FP++W APE +    F+TKSD+W+F V LWEI T   + PY ++    L D+    +   R+  P  CP ++YDLM +CW WD + RP F  +H  L+
Sbjct:  413 LEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQ------------------IASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTA----HAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATY-GMSPYPAID---LTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALE 623          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0345369)

HSP 1 Score: 132.88 bits (333), Expect = 9.801e-31
Identity = 78/237 (32.91%), Postives = 118/237 (49.79%), Query Frame = 3
Query: 2541 LETIAVDSDMSNIDLFSVI----KSTRFYIIMDYLNGYNLKDFLRSTYYSN---VSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            LE  A+  +M + +L  +I    +   FYII ++++  NL DFLRS        V+  +  TQ                  +A+GM +LE     HRDLA RNC++     VK+   GL     ++ Y +    +    FP++W APE +    F+TKSD+W+F V LWEI T   + PY ++    L D+    +   R+  P  CP ++YDLM +CW WD + RP F  +H  L+
Sbjct:  413 LEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQ------------------IASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTA----HAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATY-GMSPYPAID---LTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALE 623          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0075357)

HSP 1 Score: 132.88 bits (333), Expect = 9.801e-31
Identity = 78/237 (32.91%), Postives = 118/237 (49.79%), Query Frame = 3
Query: 2541 LETIAVDSDMSNIDLFSVI----KSTRFYIIMDYLNGYNLKDFLRSTYYSN---VSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            LE  A+  +M + +L  +I    +   FYII ++++  NL DFLRS        V+  +  TQ                  +A+GM +LE     HRDLA RNC++     VK+   GL     ++ Y +    +    FP++W APE +    F+TKSD+W+F V LWEI T   + PY ++    L D+    +   R+  P  CP ++YDLM +CW WD + RP F  +H  L+
Sbjct:  413 LEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQ------------------IASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTA----HAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATY-GMSPYPAID---LTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALE 623          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 142.51 bits (358), Expect = 6.594e-34
Identity = 103/337 (30.56%), Postives = 168/337 (49.85%), Query Frame = 3
Query: 2271 YHSPFPRVDQ-NNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM------------LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            Y  P   VD     D ++   P   L+  +++  G+FG + +C              L E D +      VK L  D+ S+ ++ F+ ++KI+S +N  N+++L  + V SD                ++ +Y+   +L  FL     S    +  LT +     +S++ L+ +  Q+++GMK+L  L   HRDLA RNC++D  + +KI   G+     + DY  ++        P+RWMA ESI+ G FTT SD+W+F VTLWEIFTLC   PY  L++E ++    +   ++     L  P  CP  ++ LM RCW+ D + RP F  +H+ L+
Sbjct:  541 YSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEVHLCEAEGLAEFLGEGAPLPEQDGRPVL-VAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSD-------------PLCMVTEYMENGDLNMFL-----SQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYRIQ---GRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLHQALR 855          

HSP 2 Score: 84.7297 bits (208), Expect = 5.230e-16
Identity = 78/368 (21.20%), Postives = 154/368 (41.85%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEY-KFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNN--QWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISF-DLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKD----PFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVT-----ISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRPAI 1484
            M    + +D  +ASS  Y    P  ARL     +       AWC    +     +++++D R+++ +  + T GR A  +  ++  +  ++Y R  +    WRN     NE ++       T +R     II + +R+ P+     ++  C++    GC  +D  ++Y +P+G ++         L D  YDG +    L  GLG L D +   + F     V   + +++ G+       D     ++ + F F+++R+F S+ ++S   F   + +   ++       IS+ ++  V  +  I   D + +   VTV L H              + +++ SEI  +S   +       P K+P +
Sbjct:   17 MEDGRIKNDDITASSQWYDSTGPQYARLNREEGE------GAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN--RFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTV--CMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLNDSTYDGPLERRKLSGGLGQLADGVVGLDDF-----VESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVI--DDRNPSARYVTVPLKHRSATALRCRFYFA-DTWMMFSEISFQSVTIVL------PTKKPPV 360          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 142.51 bits (358), Expect = 6.718e-34
Identity = 103/337 (30.56%), Postives = 168/337 (49.85%), Query Frame = 3
Query: 2271 YHSPFPRVDQ-NNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM------------LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            Y  P   VD     D ++   P   L+  +++  G+FG + +C              L E D +      VK L  D+ S+ ++ F+ ++KI+S +N  N+++L  + V SD                ++ +Y+   +L  FL     S    +  LT +     +S++ L+ +  Q+++GMK+L  L   HRDLA RNC++D  + +KI   G+     + DY  ++        P+RWMA ESI+ G FTT SD+W+F VTLWEIFTLC   PY  L++E ++    +   ++     L  P  CP  ++ LM RCW+ D + RP F  +H+ L+
Sbjct:  553 YSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEVHLCEAEGLAEFLGEGAPLPEQDGRPVL-VAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSD-------------PLCMVTEYMENGDLNMFL-----SQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYRIQ---GRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLHQALR 867          

HSP 2 Score: 84.7297 bits (208), Expect = 4.729e-16
Identity = 79/371 (21.29%), Postives = 157/371 (42.32%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEY-KFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNN--QWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISF-DLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKD----PFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVT-----ISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGL---NNFILLSEIEIKSAKSIRTNAANSPPKRPAI 1484
            M    + +D  +ASS  Y    P  ARL     +       AWC    +     +++++D R+++ +  + T GR A  +  ++  +  ++Y R  +    WRN     NE ++       T +R     II + +R+ P+     ++  C++    GC  +D  ++Y +P+G ++         L D  YDG +    L  GLG L D +   + F     V   + +++ G+       D     ++ + F F+++R+F S+ ++S   F   + +   ++       IS+ ++  V  +  I   D + +   VTV L H      +  + C     + +++ SEI  +S   +       P K+P +
Sbjct:   29 MEDGRIKNDDITASSQWYDSTGPQYARLNREEGE------GAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN--RFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTV--CMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLNDSTYDGPLERRKLSGGLGQLADGVVGLDDF-----VESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVI--DDRNPSARYVTVPLKHRS----ATALRCRFYFADTWMMFSEISFQSVTIVL------PTKKPPV 372          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Zebrafish
Match: BX088694.1 (discoidin domain receptor family, member 2, like [Source:NCBI gene;Acc:565333])

HSP 1 Score: 142.51 bits (358), Expect = 7.599e-34
Identity = 103/336 (30.65%), Postives = 167/336 (49.70%), Query Frame = 3
Query: 2271 YHSPFPRVDQ-NNSDSNIRVIPISSLIPIQQVIRGEFGTISVCT------MLIEG-----DHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            Y  P   VD     D ++   P   L+  +++  G+FG + +C        L EG              VK L  D+ S+ ++ F+ ++KI+S +N  N+++L  + V SD                ++ +Y+   +L  FL     S    +  LT +     +S++ L+ +  Q+++GMK+L  L   HRDLA RNC++D  + +KI   G+     + DY  ++        P+RWMA ESI+ G FTT SD+W+F VTLWEIFTLC   PY  L++E ++    +   ++     L  P  CP  ++ LM RCW+ D + RP F  +H+ L+
Sbjct:  531 YSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEVHLCEAEGLAEFLGEGAPLPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSD-------------PLCMVTEYMENGDLNMFL-----SQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYRIQ---GRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLHQALR 845          

HSP 2 Score: 83.9593 bits (206), Expect = 9.826e-16
Identity = 77/368 (20.92%), Postives = 154/368 (41.85%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEY-KFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNN--QWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISF-DLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKD----PFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVT-----ISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRPAI 1484
            M    + +D  +ASS  Y    P  ARL     +       AWC    +     +++++D R+++ +  + T GR A  +  ++  +  ++Y R  +    WRN     NE ++       T +R     II + +R+ P+     ++  C++    GC  +D  ++Y +P+G ++         L D  YDG +    L  GLG L D +   + F     V   + +++ G+       D     ++ + F F+++R+F S+ ++S   F   + +   ++       IS+ ++  V  +  I   D + +   VT+ L H              + +++ SEI  +S   +       P K+P +
Sbjct:   29 MEDGRIKNDDITASSQWYDSTGPQYARLNREEGE------GAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN--RFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTV--CMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLNDSTYDGPLERRKLSGGLGQLADGVVGLDDF-----VESRQYRLWPGYDYVGWRNDGLGPGYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVI--DDRNPSARYVTIPLKHRSATALRCRFYFA-DTWMMFSEISFQSVTIVL------PTKKPPV 372          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Zebrafish
Match: FP015875.1 (discoidin domain receptor family, member 2, like [Source:NCBI gene;Acc:565333])

HSP 1 Score: 142.124 bits (357), Expect = 7.867e-34
Identity = 103/336 (30.65%), Postives = 167/336 (49.70%), Query Frame = 3
Query: 2271 YHSPFPRVDQ-NNSDSNIRVIPISSLIPIQQVIRGEFGTISVCT------MLIEG-----DHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            Y  P   VD     D ++   P   L+  +++  G+FG + +C        L EG              VK L  D+ S+ ++ F+ ++KI+S +N  N+++L  + V SD                ++ +Y+   +L  FL     S    +  LT +     +S++ L+ +  Q+++GMK+L  L   HRDLA RNC++D  + +KI   G+     + DY  ++        P+RWMA ESI+ G FTT SD+W+F VTLWEIFTLC   PY  L++E ++    +   ++     L  P  CP  ++ LM RCW+ D + RP F  +H+ L+
Sbjct:  531 YSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEVHLCEAEGLAEFLGEGAPLPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLCVCVSSD-------------PLCMVTEYMENGDLNMFL-----SQREIESTLTHANNIPSVSIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYRIQ---GRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLSAPPLCPSSLFKLMMRCWSRDITDRPSFNKLHQALR 845          

HSP 2 Score: 84.7297 bits (208), Expect = 5.275e-16
Identity = 78/368 (21.20%), Postives = 154/368 (41.85%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEY-KFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNN--QWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISF-DLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKD----PFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVT-----ISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRPAI 1484
            M    + +D  +ASS  Y    P  ARL     +       AWC    +     +++++D R+++ +  + T GR A  +  ++  +  ++Y R  +    WRN     NE ++       T +R     II + +R+ P+     ++  C++    GC  +D  ++Y +P+G ++         L D  YDG +    L  GLG L D +   + F     V   + +++ G+       D     ++ + F F+++R+F S+ ++S   F   + +   ++       IS+ ++  V  +  I   D + +   VTV L H              + +++ SEI  +S   +       P K+P +
Sbjct:   29 MEDGRIKNDDITASSQWYDSTGPQYARLNREEGE------GAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN--RFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTV--CMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLNDSTYDGPLERRKLSGGLGQLADGVVGLDDF-----VESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPVEFHTVI--DDRNPSARYVTVPLKHRSATALRCRFYFA-DTWMMFSEISFQSVTIVL------PTKKPPV 372          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Zebrafish
Match: ddr2b (discoidin domain receptor tyrosine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-060503-361])

HSP 1 Score: 120.553 bits (301), Expect = 7.982e-31
Identity = 60/158 (37.97%), Postives = 85/158 (53.80%), Query Frame = 3
Query: 2766 ANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            ++GMK+L  L   HRDLA RNC++ +   +KI   G+       DY  ++        P+RWM+ ESI+ G FT  SD+W+F VTLWEI TLC   PY   T+E ++    +    +N    L  P  CP+ +Y LM  CW  +   RP F ++H  L
Sbjct:    6 SSGMKYLSSLNFVHRDLATRNCLVGMNNIIKIADFGMSRNLYRGDYYRIQ---GRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYAQFTDEQVIENTGEFFRDQNKQVYLLRPACCPESLYSLMLNCWRRNAKERPTFLEIHSTL 160          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Xenopus
Match: pitpnc1l (phosphatidylinositol transfer protein cytoplasmic 1 like [Source:Xenbase;Acc:XB-GENE-5779888])

HSP 1 Score: 134.035 bits (336), Expect = 4.606e-31
Identity = 97/315 (30.79%), Postives = 153/315 (48.57%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
             P   L+  +++  G+FG + +C ++   +  T    F           VK L  D+  + +S F+ +LKILS ++  ++++L    +D D                +I +Y+   +L  FL S +     +     Q +P   IS  SL+ +  Q+ +GMK+L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWEI  LC   PYG L++E ++    ++         L  P  CP+ +Y+LM +CW+ D   RP F D+H  L
Sbjct:  604 FPRGHLLFKEKLGEGQFGEVHLCEVVNPHELPTLQFPFNMRKGRSLLVAVKLLRADANKNARSDFLKELKILSRLSDPHIIRLLGACLDED-------------PLCMITEYMENGDLNQFLSSHHLDEGEESG--AQCLP--AISYPSLLHVAVQICSGMKYLSSLNFVHRDLASRNCLVGENFTIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEILMLCKEQPYGELSDEDVIENAGEIFRDSKKQIFLFRPPPCPQPLYELMLQCWSRDCRERPSFQDIHALL 898          

HSP 2 Score: 76.2554 bits (186), Expect = 3.247e-13
Identity = 45/164 (27.44%), Postives = 81/164 (49.39%), Query Frame = 3
Query:  516 HSQSGPDDGN-AWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAIL 998
            HS+   +DG+ AWCP   +    EE+++VD R +  +  + T GR  G   K +     ++Y R +  +W  + +     V+  N +    +  +L   IIA+ +R YP+      M  CL+    GC  +D   SY +P G+++++ ++  +L D  YDG  +
Sbjct:   63 HSRLESNDGDGAWCPLGPVFPNYEEFLQVDLRNLHFLTLVGTQGRDGGGLGKEFARHYQLRYSR-DGFKWSQWRDRWGNEVIEGNENTHDSVLKDLGPPIIARYVRFYPMAD--RVMSVCLRVELYGCIWQDGLRSYTSPPGNVMSLPSMLINLNDSTYDGFTV 223          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Xenopus
Match: pitpnc1l (phosphatidylinositol transfer protein cytoplasmic 1 like [Source:Xenbase;Acc:XB-GENE-5779888])

HSP 1 Score: 134.035 bits (336), Expect = 5.589e-31
Identity = 97/315 (30.79%), Postives = 153/315 (48.57%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
             P   L+  +++  G+FG + +C ++   +  T    F           VK L  D+  + +S F+ +LKILS ++  ++++L    +D D                +I +Y+   +L  FL S +     +     Q +P   IS  SL+ +  Q+ +GMK+L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWEI  LC   PYG L++E ++    ++         L  P  CP+ +Y+LM +CW+ D   RP F D+H  L
Sbjct:  638 FPRGHLLFKEKLGEGQFGEVHLCEVVNPHELPTLQFPFNMRKGRSLLVAVKLLRADANKNARSDFLKELKILSRLSDPHIIRLLGACLDED-------------PLCMITEYMENGDLNQFLSSHHLDEGEESG--AQCLP--AISYPSLLHVAVQICSGMKYLSSLNFVHRDLASRNCLVGENFTIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEILMLCKEQPYGELSDEDVIENAGEIFRDSKKQIFLFRPPPCPQPLYELMLQCWSRDCRERPSFQDIHALL 932          

HSP 2 Score: 76.2554 bits (186), Expect = 3.338e-13
Identity = 47/165 (28.48%), Postives = 80/165 (48.48%), Query Frame = 3
Query:  516 HSQSGPDDGN-AWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNN--NQWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAIL 998
            HS+   +DG+ AWCP   +    EE+++VD R +  +  + T GR  G   K +     ++Y R     +QWR+     NE +        + L+     IIA+ +R YP+      M  CL+    GC  +D   SY +P G+++++ ++  +L D  YDG  +
Sbjct:   63 HSRLESNDGDGAWCPLGPVFPNYEEFLQVDLRNLHFLTLVGTQGRDGGGLGKEFARHYQLRYSRDGFKWSQWRD--RWGNEVIEGNENTHDSVLKDLGPPIIARYVRFYPMAD--RVMSVCLRVELYGCIWQDGLRSYTSPPGNVMSLPSMLINLNDSTYDGFTV 223          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Xenopus
Match: pitpnc1l (phosphatidylinositol transfer protein cytoplasmic 1 like [Source:Xenbase;Acc:XB-GENE-5779888])

HSP 1 Score: 133.265 bits (334), Expect = 6.621e-31
Identity = 97/315 (30.79%), Postives = 153/315 (48.57%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
             P   L+  +++  G+FG + +C ++   +  T    F           VK L  D+  + +S F+ +LKILS ++  ++++L    +D D                +I +Y+   +L  FL S +     +     Q +P   IS  SL+ +  Q+ +GMK+L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWEI  LC   PYG L++E ++    ++         L  P  CP+ +Y+LM +CW+ D   RP F D+H  L
Sbjct:  538 FPRGHLLFKEKLGEGQFGEVHLCEVVNPHELPTLQFPFNMRKGRSLLVAVKLLRADANKNARSDFLKELKILSRLSDPHIIRLLGACLDED-------------PLCMITEYMENGDLNQFLSSHHLDEGEESG--AQCLP--AISYPSLLHVAVQICSGMKYLSSLNFVHRDLASRNCLVGENFTIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEILMLCKEQPYGELSDEDVIENAGEIFRDSKKQIFLFRPPPCPQPLYELMLQCWSRDCRERPSFQDIHALL 832          

HSP 2 Score: 76.6406 bits (187), Expect = 2.067e-13
Identity = 78/326 (23.93%), Postives = 139/326 (42.64%), Query Frame = 3
Query:  516 HSQSGPDDGN-AWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNN--NQWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQNGLGLLM-DNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDF------------KSITLYSVKD--FKHNIYLSGLITVTISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAK 1436
            HS+   +DG+ AWCP   +    EE+++VD R +  +  + T GR  G   K +     ++Y R     +QWR+     NE +        + L+     IIA+ +R YP+      M  CL+    GC  +D   SY +P G+++++ ++  +L D  YDG  +G LQ G    + D +   + F             + GW  ++  K  ++ + F F+  R F              I ++   D  FK +++         +  D   V+L+  +   D  A  + + +Q   ++   C    +   + ++LLSEI   S K
Sbjct:   62 HSRLESNDGDGAWCPLGPVFPNYEEFLQVDLRNLHFLTLVGTQGRDGGGLGKEFARHYQLRYSRDGFKWSQWRD--RWGNEVIEGNENTHDSVLKDLGPPIIARYVRFYPMAD--RVMSVCLRVELYGCIWQDGLRSYTSPPGNVMSLPSMLINLNDSTYDGFTVGGLQYGGLGQLTDGVIGADDFLQHKEQGVWPGYDYVGWMTSNFPKG-YLEMEFEFDALRSFIYMRVHCNNMGSGGIQIFRRVDCYFKRSLH---------TPWDPQPVTLSLALDVRDPSARSVTIALQGRAARILRCHYYFS---SQWLLLSEISFLSGK 370          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Xenopus
Match: pitpnc1l (phosphatidylinositol transfer protein cytoplasmic 1 like [Source:Xenbase;Acc:XB-GENE-5779888])

HSP 1 Score: 132.88 bits (333), Expect = 1.098e-30
Identity = 97/315 (30.79%), Postives = 153/315 (48.57%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
             P   L+  +++  G+FG + +C ++   +  T    F           VK L  D+  + +S F+ +LKILS ++  ++++L    +D D                +I +Y+   +L  FL S +     +     Q +P   IS  SL+ +  Q+ +GMK+L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWEI  LC   PYG L++E ++    ++         L  P  CP+ +Y+LM +CW+ D   RP F D+H  L
Sbjct:  557 FPRGHLLFKEKLGEGQFGEVHLCEVVNPHELPTLQFPFNMRKGRSLLVAVKLLRADANKNARSDFLKELKILSRLSDPHIIRLLGACLDED-------------PLCMITEYMENGDLNQFLSSHHLDEGEESG--AQCLP--AISYPSLLHVAVQICSGMKYLSSLNFVHRDLASRNCLVGENFTIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEILMLCKEQPYGELSDEDVIENAGEIFRDSKKQIFLFRPPPCPQPLYELMLQCWSRDCRERPSFQDIHALL 851          

HSP 2 Score: 77.0258 bits (188), Expect = 1.767e-13
Identity = 78/326 (23.93%), Postives = 139/326 (42.64%), Query Frame = 3
Query:  516 HSQSGPDDGN-AWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNN--NQWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQNGLGLLM-DNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDF------------KSITLYSVKD--FKHNIYLSGLITVTISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAK 1436
            HS+   +DG+ AWCP   +    EE+++VD R +  +  + T GR  G   K +     ++Y R     +QWR+     NE +        + L+     IIA+ +R YP+      M  CL+    GC  +D   SY +P G+++++ ++  +L D  YDG  +G LQ G    + D +   + F             + GW  ++  K  ++ + F F+  R F              I ++   D  FK +++         +  D   V+L+  +   D  A  + + +Q   ++   C    +   + ++LLSEI   S K
Sbjct:   58 HSRLESNDGDGAWCPLGPVFPNYEEFLQVDLRNLHFLTLVGTQGRDGGGLGKEFARHYQLRYSRDGFKWSQWRD--RWGNEVIEGNENTHDSVLKDLGPPIIARYVRFYPMAD--RVMSVCLRVELYGCIWQDGLRSYTSPPGNVMSLPSMLINLNDSTYDGFTVGGLQYGGLGQLTDGVIGADDFLQHKEQGVWPGYDYVGWMTSNFPKG-YLEMEFEFDALRSFIYMRVHCNNMGSGGIQIFRRVDCYFKRSLH---------TPWDPQPVTLSLALDVRDPSARSVTIALQGRAARILRCHYYFS---SQWLLLSEISFLSGK 366          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Xenopus
Match: FES (FES proto-oncogene, tyrosine kinase [Source:NCBI gene;Acc:100489191])

HSP 1 Score: 131.339 bits (329), Expect = 3.014e-30
Identity = 90/301 (29.90%), Postives = 149/301 (49.50%), Query Frame = 3
Query: 2325 VIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            V+    +I  +++ +G FG   V +  +  D+   A   VK+        +K  F+M+ +IL   +  N+VKL  I V +    I           YI+M+ + G + + FLR     N     K+ + +            +    A GM++LE     HRDLA RNC++  +  +KI   G+   + +  Y S   +  +   P++W APE++  G ++++SD+WSF V LWE F+L S VPY +++N+   +++       RL  P NCP ++Y LM RCW +D   RP F+ VH+ L
Sbjct:  555 VLEHEEVILGERIGKGNFG--EVFSGRLRADNTPVA---VKSCRDTLPPDLKDKFLMEARILKQYSHPNIVKL--IGVCTQKHPI-----------YIVMELVQGGDFQTFLR-----NEGPKLKVKELI-----------RMSENAAAGMEYLESKHCIHRDLAARNCLVTEKNVLKISDFGMSREEEDGVYSSTGGMKQI---PVKWTAPEALNYGRYSSESDVWSFGVLLWEAFSLGS-VPYATMSNQQTREIIE---QGIRLLVPDNCPDEVYSLMLRCWEYDPKKRPNFSTVHQEL 814          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Mouse
Match: Ptk7 (PTK7 protein tyrosine kinase 7 [Source:MGI Symbol;Acc:MGI:1918711])

HSP 1 Score: 144.05 bits (362), Expect = 4.071e-34
Identity = 94/321 (29.28%), Postives = 158/321 (49.22%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            P  ++ +S  +    P +SL PI  + + EFG + +       +  T     VK+L    +      F  ++++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     ++D KL +S P S     +L   +   A GM+HL      H+DLA RNC+I  +  VK+   GL     N +Y            PLRWM+PE+++ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW  +   RP F+++   L    ++S
Sbjct:  769 PATNKRHSAGDRMHFPRASLQPITTLGKSEFGEVFLAKAQGVEEGATETLVLVKSLQSRDEQQQLD-FRREVEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----NKDEKL-KSQPLSTKQKVALCSQV---ALGMEHLSNNRFVHKDLAARNCLISAQRQVKVSALGLSKDVYNSEYYHF----RQAWVPLRWMSPEAVLEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWAPNPKDRPSFSEIASTLGDSPADS 1060          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 139.428 bits (350), Expect = 6.828e-33
Identity = 101/331 (30.51%), Postives = 159/331 (48.04%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR------YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSN-VSQDFKL-TQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            PRVD           P S L   +++  G+FG + +C +     L+  D   +          VK L  D+  + ++ F+ ++KI+S +   N+++L  + V  D                +I DY+   +L  FL +    N  +Q     T+S     IS   L+ +  Q+A+GM++L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+  LC   P+G LT+E ++    +    +     L  P  CP+ +Y+LM RCW+ +   RP FA +H+FL
Sbjct:  562 PRVD----------FPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDP-------------LCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 866          

HSP 2 Score: 87.8113 bits (216), Expect = 6.283e-17
Identity = 65/238 (27.31%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  492 SAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDG-AILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLY 1196
            +AAR   + S  G  DG AWCP   +  K EE+++VD RR+ ++  + T GR  G   K ++    ++Y R +  +W ++ +   + V++ N D    +  +L   ++A+ +R YP       M  CL+    GC   D  +SY AP G  + ++ +   L D  YDG    G    GLG L D +   + F     +       + GWS  S     ++ + F F++ R F+++ ++
Sbjct:   58 TAARHSRLESSDG--DG-AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR-DGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP--RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQS-FPTGYVEMEFEFDRLRTFQTMQVH 288          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 139.428 bits (350), Expect = 8.023e-33
Identity = 101/331 (30.51%), Postives = 159/331 (48.04%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR------YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSN-VSQDFKL-TQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            PRVD           P S L   +++  G+FG + +C +     L+  D   +          VK L  D+  + ++ F+ ++KI+S +   N+++L  + V  D                +I DY+   +L  FL +    N  +Q     T+S     IS   L+ +  Q+A+GM++L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+  LC   P+G LT+E ++    +    +     L  P  CP+ +Y+LM RCW+ +   RP FA +H+FL
Sbjct:  599 PRVD----------FPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDP-------------LCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 903          

HSP 2 Score: 88.1965 bits (217), Expect = 5.846e-17
Identity = 65/238 (27.31%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  492 SAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDG-AILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLY 1196
            +AAR   + S  G  DG AWCP   +  K EE+++VD RR+ ++  + T GR  G   K ++    ++Y R +  +W ++ +   + V++ N D    +  +L   ++A+ +R YP       M  CL+    GC   D  +SY AP G  + ++ +   L D  YDG    G    GLG L D +   + F     +       + GWS  S     ++ + F F++ R F+++ ++
Sbjct:   58 TAARHSRLESSDG--DG-AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR-DGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP--RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQS-FPTGYVEMEFEFDRLRTFQTMQVH 288          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 139.428 bits (350), Expect = 8.023e-33
Identity = 101/331 (30.51%), Postives = 159/331 (48.04%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR------YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSN-VSQDFKL-TQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            PRVD           P S L   +++  G+FG + +C +     L+  D   +          VK L  D+  + ++ F+ ++KI+S +   N+++L  + V  D                +I DY+   +L  FL +    N  +Q     T+S     IS   L+ +  Q+A+GM++L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+  LC   P+G LT+E ++    +    +     L  P  CP+ +Y+LM RCW+ +   RP FA +H+FL
Sbjct:  599 PRVD----------FPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDP-------------LCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 903          

HSP 2 Score: 88.1965 bits (217), Expect = 5.846e-17
Identity = 65/238 (27.31%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  492 SAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDG-AILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLY 1196
            +AAR   + S  G  DG AWCP   +  K EE+++VD RR+ ++  + T GR  G   K ++    ++Y R +  +W ++ +   + V++ N D    +  +L   ++A+ +R YP       M  CL+    GC   D  +SY AP G  + ++ +   L D  YDG    G    GLG L D +   + F     +       + GWS  S     ++ + F F++ R F+++ ++
Sbjct:   58 TAARHSRLESSDG--DG-AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR-DGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP--RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQS-FPTGYVEMEFEFDRLRTFQTMQVH 288          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 139.428 bits (350), Expect = 8.023e-33
Identity = 101/331 (30.51%), Postives = 159/331 (48.04%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR------YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSN-VSQDFKL-TQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            PRVD           P S L   +++  G+FG + +C +     L+  D   +          VK L  D+  + ++ F+ ++KI+S +   N+++L  + V  D                +I DY+   +L  FL +    N  +Q     T+S     IS   L+ +  Q+A+GM++L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+  LC   P+G LT+E ++    +    +     L  P  CP+ +Y+LM RCW+ +   RP FA +H+FL
Sbjct:  599 PRVD----------FPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDP-------------LCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 903          

HSP 2 Score: 88.1965 bits (217), Expect = 5.846e-17
Identity = 65/238 (27.31%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  492 SAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDG-AILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLY 1196
            +AAR   + S  G  DG AWCP   +  K EE+++VD RR+ ++  + T GR  G   K ++    ++Y R +  +W ++ +   + V++ N D    +  +L   ++A+ +R YP       M  CL+    GC   D  +SY AP G  + ++ +   L D  YDG    G    GLG L D +   + F     +       + GWS  S     ++ + F F++ R F+++ ++
Sbjct:   58 TAARHSRLESSDG--DG-AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR-DGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP--RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQS-FPTGYVEMEFEFDRLRTFQTMQVH 288          
BLAST of Epithelial discoidin domain-containing receptor vs. UniProt/SwissProt
Match: sp|Q13308|PTK7_HUMAN (Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 1.567e-34
Identity = 101/320 (31.56%), Postives = 160/320 (50.00%), Query Frame = 3
Query: 2295 DQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM--LIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            ++ +S S+    P SSL PI  + + EFG + +     L EG  +T     VK+L    +      F  +L++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     S+D KL +S P S     +L   +   A GM+HL      H+DLA RNC++  +  VK+   GL     N +Y            PLRWM+PE+I+ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW      RP F+++   L   T +S
Sbjct:  780 NKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLV--LVKSLQSKDEQQQLD-FRRELEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----SKDEKL-KSQPLSTKQKVALCTQV---ALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHF----RQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDS 1068          
BLAST of Epithelial discoidin domain-containing receptor vs. UniProt/SwissProt
Match: sp|Q8BKG3|PTK7_MOUSE (Inactive tyrosine-protein kinase 7 OS=Mus musculus OX=10090 GN=Ptk7 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.847e-33
Identity = 94/321 (29.28%), Postives = 158/321 (49.22%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            P  ++ +S  +    P +SL PI  + + EFG + +       +  T     VK+L    +      F  ++++   +N +N+V+L  +  +++               Y++++Y++  +LK FLR +     ++D KL +S P S     +L   +   A GM+HL      H+DLA RNC+I  +  VK+   GL     N +Y            PLRWM+PE+++ G F+TKSD+W+F V +WE+FT   +   G   +E L DL + +    RLP P+ CP  +Y LM RCW  +   RP F+++   L    ++S
Sbjct:  769 PATNKRHSAGDRMHFPRASLQPITTLGKSEFGEVFLAKAQGVEEGATETLVLVKSLQSRDEQQQLD-FRREVEMFGKLNHANVVRLLGLCREAEP-------------HYMVLEYVDLGDLKQFLRISK----NKDEKL-KSQPLSTKQKVALCSQV---ALGMEHLSNNRFVHKDLAARNCLISAQRQVKVSALGLSKDVYNSEYYHF----RQAWVPLRWMSPEAVLEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKA---RLPQPEGCPSKLYRLMQRCWAPNPKDRPSFSEIASTLGDSPADS 1060          
BLAST of Epithelial discoidin domain-containing receptor vs. UniProt/SwissProt
Match: sp|Q63474|DDR1_RAT (Epithelial discoidin domain-containing receptor 1 OS=Rattus norvegicus OX=10116 GN=Ddr1 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.600e-32
Identity = 99/336 (29.46%), Postives = 159/336 (47.32%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR------YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXX-------XXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            PRVD           P S L   +++  G+FG + +C +     L+  D   + +        VK L  D+  + ++ F+ ++KI+S +   N+++L  + V  D                +I DY+   +L  FL +    N     K+TQ +P  + S             +  Q+A+GM++L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+  LC   P+G LT+E ++    +    +     L  P  CP+ +Y+LM RCW+ +   RP F+ +H+FL
Sbjct:  598 PRVD----------FPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVTSDFPISVQKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDLNIIRLLGVCVQDDP-------------LCMITDYMENGDLNQFLSAHQLEN-----KVTQGLPGDRESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFSQLHRFL 902          

HSP 2 Score: 85.1149 bits (209), Expect = 3.097e-15
Identity = 66/240 (27.50%), Postives = 115/240 (47.92%), Query Frame = 3
Query:  492 SAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLR-TIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDG-AILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDP--FIIIRFHFEQERDFKSITLY 1196
            +AAR   + S  G  DG AWCP   +  K EE+++VD RR+ ++  + T GR  G   K ++    ++Y R +  +W ++ +   + V++ N D    +  +L   ++A+ +R YP       M  CL+    GC   D  +SY AP G  + ++ + + L D  YDG    G    GLG L D +   + F     +       + GW   S H  P  ++ + F F++ R F+++ ++
Sbjct:   58 TAARHSRLESSDG--DG-AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR-DGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP--RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEMVY-LNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGW---SNHSFPSGYVEMEFEFDRLRSFQTMQVH 287          
BLAST of Epithelial discoidin domain-containing receptor vs. UniProt/SwissProt
Match: sp|Q03146|DDR1_MOUSE (Epithelial discoidin domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ddr1 PE=2 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 5.612e-32
Identity = 101/331 (30.51%), Postives = 159/331 (48.04%), Query Frame = 3
Query: 2286 PRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR------YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSN-VSQDFKL-TQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            PRVD           P S L   +++  G+FG + +C +     L+  D   +          VK L  D+  + ++ F+ ++KI+S +   N+++L  + V  D                +I DY+   +L  FL +    N  +Q     T+S     IS   L+ +  Q+A+GM++L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+  LC   P+G LT+E ++    +    +     L  P  CP+ +Y+LM RCW+ +   RP FA +H+FL
Sbjct:  599 PRVD----------FPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDP-------------LCMITDYMENGDLNQFLSARQLENKATQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 903          

HSP 2 Score: 88.1965 bits (217), Expect = 4.089e-16
Identity = 65/238 (27.31%), Postives = 113/238 (47.48%), Query Frame = 3
Query:  492 SAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDG-AILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLY 1196
            +AAR   + S  G  DG AWCP   +  K EE+++VD RR+ ++  + T GR  G   K ++    ++Y R +  +W ++ +   + V++ N D    +  +L   ++A+ +R YP       M  CL+    GC   D  +SY AP G  + ++ +   L D  YDG    G    GLG L D +   + F     +       + GWS  S     ++ + F F++ R F+++ ++
Sbjct:   58 TAARHSRLESSDG--DG-AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR-DGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP--RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQS-FPTGYVEMEFEFDRLRTFQTMQVH 288          
BLAST of Epithelial discoidin domain-containing receptor vs. UniProt/SwissProt
Match: sp|Q7YR43|DDR1_PANTR (Epithelial discoidin domain-containing receptor 1 OS=Pan troglodytes OX=9598 GN=DDR1 PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.198e-31
Identity = 98/333 (29.43%), Postives = 159/333 (47.75%), Query Frame = 3
Query: 2307 SDSNIRV-IPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR------YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLT--QSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNST 3251
             D   RV  P S L   +++  G+FG + +C +     L+  D     R        VK L  D+  + ++ F+ ++KI+S +   N+++L  + V  D                +I DY+   +L  FL +    + + +      Q+     IS   L+ +  Q+A+GM++L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+  LC   P+G LT+E ++    +    +     L  P  CP+ +Y+LM RCW+ +   RP F+ +H+FL     N+ 
Sbjct:  593 GDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDP-------------LCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV 909          

HSP 2 Score: 82.0333 bits (201), Expect = 2.827e-14
Identity = 62/230 (26.96%), Postives = 110/230 (47.83%), Query Frame = 3
Query:  516 HSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQK-YTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNL-RTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDG-AILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLY 1196
            HS  G  DG AWCP  ++  K EE+++VD +R+ ++  + T GR  G   K ++    ++Y R +  +W  + +   + V++ N D    +  +L   ++A+ +R YP       M  CL+    GC   D  +SY AP G  + ++   + L D  YDG  + G    GLG L D +   + F     +       + GWS  S     ++ + F F++ R F+++ ++
Sbjct:   61 HSSDG--DG-AWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR-DGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYP--RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVY-LNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHS-FSSGYVEMEFEFDRLRAFQAMQVH 282          
BLAST of Epithelial discoidin domain-containing receptor vs. TrEMBL
Match: A0A4Z2DC18 (Discoidin domain-containing receptor 2 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_002553 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.530e-41
Identity = 106/313 (33.87%), Postives = 158/313 (50.48%), Query Frame = 3
Query:  318 WI--LFFIVIYNCLISAVKAFQESVRFSDNETNCISYLM-SPKYLTDDQFSASSF---EYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIA--------NISFDLRDYIYDGAILGT---LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKI-FTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS 1199
            WI  LF +  +   ++  KA Q   R    +  C   L+ S     D  FS+SS       FQP  ARL EV+  S    G AWCPN ++     EWI+ +F  +VII  I+T GR DGN ++Y P  +++Y+R +N  W  +V  +   VL  N D R   R+ L + +IAKRIRIYP  S  S  + CL+FA  GC   D  +SY  PQGD++T          +I    +D  YDG ++ +   L  G+G LMDN+A+       ++ +  +    F GW   S+     + I F F++ R+F  + +++
Sbjct:    8 WITLLFILCSFILTVNTYKAEQIIRRGPGQDPQCADPLINSIDTFPDTSFSSSSVWKNATDFQPFRARLTEVYGSSEHTSGYAWCPNTHVEDGLREWIQAEFSHLVIISVIFTAGRGDGNVKEYMPNFVLRYQREDNGVWYEHVKSDGTRVLKANNDPRNIARTTLDSVVIAKRIRIYPY-SHRSKQQVCLRFALYGCDFPDGVISYSMPQGDIVTYGRQLFGSPYSIPQSFQDLTYDGQLIESENQLIGGIGQLMDNVAYLGNVSQHSDSHPTQPGFHFIGWHIPSKD----LRILFKFDEVRNFIWLRIFT 315          
BLAST of Epithelial discoidin domain-containing receptor vs. TrEMBL
Match: A0A4E0RMB2 (Discoidin domain-containing receptor 2 OS=Fasciola hepatica OX=6192 GN=D915_000498 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.535e-40
Identity = 114/341 (33.43%), Postives = 165/341 (48.39%), Query Frame = 3
Query:  315 FWILFFIVIYNCL-------ISAVKAFQESVRFSDNETNCISYLM-SPKYLTDDQFSASSF---EYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLIT-----------IANISFDLRDYIYDGAILGT---LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKI-FTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTIS 1256
             +IL ++ IY  L       I   K  +   R    ++ C+S L+ S +   D  FSASS      +FQP  ARL +V+       G+AWCPN  I     EWI+ +F  +V+I  I+T GR DGN +++ P  ++KY+R +N  W  +V  +   VL  N+D R   R+ L + +IAKRIRIYP  S     + CL+FA LGC   D  VSY  PQG   +           I + S + RD  YDG ++GT   L +G+G LMDN+A+         +   K    F GW    +H    + I F F+  R F  + L++         L   ++V  S
Sbjct:    1 MYILSYLRIYFLLNALRFGTIQCSKNVRTVRRGLGPDSQCMSPLIKSHEEFPDSAFSASSTLEDRTEFQPHQARLPDVYGSKEHTSGHAWCPNTPIEESLREWIQAEFSDLVMIGAIFTAGRGDGNVKEFMPNFVLKYQREDNGPWYEHVKRDGTRVLRANSDPRNLARATLDSMVIAKRIRIYPY-SRDGKQQVCLRFALLGCKFPDGVVSYGMPQGGDRSYSTSPVPLGNPIGSFSANFRDLSYDGQLVGTNDHLTDGMGQLMDNVAYLGNVTTPLAMYPSKPGFHFVGW---YQHGQTDVPIVFKFDTARTFTWVRLFTFDSIPLRARLFSRVSVAFS 337          
BLAST of Epithelial discoidin domain-containing receptor vs. TrEMBL
Match: A0A504XNQ2 (Discoidin domain-containing receptor 2 OS=Fasciola gigantica OX=46835 GN=FGIG_00304 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.708e-40
Identity = 114/341 (33.43%), Postives = 165/341 (48.39%), Query Frame = 3
Query:  315 FWILFFIVIYNCL-------ISAVKAFQESVRFSDNETNCISYLM-SPKYLTDDQFSASSF---EYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLIT-----------IANISFDLRDYIYDGAILGT---LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKI-FTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTIS 1256
             +IL ++ IY  L       I   K  +   R    ++ C+S L+ S +   D  FSASS      +FQP  ARL +V+       G+AWCPN  I     EWI+ +F  +V+I  I+T GR DGN +++ P  ++KY+R +N  W  +V  +   VL  N+D R   R+ L + +IAKRIRIYP  S     + CL+FA LGC   D  VSY  PQG   +           I + S + RD  YDG ++GT   L +G+G LMDN+A+         +   K    F GW    +H    + I F F+  R F  + L++         L   ++V  S
Sbjct:    1 MYILSYLRIYVLLNALRFGAIQCSKNVRTVRRGLGPDSQCMSPLIKSHEEFPDSAFSASSTLEDRTEFQPYQARLPDVYGSKEHTSGHAWCPNTPIEESLREWIQAEFSDLVMIGAIFTAGRGDGNVKEFMPNFVLKYQREDNGPWYEHVKRDGTRVLRANSDPRNLARATLDSMVIAKRIRIYPY-SRDGKQQVCLRFALLGCKFPDGVVSYGMPQGGDRSFSTNPVPLGNPIGSFSANFRDLSYDGQLVGTNDHLTDGMGQLMDNVAYLGNVTTPLAMYPSKPGFHFVGW---YQHGQTDVPIVFKFDTARTFTWVRLFTFDSIPLRARLFSRVSVAFS 337          
BLAST of Epithelial discoidin domain-containing receptor vs. TrEMBL
Match: A0A4S2LFH7 (F5/8 type C domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007544 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 6.899e-40
Identity = 115/348 (33.05%), Postives = 170/348 (48.85%), Query Frame = 3
Query:  315 FWI-LFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSP-KYLTDDQFSASSF---EYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIAN-------------ISFDLRDYIYDGAILGT---LQNGLGLLMDNIAWRNKF----DLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS-------VKDFKHNIYLSGLITVTISD 1259
            +WI ++  ++ +    + K  Q   R   ++ +C+S L+S      D  FSASS    +  FQP  ARL +V+       G AWCPN  +     EWI+ +F  +VIIK I+T GR DGN +++ P  ++KY+R +   W  +V  +   +L  N+D R   R+ L + +IAKR+RIYP  S   S   CL+FA  GC   D  VSY  PQG L T  +             ++  L+D  YDG I+ T   L +GLG LMDN+A+        DL+ +  G     F GW    + +   I + F F+  R F  I L++       V+ F H +    +   T SD
Sbjct:    7 YWINVWVAILMSGFAQSFKPEQIVRRGPGSDLHCMSPLISAYDEFPDSAFSASSVLQNKTDFQPYQARLTDVYGSKEHTSGYAWCPNSMVDEMLREWIQAEFSDLVIIKSIFTAGRGDGNVKEFMPSFVLKYQREDGGTWYEHVKRDGARILKANSDPRNLARATLDSVVIAKRVRIYPY-SRKGSRDVCLRFALYGCKFPDGVVSYTIPQGGLRTQTSFRSPALGDPLEPVVARHLKDLSYDGQIIPTTYQLTDGLGQLMDNVAFLGNLTRESDLYPSQPGFH---FVGWPQGEQSE---IQLIFKFDTTRRFTWIRLFTFDSLILRVRLFSHAMVAFSMNGSTFSD 347          
BLAST of Epithelial discoidin domain-containing receptor vs. TrEMBL
Match: A0A4V3SDW4 (F5/8 type C domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007544 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 7.639e-40
Identity = 115/348 (33.05%), Postives = 170/348 (48.85%), Query Frame = 3
Query:  315 FWI-LFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSP-KYLTDDQFSASSF---EYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIAN-------------ISFDLRDYIYDGAILGT---LQNGLGLLMDNIAWRNKF----DLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS-------VKDFKHNIYLSGLITVTISD 1259
            +WI ++  ++ +    + K  Q   R   ++ +C+S L+S      D  FSASS    +  FQP  ARL +V+       G AWCPN  +     EWI+ +F  +VIIK I+T GR DGN +++ P  ++KY+R +   W  +V  +   +L  N+D R   R+ L + +IAKR+RIYP  S   S   CL+FA  GC   D  VSY  PQG L T  +             ++  L+D  YDG I+ T   L +GLG LMDN+A+        DL+ +  G     F GW    + +   I + F F+  R F  I L++       V+ F H +    +   T SD
Sbjct:    7 YWINVWVAILMSGFAQSFKPEQIVRRGPGSDLHCMSPLISAYDEFPDSAFSASSVLQNKTDFQPYQARLTDVYGSKEHTSGYAWCPNSMVDEMLREWIQAEFSDLVIIKSIFTAGRGDGNVKEFMPSFVLKYQREDGGTWYEHVKRDGARILKANSDPRNLARATLDSVVIAKRVRIYPY-SRKGSRDVCLRFALYGCKFPDGVVSYTIPQGGLRTQTSFRSPALGDPLEPVVARHLKDLSYDGQIIPTTYQLTDGLGQLMDNVAFLGNLTRESDLYPSQPGFH---FVGWPQGEQSE---IQLIFKFDTTRRFTWIRLFTFDSLILRVRLFSHAMVAFSMNGSTFSD 347          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Cavefish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 134.806 bits (338), Expect = 1.368e-31
Identity = 108/342 (31.58%), Postives = 174/342 (50.88%), Query Frame = 3
Query: 2271 YHSPFPRVDQ-NNSDSNIRVIPISSLIPIQQVIRGEFGTISVCT------MLIEG-----DHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSH--RNNTPRL--PCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            Y  P   VD     D ++   P   LI  +++  G+FG + +C        L EG         +    VK L  D+ S+ ++ F+ ++KI+S +N  N+++L  + V SD                ++ +Y+   +L  FL     S    +  LT +     +S++ L+ +  Q+A+GMK+L  L   HRDLA RNC++D ++ +KI   G+     + DY  ++        P+RWMA ESI+ G FTT SD+W+F VTLWEIFTLC+  PY  LT+E +++      RN   ++    P  CP  +Y+LM RCW+ D   RP F+ +++ L+    +S
Sbjct:  507 YSVPAVTVDSLTRKDISVAEFPRERLIFREKLGEGQFGEVHLCEAEGLAEFLGEGAPLPEQDGRSVLVAVKQLRADATSNARNDFLKEIKIMSRLNDPNIIRLLCVCVRSD-------------PLCMVTEYMENGDLNMFL-----SQRELESTLTHANNIPSVSMADLLHMAVQIASGMKYLASLNFVHRDLATRNCLLDRQLTIKISDFGMSRNLYSSDYYRIQ---GRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCTEQPYSLLTDEQVIENSGEFFRNQGRQIYLSPPPLCPPSLYELMMRCWSRDIRDRPSFSSLYQALRPHAHHS 827          

HSP 2 Score: 58.5362 bits (140), Expect = 4.428e-8
Identity = 73/349 (20.92%), Postives = 139/349 (39.83%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEYKFQ-PSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFD-LRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDP----FIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVT-----ISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSA 1433
            M    + +D  +ASS  Y+   P   RL   + + G  DG AWCP   +     ++++VD R++  +  + T GR A  +  ++  +  + Y R + ++W ++ N     ++  N                       +N+ AS           GC  +D   +Y AP+G  +         L D  YDG +    L  GLG L D +  ++ F     V   + +++ G+       D     ++ + F F+++R+F S+ ++    F   + +   ++       IS+ +   V  +  +   D + +   VTV L    G           + +++ SEI   SA
Sbjct:   28 MEDGRIKNDDITASSQWYETTGPQYGRL---NKEEG--DG-AWCPAGQLQPSDVQYLQVDLRQLTFVTVVATQGRYARSSGNEFARKYRLDYSR-DGHRWISWRNRYGSEIIKGN-----------------------VNTYAS--------VVFGCPWQDGLTAYSAPEGQTMMAPGFPNTLLNDSTYDGVLERRKLLGGLGQLTDGVIGQDDF-----VQTRQYQLWPGYDYLGWRNDSLGPGYVEMEFQFDRQRNFTSMKVHCNNMFSRGVKVFSSVSCVFKPHLISEWEAEPVVFSTVL--DDRNPSARYVTVPLLQRSGTATRCRFFFA-DTWMMFSEISFHSA 330          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Cavefish
Match: ENSAMXT00000019857.2 (discoidin domain-containing receptor 2-like [Source:NCBI gene;Acc:103025914])

HSP 1 Score: 134.806 bits (338), Expect = 1.582e-31
Identity = 93/319 (29.15%), Postives = 152/319 (47.65%), Query Frame = 3
Query: 2310 DSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGDHQTTAR----YFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            D  +   P   L   +++  G+FG + +C        ++ D            VK L  D+  + ++ F+ +++I+S +   N+++L  + V+SD                +I +Y+   +L  FL      +  ++ K T S     IS S+L+ + TQ+A+GMK+L  L   HRDLA RNC++     +KI   G+       DY  ++        P+RWM+ ESI+ G FT  SD+W+F VTLWE  TLC   PY  L+++ ++    +    +N    LP P  CP  ++ LM  CW  +   RP F  +H  L
Sbjct:  546 DGALEEFPREKLTFKEKLGEGQFGEVHLCEANGMQDFMKEDEDGVENEPILVAVKTLREDATKNTRNDFLKEIRIMSRLRDPNIIRLLAVCVESD-------------PLCMITEYMENGDLNKFLSRHKLQDSGEEQKDTSS----TISYSTLIRMATQIASGMKYLSSLNFVHRDLATRNCLVGTNYTIKIADFGMSRNLYRGDYYRIQ---GRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWETLTLCKEQPYSQLSDDQVIENTGEFFRDQNKQVYLPRPACCPDAVHSLMQSCWRRNAKERPSFQHIHSTL 844          

HSP 2 Score: 101.679 bits (252), Expect = 2.577e-21
Identity = 106/407 (26.04%), Postives = 181/407 (44.47%), Query Frame = 3
Query:  318 WILFFIVIYNCLISAVKAFQESVRFSDNETNCISYL-MSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGN-AWCPNKNIHSKP-EEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITV--------TISDRDNNQVSLNATIAGGDSDANELLVTVQLNH--SKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKR--PAIH 1487
            W +F +++   + S V           N   C   L M+   + D+  SASS     + +AAR    + +   DDG+ AWCP+    +K  +E++++D R +  +  + T GR ADG   ++     IKY R +  +W ++ + N   V+  N +    +  +L   IIA+ +R  P++    SM  C++    GC   D  VSY AP G  +T  N+   L D +YDG +  ++  GLG L D     + F             + GW+ AS       ++ F F++ R+F S+ ++      +N+Y SG+           + SD +   VS        ++ A    VTV L H  +    C    +   + +++ SEI  +S  ++  N +  P KR  P+ H
Sbjct:    6 WHIFLVILSGAVRSQV-----------NPGVCRYPLGMTGGKIQDEDISASS--QWSESTAAR----YGRLDFDDGDGAWCPDVVAEAKSLKEFLQIDLRTLHFVTLVGTQGRHADGMGNEFAQSYRIKYSR-DGVRWVSWHDRNGGQVIDGNKNPYEVVLKDLEPPIIARFVRFMPVSD--PSMTVCMRVELYGCEWLDGLVSYSAPVGQEMTFQNLHVYLNDTVYDGTVDHSMTEGLGQLTDGSWGLDNFTQSQVYGVWPGYDYVGWTNASFPSGSVEMV-FEFDRVRNFTSMKVHC-----NNMYTSGVRAFQQAVCYFRSESDWEARPVSFKPEADNTNTSAR--FVTVALGHRMASAIKCRFAFS---DAWMMFSEIAFQSGTAV-YNTSLIPRKRGHPSAH 380          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 130.568 bits (327), Expect = 3.740e-30
Identity = 95/331 (28.70%), Postives = 150/331 (45.32%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVI-------DLRM---HVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSN 3245
            +P   LI  +++  G+FG + +C +    D       F           VK L  D+  + ++ F+ ++KILS +   N+++L  + V SD                ++ +Y+   +L  +L      + +     T ++ Y  +   +  I     A+GMK L  L   HRDLA RNC++       + RM   H+KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+ ++C   PY  +T+E ++D              L  P  CP+ +Y+LM  CWN D   RP F  +H FL     N
Sbjct:  681 LPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSSD-------------PLCMVTEYMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQI-----ASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQIYLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAMN 990          

HSP 2 Score: 102.449 bits (254), Expect = 1.702e-21
Identity = 66/228 (28.95%), Postives = 112/228 (49.12%), Query Frame = 3
Query:  525 SGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS 1199
            +G  DG AWCP   +     E+++V+  ++  +  + T GR ADG+ +++     ++Y R +  QW  + +   + V++ N +    +  +L   IIA+ +R YP+      M  CL+    GC   D   +Y AP G ++ ++     L D IYDG+I  GTL  GLG L D +   + F     +       + GWS  +  + P + I FHFE+ R F  + ++S
Sbjct:   89 TGEGDG-AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR-DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLAD--RVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPIYLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQ-PTVDIEFHFEKTRIFHVMQVHS 311          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 130.568 bits (327), Expect = 3.896e-30
Identity = 95/331 (28.70%), Postives = 150/331 (45.32%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVI-------DLRM---HVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSN 3245
            +P   LI  +++  G+FG + +C +    D       F           VK L  D+  + ++ F+ ++KILS +   N+++L  + V SD                ++ +Y+   +L  +L      + +     T ++ Y  +   +  I     A+GMK L  L   HRDLA RNC++       + RM   H+KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+ ++C   PY  +T+E ++D              L  P  CP+ +Y+LM  CWN D   RP F  +H FL     N
Sbjct:  662 LPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSSD-------------PLCMVTEYMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQI-----ASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQIYLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAMN 971          

HSP 2 Score: 102.449 bits (254), Expect = 1.719e-21
Identity = 66/228 (28.95%), Postives = 112/228 (49.12%), Query Frame = 3
Query:  525 SGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS 1199
            +G  DG AWCP   +     E+++V+  ++  +  + T GR ADG+ +++     ++Y R +  QW  + +   + V++ N +    +  +L   IIA+ +R YP+      M  CL+    GC   D   +Y AP G ++ ++     L D IYDG+I  GTL  GLG L D +   + F     +       + GWS  +  + P + I FHFE+ R F  + ++S
Sbjct:   70 TGEGDG-AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR-DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLAD--RVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPIYLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQ-PTVDIEFHFEKTRIFHVMQVHS 292          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 130.568 bits (327), Expect = 3.994e-30
Identity = 95/331 (28.70%), Postives = 150/331 (45.32%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVI-------DLRM---HVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSN 3245
            +P   LI  +++  G+FG + +C +    D       F           VK L  D+  + ++ F+ ++KILS +   N+++L  + V SD                ++ +Y+   +L  +L      + +     T ++ Y  +   +  I     A+GMK L  L   HRDLA RNC++       + RM   H+KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+ ++C   PY  +T+E ++D              L  P  CP+ +Y+LM  CWN D   RP F  +H FL     N
Sbjct:  624 LPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSSD-------------PLCMVTEYMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQI-----ASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQIYLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAMN 933          

HSP 2 Score: 102.449 bits (254), Expect = 1.762e-21
Identity = 66/228 (28.95%), Postives = 112/228 (49.12%), Query Frame = 3
Query:  525 SGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS 1199
            +G  DG AWCP   +     E+++V+  ++  +  + T GR ADG+ +++     ++Y R +  QW  + +   + V++ N +    +  +L   IIA+ +R YP+      M  CL+    GC   D   +Y AP G ++ ++     L D IYDG+I  GTL  GLG L D +   + F     +       + GWS  +  + P + I FHFE+ R F  + ++S
Sbjct:   70 TGEGDG-AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR-DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLAD--RVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPIYLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQ-PTVDIEFHFEKTRIFHVMQVHS 292          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 2.580e-31
Identity = 84/292 (28.77%), Postives = 145/292 (49.66%), Query Frame = 3
Query: 2352 IQQVIRGEFGTI--SVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTY--YSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADV 3215
            ++++ +G FG +   +   +++G+ +T  R  +K +N  +    +  F+ +  ++ S NC ++V+L             L  V ++    +IM+ +   +LK +LRS      + ++   L +       SL  ++ +  ++A+GM +L      HRDLA RNC++     VKI   G+       DY        L   P+RWM+PES+  GVFTT SD+WSF V LWEI T     PY  L+NE +L  +    +   L  P  CP+ + +L+ +CW ++   RP F ++
Sbjct:   16 MRELGQGTFGMVYEGLARGIVKGEDET--RVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRL-------------LGVVSQAQPILVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLL---PVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAE-QPYQGLSNEQVLKFVM---DGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 285          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 4.320e-31
Identity = 83/290 (28.62%), Postives = 143/290 (49.31%), Query Frame = 3
Query: 2352 IQQVIRGEFGTI--SVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADV 3215
            ++++ +G FG +   +   +++G+ +T  R  +K +N  +    +  F+ +  ++ S NC ++V+L             L  V ++    +IM+ +   +LK +LRS       +  +   S+P        ++ +  ++A+GM +L      HRDLA RNC++     VKI   G+       DY        L   P+RWM+PES+  GVFTT SD+WSF V LWEI T     PY  L+NE +L  +    +   L  P  CP+ + +L+ +CW ++   RP F ++
Sbjct:   64 MRELGQGTFGMVYEGLARGIVKGEDET--RVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRL-------------LGVVSQAQPILVIMELMTRGDLKSYLRSLRPDAEKKPTRPPSSLP-------EMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLL---PVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAE-QPYQGLSNEQVLKFVM---DGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEI 324          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 2.917e-30
Identity = 68/172 (39.53%), Postives = 91/172 (52.91%), Query Frame = 3
Query: 2766 ANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNSTSQAQIILPAP 3281
            A GM +L E    HRDLA RNC++  R+ VKI   GL  +    DY      N     P+RWM PESI    +T++SD+W+F V LWEIF+   L PY  +++E ++  +   N    L CP  CP D+Y+LM  CW    + RP FA V   L      +   AQ+  PAP
Sbjct:   94 AAGMAYLAERKFVHRDLATRNCLVGNRLVVKISDFGLSQSIYAADYYKA---NENDAIPIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSH-GLQPYFGMSHEEVIYFVRDGN---VLACPDGCPLDLYNLMRLCWAHAPADRPSFASVQHVL------ARMHAQLTAPAP 252          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Sea Lamprey
Match: fer (fer (fps/fes related) tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-060526-234])

HSP 1 Score: 124.79 bits (312), Expect = 4.031e-29
Identity = 77/255 (30.20%), Postives = 123/255 (48.24%), Query Frame = 3
Query: 2487 FIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNST 3251
            F+M+ +IL   N  N+V+L  +               + T  YI+M+ + G +   FLR            + Q + YS+ +           A GM +LE     HRDLA RNC++     +KI   G+   + +  Y +  ++  +   P++W APE++  G +TT SD+WS+ + LWEIF+L S  PY   +N+   + ++   +  R+P P  CP  IY LM RCW +    RP F ++H+ L   T   T
Sbjct:  601 FLMEARILKRYNHPNVVRLIGVCT-------------RRTPVYIVMELVRGGDFLTFLRRE-----GSRLSVPQLLNYSEQA-----------AAGMAYLESHNCIHRDLAARNCLVGEASVLKISDFGMSRQQADGVYLATGVMRQI---PIKWTAPEALHYGTYTTMSDVWSYGILLWEIFSLGS-SPYPGWSNKMACEQVA---SGYRMPPPAVCPDGIYSLMLRCWEFHAEQRPTFTELHRELSLITRKHT 819          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007292.1 (pep scaffold:Pmarinus_7.0:GL476471:161062:207122:1 gene:ENSPMAG00000006520.1 transcript:ENSPMAT00000007292.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 5.718e-29
Identity = 97/344 (28.20%), Postives = 151/344 (43.90%), Query Frame = 3
Query: 2271 YHSPFPRVDQNNSDSNIRVIPISSLIPIQQVI-RGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYS-NVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADV----HKFLQFKTS-NSTSQAQIILPAP 3281
            Y  PF   D N +          S I I++VI  GE G +    + + G  Q  A   +K L        +  F+ +  I+      ++++LE +             V KS    II +++   +L  FLR      NV Q   + + +                 A GMK+L ++   HRDLA RN ++D ++  K+   GL  ++  ED        H    P+RW APE+I    FT+ SD+WSF V +WE+ +     PY  + N+   D++       RLP P +CP  ++ LM  CW  + + RP FA +     K LQ   S ++TSQ+ + L  P
Sbjct:  605 YVDPFTYEDPNKAVQEFAREIEPSWITIEKVIGSGESGEVCRGRLRVPG--QAEAPVAIKTLKAGYSEKQRRDFLSEASIMGQFEHPSIIRLEGV-------------VTKSKPVMIITEFMENGSLDAFLRGNDGQFNVGQLVGMLRGI-----------------AAGMKYLSDMNYIHRDLAARNVLVDSKLVCKVSDFGL--SRGLEDDPQAVYTTHGGKIPIRWTAPEAIAFRKFTSASDVWSFGVLMWEVMSYGER-PYWDMNNQ---DVIQAIEEGYRLPAPMDCPPALHQLMLDCWQKERTERPNFAQILAYLDKLLQNPASLHATSQSSVELSNP 910          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 59.6918 bits (143), Expect = 1.903e-9
Identity = 46/161 (28.57%), Postives = 80/161 (49.69%), Query Frame = 3
Query: 2769 NGMKHL-EELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLV-TF--PLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSL--TNEALLDLMSHRNN--TPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            NG+ HL  +  + HRD+   N +I+ +  +K+   G+          S +++N +  TF     +M+PE I   V++ K D+WS  + + E+ T     P G    T + +LDL+    N  +PRLP  +   K++ D +NRC   +E  R   + +H+ L
Sbjct:  316 NGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGV----------SKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVT--GEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERER---SSIHELL 461          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 55.8398 bits (133), Expect = 4.294e-8
Identity = 59/231 (25.54%), Postives = 99/231 (42.86%), Query Frame = 3
Query: 2559 DSDMSNIDLF---SVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVT--TKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFK 3236
            DS   NI  F    +I     ++IM+Y+ G  L D L +   SN  +      S P ++  ++ ++        G+K L    + HRD+   N +++ +  VKI   G     T+      +M      V  P  WMAPE +    +  K D+WS  + L E+       PY +      L L+++ N +P+L  P++  K     ++ C   +  +R   A V K L F+
Sbjct:  428 DSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGE-----HSSPLNENQMAYIVKET---CQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATM------VGTPY-WMAPEIVNQKGYDEKVDVWSLGIMLIEMIE--GEPPYLNEDPLKALYLIAN-NGSPKLRHPESVSKQTKQFLDACLQVNVESR---ASVRKLLTFE 637          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 50.447 bits (119), Expect = 1.818e-6
Identity = 49/187 (26.20%), Postives = 85/187 (45.45%), Query Frame = 3
Query: 2772 GMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNSTSQAQIILPAPPPDDHT-S*FSWDSSLK 3329
            G+K+L   G+ HRD+   N ++     VK+   G V+T  N    ++          L WMAPE +     +T SDIWS   T+ E+ T     PY +LT+  +   + +    P    P +  + + D +++C+  +   RP  AD  + L+    NST   ++       +D T + + WD+  +
Sbjct:  133 GLKYLHGEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTL-------AGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNP--PYHNLTDANIYYAVENDTYYP----PSSFSEPLKDFLSKCFVKNMYKRPT-AD--QLLKHVWINSTENVKVDKLNKFKEDFTDADYHWDADFQ 302          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 48.9062 bits (115), Expect = 5.490e-6
Identity = 46/191 (24.08%), Postives = 79/191 (41.36%), Query Frame = 3
Query: 2610 FYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVT--TKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDL-MSHRNNTPRLPCPQNCPKDIYDLMNRC 3173
             +++M+++ G +L D + ++  ++ S        + Y                 G+K L +  + HRD+   N ++D R  VKI   G     T       +M      V  P  WMAPE +    +  K D+WS  +   E+  L    PY  L  + L  L +   N TP+L  P++   +I   ++ C
Sbjct:  636 LWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRET----------CQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATM------VGTPY-WMAPEVVKQREYDEKIDVWSLGIMTIEM--LEGEPPY--LNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVC 805          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Nematostella
Match: EDO44269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW90])

HSP 1 Score: 139.813 bits (351), Expect = 5.945e-37
Identity = 89/263 (33.84%), Postives = 134/263 (50.95%), Query Frame = 3
Query: 2487 FIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFL--RSTYYSNVSQDFKLT-QSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD---LMSHRNNTPR---LPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNS 3248
            F  ++KI++ +   N+V+L  +  D  M               +I++Y+   +L  FL  R     N +   K+T Q++ Y  + L          A GMK++      HRDLA RNC++     VKI   G+     ++ Y  ++     V  P+RWMAPE I+ G FT+ SD+W+F VTLWEI TL +  PYG LT+E +++   LM  R  +     L  P+ CP D+Y  M  CW  + SARP F D+H FL+ + + S
Sbjct:   14 FFKEVKIMAGVRHENVVRLLGVCKDDPMC--------------MIVEYMENGDLNQFLKQRELASGNSADPNKVTYQALLYMALQL----------AAGMKYIASHQFVHRDLATRNCLVGHSFTVKIADFGMSRHLYSKHYYRIQ---GRVILPIRWMAPECILQGKFTSASDVWAFGVTLWEILTLAAEYPYGDLTDEKVIENVQLMFFRPKSDAITFLSRPEICPPDVYAKMRSCWAIEPSARPDFHDIHSFLENRVALS 249          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 127.102 bits (318), Expect = 4.606e-32
Identity = 85/307 (27.69%), Postives = 149/307 (48.53%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGD------HQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            +P   +  I+++  G FG      M+ EG+      ++   +  VK ++ ++    +  F+ +  I+ +  C+++V+L  +  D   +              ++M+ ++  +LK+FLRS          ++T        +L  ++ +  ++A+GM +L      HRDLA RNC+++  + VKI   G+       DY        L   P+RWMAPES+  GVFT+ SD+WSF V +WE+ TL S  PY   +NE +L  +      P+   P +CP  ++DLM  CW +   ARP F  +   ++
Sbjct:   13 VPREKIKLIRELGNGSFG------MVYEGEATDIVPNKPKCKVAVKTVSENASIRDRIEFLQEASIMKAFQCNHVVRLLGVVSDGQPT-------------LVVMELMDNGDLKNFLRS-------HRPEVTMESDEPPPTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNANLTVKIGDFGMTRDIYETDYYRKGGKGLL---PVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQ-PYPGKSNEEVLKYVVDGGVMPK---PDDCPDRLFDLMTLCWQFSPKARPTFLSIISLIE 286          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 126.331 bits (316), Expect = 7.626e-32
Identity = 77/255 (30.20%), Postives = 123/255 (48.24%), Query Frame = 3
Query: 2487 FIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL--QFKTSN 3245
            F+ +  ++  I   NLV+L             L    +   FYII +++   NL D+LRS       +D      M            + TQ+ + M +LE +   HRDLA RNC++     VK+   GL      + Y +    +    FP++W APE++    F+ KSD+W+F + LWE+ T   + PY  +    + D +   +   R+PCP+ CP ++Y LM  CW WD ++RP F ++H+ L   F +SN
Sbjct:   55 FLKEASVMKGIKHQNLVQL-------------LGVCTREPPFYIITEFMMNGNLLDYLRSP----KGKDLDAVTLM-----------YMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRLVSEDIYTA----HQGAKFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATY-GMSPYPGIDLSQVYDKL---DGGYRMPCPEGCPPEVYSLMQTCWCWDPNSRPSFKEIHEKLNTMFPSSN 273          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Nematostella
Match: EDO49237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV3])

HSP 1 Score: 115.546 bits (288), Expect = 1.492e-28
Identity = 73/221 (33.03%), Postives = 112/221 (50.68%), Query Frame = 3
Query: 2610 FYIIMDYLNGYNLKDFL----------RSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGL---VTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNE-ALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
             +++++++ G +L+D L           S+ Y N+       Q +            +   +A GM HLEE    HRDLA RN ++ L +  K+   GL   VTT        + I++     P +WMAPES+  G++TTKSD+WSF V LWEI TL    PY    NE +++ L+ H  +  R+  P  C ++IY LM  CW  D + RP F ++ + L+
Sbjct:   30 LFVVIEFVEGGDLRDLLLKSRMSRNKWASSSYENLRSRLNERQLL-----------FLALGVARGMAHLEEKQCIHRDLAARNVLVGLGLVAKVADFGLARHVTTD------GLYIVSAQTKLPWKWMAPESL-RGLYTTKSDVWSFGVVLWEIATLGE-TPY---PNEVSIMKLLQHLIDGHRMSKPPYCDEEIYKLMLECWQLDPATRPSFKEIERTLK 228          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Nematostella
Match: EDO45490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSX1])

HSP 1 Score: 113.62 bits (283), Expect = 2.901e-28
Identity = 72/248 (29.03%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 2442 VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWD 3185
            VK L     + +K+SF+ ++ +++ ++  N+V+L  ++ + +              + +I ++++  +L  ++R     ++ ++  LTQ           L+ I  Q+++GM+HL+ +   HRDLA RNC++   + VKI   G+       DY  +E        P+RWM PE+++ G FT +SD++SF V LWE++   +L PY   TNE +   +        L  P++CP  IYD+M  CWN D
Sbjct:    6 VKTLKQGCSNEMKTSFLQEVTLMAVLHHPNIVELLAVSTEEE-------------PYGMIFEFMSQGDLNQYMRKRGPYSLEEEKSLTQE---------DLLSISLQVSSGMEHLQSMRFVHRDLATRNCLVGDGLVVKIADFGMSRDVYASDYYKVE---GQAVMPIRWMPPEALLYGRFTVESDVYSFGVLLWEVYAF-ALQPYYGYTNEEVCGFI---KKGVHLGKPEDCPDHIYDVMKSCWNKD 224          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Medaka
Match: ddr2b (discoidin domain-containing receptor 2 [Source:NCBI gene;Acc:101156357])

HSP 1 Score: 141.354 bits (355), Expect = 1.454e-33
Identity = 95/325 (29.23%), Postives = 160/325 (49.23%), Query Frame = 3
Query: 2304 NSDSNIRVIPISSLIPIQQVIRGEFGTISVCTM-----LIEGD------HQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIY-DLMNRCWNWDESARPKFADVHKFLQ 3230
             +DS++R  P   L   +++  G+FG + +C        ++ D       ++     VK L  D+  + ++ F+ +++I+S +   N+V+L  + VD+D               ++I +Y+   +L  FL      + S+ F L  ++ Y+++   ++ I     A+GMK+L  L   HRDLA RNC++     ++I   G+       DY  ++        P+RWM+ ESI+ G FT  SD+W+F VTLWEI TLC   PY  L++E ++    +    +     LP P  CP  +Y DLM  CW  +   RP F ++H  LQ
Sbjct:  540 GTDSSLREFPREKLSFKEKLGEGQFGEVHLCEAEGMQDFLDEDLSVGEISESLLLVAVKTLREDANKNARNDFLKEIRIMSRLRDPNIVRLLAVCVDTD-------------PLWMITEYMENGDLNQFL------SRSKIFFLFGALSYTKLINMAVQI-----ASGMKYLSSLNFVHRDLATRNCLVGKNYTIRIADFGMSRNLYKGDYYRIQ---GRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYSQLSDEQVIENTGEFFRDKGKQVYLPKPPCCPDSVYNDLMLSCWRRNAKQRPSFQEIHAQLQ 837          

HSP 2 Score: 103.219 bits (256), Expect = 9.271e-22
Identity = 101/384 (26.30%), Postives = 173/384 (45.05%), Query Frame = 3
Query:  354 ISAVKAFQESVRFSDNETNCISYLMSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKP---EEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKI-FTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTI---SDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRP 1478
            IS    F E  R+           M+   + D+  SASS  Y  + +AA+   +    G  DG AWCP+  I S+P   +E+++VD R +  I  + T GR ADG   ++  +  IKY R  +N W ++ +   + V+  N +A   +  +L   IIA+ +R  P+     SM  C++    GC   D  VSY  P G  +   ++     D +YDGA   +L  GLG L D     + F L + + G      + GWS  +  K  ++ + F F+  R+F S+ +++   F   + +   +T      S+ +   ++   T       A  + VT+    +K   C  + +   + ++L SE+  +S  ++  N +  P K P
Sbjct:   23 ISVASCFPEVCRYPLG--------MTGGQIQDEDISASS--YWSESTAAKFGRLDIGGG--DG-AWCPD--IMSEPHGLKEYLQVDLRSLHFITLVGTQGRHADGMGNEFAQRYRIKYSRDGSN-WVSWQDRKGQQVIEGNRNAYDVVLKDLEPPIIARYVRFMPVTD--HSMIVCMRVELYGCEWLDGLVSYSIPDGHQMIYRDLEVSFNDSVYDGA---SLTKGLGQLTDGTWGLDDF-LHSQIYGVWPGYDYVGWSNRTFPKG-YVEMIFDFDHVRNFTSMKVHTSNMFSRGVRVFRQVTCFFWSDSEWEPGPITFRPTPDRVSQRARFVTVTLGDRTAKTIKCRFHFS---DVWMLFSEVAFQSGSAV-YNTSMGPGKHP 379          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Medaka
Match: ENSORLT00000021512.2 (discoidin domain-containing receptor 2 [Source:NCBI gene;Acc:101165486])

HSP 1 Score: 139.428 bits (350), Expect = 5.266e-33
Identity = 102/336 (30.36%), Postives = 165/336 (49.11%), Query Frame = 3
Query: 2271 YHSPFPRVDQ-NNSDSNIRVIPISSLIPIQQVIRGEFGTISVCT------MLIEGD-----HQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALL----DLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ 3230
            Y  P   VD     D +    P   LI  +++  G+FG + +C        L EG              VK L  D+    ++ F+ ++KI+S ++  N+++L  + V SD                ++ +Y+   +L  FL     S    +  LT +     +SL  L+ +  Q+++GMK+L  L   HRDLA RNC++D R+ +KI   G+     + DY  ++        P+RWMA ESI+ G FTT SD+W+F VTLWEIFTLC   PY  L++E ++    +   ++     L  P  CP  +++LM RCW+ + + RP F  +++ L+
Sbjct:  516 YAVPALTVDSLTRKDISAAEFPRQQLIFREKLGEGQFGEVHLCEAEGLPEFLGEGSPLPDRDSRPVLVAVKQLRADATLQARNDFLKEIKIMSRLDDPNIIRLLCVCVSSD-------------PLCMVTEYMENGDLNMFL-----SQREIESTLTHANSIPSVSLCDLLHMAVQISSGMKYLASLNFVHRDLATRNCLVDRRLTIKIADFGMSRNLYSSDYYRIQ---GRAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYSLLSDEQVIENTGEFFRNQGRQIFLYSPPLCPPSLFELMMRCWSRNITDRPTFDGIYQTLR 830          

HSP 2 Score: 93.9745 bits (232), Expect = 5.986e-19
Identity = 84/356 (23.60%), Postives = 154/356 (43.26%), Query Frame = 3
Query:  426 MSPKYLTDDQFSASSFEYKFQ-PSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLR-TIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANI-SFDLRDYIYDGAI-LGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTISDR---DNNQVSLNATIAGGDSDANELLVTVQLNH--SKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANS 1463
            M    + D   +ASS  Y+   P  ARL      +  D   AWCP   +     ++++VD   +  +  + T GR A G  +++     + Y R +   W+ + N    +V+  N +    +   L  +IIA+ +R+ P+  ++S++  C++    GC   D  +SY AP+G L+         L D IYDG      L  GLG L D +   + F L +         + GW   S+     + + F F+++R+F S+ ++S   F   + +   ++     R   +  Q ++       D + +   VTV LN   +K   C        + +++ SEI  +S +++  +   S
Sbjct:   29 MEDGRVKDKDITASSKWYETTGPQFARL------NREDGDGAWCPEGQLQHSDTQYLQVDLSVLTFLTLVGTQGRYARGLGKEFARAYRLNYSR-DGLTWKAWKNRQGNTVIEGNKNTYAIVYKELHPSIIARYVRLIPVTELSSTV--CMRVELYGCPWHDGLISYSAPEGQLMMPPGYPPASLNDSIYDGTHERRPLFGGLGQLTDGVVGMDDFLLTHEKQVWSGYDYLGWRNDSQGTQGHVEMEFVFDRQRNFTSMKVHSNNLFTRGVKIFSSVSCWFKPRLIANWEQEAVTFRTVLDDRNPSARYVTVPLNQRTAKALRCRFYFA---DVWMMFSEISFQSGENLHPDLKTS 372          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 126.716 bits (317), Expect = 5.733e-29
Identity = 92/326 (28.22%), Postives = 148/326 (45.40%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDL-----------RMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            +P   LI  +++  G+FG + +C +    D  +    F           VK L  D+  + ++ F+ ++KILS +   N+++L  + V SD                ++ +Y+   +L  +L      + +       ++ Y  +   +  I     A+GMK L  L   HRDLA RNC++                +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+ ++C   PY +LT+E ++D        +     L  P  CP+ +Y+LM  CWN D   RP FA +H FL
Sbjct:  648 LPRQCLIFKEKLGEGQFGEVHLCEIENPQDLPSLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSD-------------PLCMVTEYMECGDLNQYLSHRVLLDKTGPSHNAPTISYPALISIASQI-----ASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQVYLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFL 952          

HSP 2 Score: 102.064 bits (253), Expect = 2.394e-21
Identity = 76/296 (25.68%), Postives = 135/296 (45.61%), Query Frame = 3
Query:  324 LFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSPKYLTDDQFSASS-FEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQ-NGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS 1199
            LF + +   L   V A +    F  ++    +  M    + D   SASS +    +    RL      +G  DG AWCP   +     E++++D  ++  +  + T GR ADG+ Q++T    ++Y R +  +W  + +   + V++ NT+    +  +L   I+A+ +R YP+      M  CL+    GC   D   +Y +P G ++ +  +   L D IYDG+    +Q  GLG L D +   + F     +       + GWS  +  +   + I FHFE+ R F ++ ++S
Sbjct:    8 LFPVTVVTALAVLVSAEEHEWHFKPDQCR-YALGMEAGTIPDSDISASSAWSDSTEAKHGRL-----STGEGDG-AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSR-DGVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLAD--RVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPVYLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGS-VDIEFHFEKPRLFINMQVHS 292          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 126.716 bits (317), Expect = 6.105e-29
Identity = 92/326 (28.22%), Postives = 148/326 (45.40%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDL-----------RMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            +P   LI  +++  G+FG + +C +    D  +    F           VK L  D+  + ++ F+ ++KILS +   N+++L  + V SD                ++ +Y+   +L  +L      + +       ++ Y  +   +  I     A+GMK L  L   HRDLA RNC++                +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+ ++C   PY +LT+E ++D        +     L  P  CP+ +Y+LM  CWN D   RP FA +H FL
Sbjct:  688 LPRQCLIFKEKLGEGQFGEVHLCEIENPQDLPSLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSD-------------PLCMVTEYMECGDLNQYLSHRVLLDKTGPSHNAPTISYPALISIASQI-----ASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQVYLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFL 992          

HSP 2 Score: 102.064 bits (253), Expect = 2.313e-21
Identity = 76/296 (25.68%), Postives = 135/296 (45.61%), Query Frame = 3
Query:  324 LFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSPKYLTDDQFSASS-FEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQ-NGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS 1199
            LF + +   L   V A +    F  ++    +  M    + D   SASS +    +    RL      +G  DG AWCP   +     E++++D  ++  +  + T GR ADG+ Q++T    ++Y R +  +W  + +   + V++ NT+    +  +L   I+A+ +R YP+      M  CL+    GC   D   +Y +P G ++ +  +   L D IYDG+    +Q  GLG L D +   + F     +       + GWS  +  +   + I FHFE+ R F ++ ++S
Sbjct:    8 LFPVTVVTALAVLVSAEEHEWHFKPDQCR-YALGMEAGTIPDSDISASSAWSDSTEAKHGRL-----STGEGDG-AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSR-DGVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLAD--RVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPVYLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGS-VDIEFHFEKPRLFINMQVHS 292          
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 126.716 bits (317), Expect = 6.105e-29
Identity = 92/326 (28.22%), Postives = 148/326 (45.40%), Query Frame = 3
Query: 2328 IPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYF-----------VKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDL-----------RMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFL 3227
            +P   LI  +++  G+FG + +C +    D  +    F           VK L  D+  + ++ F+ ++KILS +   N+++L  + V SD                ++ +Y+   +L  +L      + +       ++ Y  +   +  I     A+GMK L  L   HRDLA RNC++                +KI   G+       DY  ++        P+RWMA E I+ G FTT SD+W+F VTLWE+ ++C   PY +LT+E ++D        +     L  P  CP+ +Y+LM  CWN D   RP FA +H FL
Sbjct:  688 LPRQCLIFKEKLGEGQFGEVHLCEIENPQDLPSLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSD-------------PLCMVTEYMECGDLNQYLSHRVLLDKTGPSHNAPTISYPALISIASQI-----ASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMSRNLYAGDYYRIQ---GRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQVYLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFL 992          

HSP 2 Score: 102.064 bits (253), Expect = 2.313e-21
Identity = 76/296 (25.68%), Postives = 135/296 (45.61%), Query Frame = 3
Query:  324 LFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSPKYLTDDQFSASS-FEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGR-ADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQ-NGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS 1199
            LF + +   L   V A +    F  ++    +  M    + D   SASS +    +    RL      +G  DG AWCP   +     E++++D  ++  +  + T GR ADG+ Q++T    ++Y R +  +W  + +   + V++ NT+    +  +L   I+A+ +R YP+      M  CL+    GC   D   +Y +P G ++ +  +   L D IYDG+    +Q  GLG L D +   + F     +       + GWS  +  +   + I FHFE+ R F ++ ++S
Sbjct:    8 LFPVTVVTALAVLVSAEEHEWHFKPDQCR-YALGMEAGTIPDSDISASSAWSDSTEAKHGRL-----STGEGDG-AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSR-DGVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLAD--RVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPVYLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGS-VDIEFHFEKPRLFINMQVHS 292          
BLAST of Epithelial discoidin domain-containing receptor vs. Planmine SMEST
Match: SMESG000069322.1 (SMESG000069322.1)

HSP 1 Score: 1958.73 bits (5073), Expect = 0.000e+0
Identity = 994/1001 (99.30%), Postives = 996/1001 (99.50%), Query Frame = 3
Query:  300 MSLFGFWILFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTISDRDNNQVSLNATIAGGDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRPAIHYFNTTDKYTTSLLSDKSESKISNWKQQDITXXXXXXXXXXXXXXXXXXXXXCYKLQRSRRSKLTKKLELVAQCNNQITRSQTPGTVFTIQSKTPANTTNQQPKYFSETKTTYSAAYSGSQPSDGVYASWPNTDEDPDLATIDKEEEKCLLSSEVGERSSMKEYATYQCSVNPTGANEYILTDNSLYRPKGNTRSSSIATTIPNISTLSVPLLKIVASYETPKTTPIVTFRSNKKLSSNNIESMCYQHLLNYRGSCGEVDFRYHSPFPRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNXXXXXXXXXXFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYXXXXXXXXXXXXXXXANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNSTSQAQIILPAPPPDDHTS 3302
            MSLFGFWILFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNN+QWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGA+LGTLQNGLGLLMDNIAWRNKFDLFNNVN EKEKIFTGWSC SRHK PFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTISDRDNNQVSLNATIAG DSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRPAIHYFNTTDKYTTSLLSDKSESKISNWKQQDITAMILVILIILLLIFVIAMAALCYKLQRSRRSKLTKKLELVAQCNNQ TRSQTPGTVFTIQSKTPANTTNQQPKYFSETKTTYSAAYSGSQPSDGVYASWPNTDEDPDLATIDKEEEKCLLSSEVGERSSMKEYATYQCSVNPTGANEYILTDNSLYRPKGNTRSSSIATTIPNISTLSVPLLKIVASYETPKTTPIVTFRSNKKLSSNNIESMCYQHLLNYRGSCGEVDFRYHSPFPRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNIDSKSSIKSSFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYSQISLSSLMIIITQLANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNSTSQAQIILPAPPPDDHTS
Sbjct:    1 MSLFGFWILFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSPKYLTDDQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNDQWRNYVNLNNESVLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITIANISFDLRDYIYDGAVLGTLQNGLGLLMDNIAWRNKFDLFNNVNDEKEKIFTGWSCTSRHKYPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTISDRDNNQVSLNATIAGDDSDANELLVTVQLNHSKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRPAIHYFNTTDKYTTSLLSDKSESKISNWKQQDITAMILVILIILLLIFVIAMAALCYKLQRSRRSKLTKKLELVAQCNNQSTRSQTPGTVFTIQSKTPANTTNQQPKYFSETKTTYSAAYSGSQPSDGVYASWPNTDEDPDLATIDKEEEKCLLSSEVGERSSMKEYATYQCSVNPTGANEYILTDNSLYRPKGNTRSSSIATTIPNISTLSVPLLKIVASYETPKTTPIVTFRSNKKLSSNNIESMCYQHLLNYRGSCGEVDFRYHSPFPRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCTMLIEGDHQTTARYFVKNLNIDSKSSIKSSFIMDLKILSSINCSNLVKLETIAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFKLTQSMPYSQISLSSLMIIITQLANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSNSTSQAQIILPAPPPDDHTS 1001          
BLAST of Epithelial discoidin domain-containing receptor vs. Planmine SMEST
Match: SMESG000051409.1 (SMESG000051409.1)

HSP 1 Score: 193.356 bits (490), Expect = 1.245e-49
Identity = 123/365 (33.70%), Postives = 195/365 (53.42%), Query Frame = 3
Query:  384 VRFSDNETNCISYLMSPKYLTDDQFSASS-FEYK--FQPSAARLIEVH-SQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSN-LRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLIT-IANISFDLRDYIYDGAILGT-----LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTISDRDNNQVSLNATIAGGDSDANE---LLVTVQLNHSKGYICSINI-TCGLNNFILLSEIEIKSA 1433
            VR S N  NC + LM    L DD+FSASS F+ +  FQ   ARL+ ++ S   P++GNAWCP+K   S   EWIEVDF+ + +I  I+T GR +GNF ++ P I I Y+R  N +   Y  + N+S++ +NTDART+ R+  +  IIA  I+IYP++   + M  C+KFA  GC   D  VSY    GD ++   ++     D  +DG  +       L+NGLGLL DN AW        ++ G ++  F GW  ++    P+I I F +E+ R+F  + ++S +     I +   + +        +  +   ++  +   N    ++ T+ L+H+ G +  + +    LN +IL+SEI   S+
Sbjct:   29 VRSSKN--NCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAW------LGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSS 384          

HSP 2 Score: 156.377 bits (394), Expect = 3.413e-38
Identity = 74/180 (41.11%), Postives = 112/180 (62.22%), Query Frame = 3
Query: 2766 ANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKP-NEDYCSMEILNHL-VTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD-----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ------FKTSNSTSQAQI 3266
            A+GMKH+EE G+ HRDLACR+C++++ + VKI  GG   + P + DY S+ + ++  +  P+RWMAPES+    F++KSD+W+F VTLWE+ T C+  PY   +N  ++D     L++  +    L  P+ CPK+IYD++  CW+  E  RP F ++H FLQ      F T N  S+  I
Sbjct:  932 ASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI 1111          
BLAST of Epithelial discoidin domain-containing receptor vs. Planmine SMEST
Match: SMESG000051409.1 (SMESG000051409.1)

HSP 1 Score: 192.971 bits (489), Expect = 1.398e-49
Identity = 123/365 (33.70%), Postives = 195/365 (53.42%), Query Frame = 3
Query:  384 VRFSDNETNCISYLMSPKYLTDDQFSASS-FEYK--FQPSAARLIEVH-SQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSN-LRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLIT-IANISFDLRDYIYDGAILGT-----LQNGLGLLMDNIAWRNKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTISDRDNNQVSLNATIAGGDSDANE---LLVTVQLNHSKGYICSINI-TCGLNNFILLSEIEIKSA 1433
            VR S N  NC + LM    L DD+FSASS F+ +  FQ   ARL+ ++ S   P++GNAWCP+K   S   EWIEVDF+ + +I  I+T GR +GNF ++ P I I Y+R  N +   Y  + N+S++ +NTDART+ R+  +  IIA  I+IYP++   + M  C+KFA  GC   D  VSY    GD ++   ++     D  +DG  +       L+NGLGLL DN AW        ++ G ++  F GW  ++    P+I I F +E+ R+F  + ++S +     I +   + +        +  +   ++  +   N    ++ T+ L+H+ G +  + +    LN +IL+SEI   S+
Sbjct:   33 VRSSKN--NCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAW------LGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSS 388          

HSP 2 Score: 156.377 bits (394), Expect = 3.740e-38
Identity = 74/180 (41.11%), Postives = 112/180 (62.22%), Query Frame = 3
Query: 2766 ANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKP-NEDYCSMEILNHL-VTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD-----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ------FKTSNSTSQAQI 3266
            A+GMKH+EE G+ HRDLACR+C++++ + VKI  GG   + P + DY S+ + ++  +  P+RWMAPES+    F++KSD+W+F VTLWE+ T C+  PY   +N  ++D     L++  +    L  P+ CPK+IYD++  CW+  E  RP F ++H FLQ      F T N  S+  I
Sbjct:  936 ASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI 1115          
BLAST of Epithelial discoidin domain-containing receptor vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 157.532 bits (397), Expect = 1.663e-38
Identity = 102/280 (36.43%), Postives = 141/280 (50.36%), Query Frame = 3
Query:  441 LTDDQFSASSFE---YKFQPSAARLIEVHSQSGPDD----GNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITI--ANISFDLRDYIYDGAI-------LGTLQNGLGLLMDNIAWRNKF--DLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNI 1223
            L ++ F ASS      +F+P  AR+ ++      DD    G+AWCP + I S PEEWIE+D   + +IK + T GR DGNF +Y P   + Y+R  + +W  Y N   E +L  NTDAR    +N  + IIA+RIRIYPI S    ++AC++    GC  +D  V Y   QG   T    N  +DLRD  YDG I        G L+ GLG LMDN+ +      D  N + G     F GW+      +   I+   F+Q R  K I  Y++     +I
Sbjct:   54 LKNESFIASSVWKEIVEFEPHQARMKQM------DDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRV-SGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPI-SKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYH---FVGWNRKFLDSNKVEIV-MKFDQMRSVKQIRFYAMNMIPEDI 321          

HSP 2 Score: 95.9005 bits (237), Expect = 1.527e-19
Identity = 62/208 (29.81%), Postives = 87/208 (41.83%), Query Frame = 3
Query: 2766 ANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEIL----------NHLVT-----FPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLT-----------------------NEALLDLMSHRNNTP--RLPCPQNC--------PKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSN 3245
            A GM +LE   + HRDLA RNC+I   + +KI    +   K  E Y    ++          N  ++     +PL+WMA ESI+   ++ K+DIWSF VT+WEI   C   PYG                          NE L    S  N  P   +  P +          +D  DL+  CWN +   RP F  +   L+ K +N
Sbjct:  953 ARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITN 1160          
BLAST of Epithelial discoidin domain-containing receptor vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 157.532 bits (397), Expect = 1.747e-38
Identity = 102/280 (36.43%), Postives = 141/280 (50.36%), Query Frame = 3
Query:  441 LTDDQFSASSFE---YKFQPSAARLIEVHSQSGPDD----GNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNESVLTMNTDARTKLRSNLRT-IIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLITI--ANISFDLRDYIYDGAI-------LGTLQNGLGLLMDNIAWRNKF--DLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYSVKDFKHNI 1223
            L ++ F ASS      +F+P  AR+ ++      DD    G+AWCP + I S PEEWIE+D   + +IK + T GR DGNF +Y P   + Y+R  + +W  Y N   E +L  NTDAR    +N  + IIA+RIRIYPI S    ++AC++    GC  +D  V Y   QG   T    N  +DLRD  YDG I        G L+ GLG LMDN+ +      D  N + G     F GW+      +   I+   F+Q R  K I  Y++     +I
Sbjct:   52 LKNESFIASSVWKEIVEFEPHQARMKQM------DDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRV-SGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPI-SKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYH---FVGWNRKFLDSNKVEIV-MKFDQMRSVKQIRFYAMNMIPEDI 319          

HSP 2 Score: 95.9005 bits (237), Expect = 1.619e-19
Identity = 62/208 (29.81%), Postives = 87/208 (41.83%), Query Frame = 3
Query: 2766 ANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKPNEDYCSMEIL----------NHLVT-----FPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLT-----------------------NEALLDLMSHRNNTP--RLPCPQNC--------PKDIYDLMNRCWNWDESARPKFADVHKFLQFKTSN 3245
            A GM +LE   + HRDLA RNC+I   + +KI    +   K  E Y    ++          N  ++     +PL+WMA ESI+   ++ K+DIWSF VT+WEI   C   PYG                          NE L    S  N  P   +  P +          +D  DL+  CWN +   RP F  +   L+ K +N
Sbjct:  951 ARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITN 1158          
The following BLAST results are available for this feature:
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTK72.750e-3531.56protein tyrosine kinase 7 (inactive) [Source:HGNC ... [more]
PTK72.801e-3531.56protein tyrosine kinase 7 (inactive) [Source:HGNC ... [more]
PTK73.190e-3531.56protein tyrosine kinase 7 (inactive) [Source:HGNC ... [more]
PTK73.263e-3531.56protein tyrosine kinase 7 (inactive) [Source:HGNC ... [more]
PTK73.421e-3531.56protein tyrosine kinase 7 (inactive) [Source:HGNC ... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr-26.733e-3128.90Discoidin domain-containing receptor tyrosine kina... [more]
ddr-26.733e-3128.90Discoidin domain-containing receptor tyrosine kina... [more]
ddr-29.372e-3128.90Discoidin domain-containing receptor tyrosine kina... [more]
abl-11.407e-2832.38Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
abl-11.446e-2832.38Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr3.344e-3631.80gene:FBgn0053531 transcript:FBtr0344771[more]
Ddr3.344e-3631.80gene:FBgn0053531 transcript:FBtr0344770[more]
Abl9.692e-3132.91gene:FBgn0000017 transcript:FBtr0330132[more]
Abl9.801e-3132.91gene:FBgn0000017 transcript:FBtr0345369[more]
Abl9.801e-3132.91gene:FBgn0000017 transcript:FBtr0075357[more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2l6.594e-3430.56discoidin domain receptor family, member 2, like [... [more]
ddr2l6.718e-3430.56discoidin domain receptor family, member 2, like [... [more]
BX088694.17.599e-3430.65discoidin domain receptor family, member 2, like [... [more]
FP015875.17.867e-3430.65discoidin domain receptor family, member 2, like [... [more]
ddr2b7.982e-3137.97discoidin domain receptor tyrosine kinase 2b [Sour... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnc1l4.606e-3130.79phosphatidylinositol transfer protein cytoplasmic ... [more]
pitpnc1l5.589e-3130.79phosphatidylinositol transfer protein cytoplasmic ... [more]
pitpnc1l6.621e-3130.79phosphatidylinositol transfer protein cytoplasmic ... [more]
pitpnc1l1.098e-3030.79phosphatidylinositol transfer protein cytoplasmic ... [more]
FES3.014e-3029.90FES proto-oncogene, tyrosine kinase [Source:NCBI g... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptk74.071e-3429.28PTK7 protein tyrosine kinase 7 [Source:MGI Symbol;... [more]
Ddr16.828e-3330.51discoidin domain receptor family, member 1 [Source... [more]
Ddr18.023e-3330.51discoidin domain receptor family, member 1 [Source... [more]
Ddr18.023e-3330.51discoidin domain receptor family, member 1 [Source... [more]
Ddr18.023e-3330.51discoidin domain receptor family, member 1 [Source... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13308|PTK7_HUMAN1.567e-3431.56Inactive tyrosine-protein kinase 7 OS=Homo sapiens... [more]
sp|Q8BKG3|PTK7_MOUSE2.847e-3329.28Inactive tyrosine-protein kinase 7 OS=Mus musculus... [more]
sp|Q63474|DDR1_RAT2.600e-3229.46Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q03146|DDR1_MOUSE5.612e-3230.51Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q7YR43|DDR1_PANTR2.198e-3129.43Epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DC182.530e-4133.87Discoidin domain-containing receptor 2 (Fragment) ... [more]
A0A4E0RMB21.535e-4033.43Discoidin domain-containing receptor 2 OS=Fasciola... [more]
A0A504XNQ22.708e-4033.43Discoidin domain-containing receptor 2 OS=Fasciola... [more]
A0A4S2LFH76.899e-4033.05F5/8 type C domain-containing protein OS=Opisthorc... [more]
A0A4V3SDW47.639e-4033.05F5/8 type C domain-containing protein OS=Opisthorc... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2l1.368e-3131.58discoidin domain receptor family, member 2, like [... [more]
ENSAMXT00000019857.21.582e-3129.15discoidin domain-containing receptor 2-like [Sourc... [more]
ddr13.740e-3028.70discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr13.896e-3028.70discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr13.994e-3028.70discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009485.12.580e-3128.77pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000009481.14.320e-3128.62pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
ENSPMAT00000001705.12.917e-3039.53pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
fer4.031e-2930.20fer (fps/fes related) tyrosine kinase [Source:ZFIN... [more]
ENSPMAT00000007292.15.718e-2928.20pep scaffold:Pmarinus_7.0:GL476471:161062:207122:1... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
STE71.903e-928.57Signal transducing MAP kinase kinase; involved in ... [more]
SKM14.294e-825.54Member of the PAK family of serine/threonine prote... [more]
CDC151.818e-626.20Protein kinase of the Mitotic Exit Network; locali... [more]
CLA45.490e-624.08Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO442695.945e-3733.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476524.606e-3227.69Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO471957.626e-3230.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492371.492e-2833.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454902.901e-2829.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2b1.454e-3329.23discoidin domain-containing receptor 2 [Source:NCB... [more]
ENSORLT00000021512.25.266e-3330.36discoidin domain-containing receptor 2 [Source:NCB... [more]
ddr15.733e-2928.22epithelial discoidin domain-containing receptor 1 ... [more]
ddr16.105e-2928.22epithelial discoidin domain-containing receptor 1 ... [more]
ddr16.105e-2928.22epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Epithelial discoidin domain-containing receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069322.10.000e+099.30SMESG000069322.1[more]
SMESG000051409.11.245e-4933.70SMESG000051409.1[more]
SMESG000051409.11.398e-4933.70SMESG000051409.1[more]
SMESG000067438.11.663e-3836.43SMESG000067438.1[more]
SMESG000067438.11.747e-3836.43SMESG000067438.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000553 ID=SMED30000553|Name=Epithelial discoidin domain-containing receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=4065bp
AATCAACTCATTATTGATCGTTCACAAACATGAATATAATCATTATTATT
ATTGCTGGTGTAAGACAATTTACAGTGGAGTTACAAATGTTTCGTTTGTA
GTAGCAAATAAGAGTTCGAATCAAATCTCTCGATTTTCATTGGTTGAAAT
GTTGTCATTGTAATATTCGATGTAGCACGTGTTAGCAGCATTTCATTTTC
GTTCTACTGAATTTGATTTATTTGGAGAAATTTATTTCCGTTATAGTTTA
ATTTTCTAACAGAAACAATAATTCGGTTTTTAAAAGAATTAACTTTTCTA
TGTCTCTATTCGGATTTTGGATTTTATTTTTCATCGTAATTTACAATTGT
CTAATTTCTGCAGTGAAAGCTTTTCAAGAAAGTGTGAGATTTAGTGACAA
TGAAACGAACTGCATCAGTTATTTGATGTCGCCAAAATATTTGACTGACG
ATCAGTTTTCAGCCAGCAGCTTTGAGTACAAATTTCAACCTAGCGCGGCA
AGATTGATAGAAGTTCATTCCCAAAGTGGGCCGGATGATGGCAATGCTTG
GTGTCCAAATAAAAATATTCATTCTAAGCCAGAAGAATGGATAGAAGTCG
ATTTTCGTCGAATGGTTATCATAAAGCGCATCTATACAATGGGCCGAGCT
GATGGAAATTTCCAGAAATATACTCCTCAAATCTTGATCAAATACAAAAG
ATCCAACAATAACCAATGGAGAAATTATGTGAATCTCAATAATGAATCGG
TTCTGACAATGAACACAGATGCGCGAACCAAGCTCAGGTCCAATTTGAGG
ACTATAATTGCGAAACGGATCCGGATCTACCCTATCAATTCCATTGCCAG
TTCTATGAAAGCTTGTTTGAAATTTGCATTTTTAGGATGTTTTATTGAAG
ATGACGCTGTGAGTTACGACGCCCCTCAGGGAGATTTAATAACAATTGCT
AACATTTCGTTCGATTTACGGGATTACATTTACGATGGAGCCATATTGGG
CACCCTTCAAAATGGTCTTGGATTGTTAATGGACAATATTGCTTGGAGAA
ATAAATTCGATTTGTTTAACAATGTGAATGGTGAAAAAGAGAAAATTTTC
ACCGGATGGTCTTGTGCTAGTCGCCATAAAGATCCTTTCATCATTATTCG
GTTTCATTTTGAACAAGAAAGAGATTTTAAGTCAATCACACTTTATTCTG
TGAAAGACTTTAAACATAACATTTACCTTTCTGGCTTGATTACGGTGACA
ATCAGTGACAGAGATAATAATCAAGTGTCTCTCAATGCAACTATTGCCGG
TGGTGATTCAGATGCCAATGAGTTGCTGGTTACAGTACAGTTGAATCACT
CGAAAGGATACATTTGCAGCATCAACATCACATGCGGCTTGAATAATTTC
ATTCTTTTGAGTGAAATTGAAATTAAATCAGCCAAATCAATCAGAACTAA
TGCCGCAAATAGCCCGCCGAAACGGCCTGCAATACATTATTTCAACACTA
CTGACAAGTATACGACAAGTCTACTCTCAGATAAGTCTGAATCAAAGATT
TCAAACTGGAAACAACAAGATATAACTGCCATGATTTTAGTGATTCTAAT
AATTTTGCTCCTAATTTTTGTAATTGCTATGGCTGCTCTTTGCTATAAAT
TGCAGAGGTCCAGGAGGAGTAAATTAACGAAAAAGCTTGAGTTGGTTGCA
CAGTGCAATAACCAAATTACACGCAGCCAAACTCCTGGGACAGTGTTCAC
AATCCAGTCAAAAACTCCAGCTAATACCACTAATCAACAACCGAAATATT
TCAGTGAAACAAAAACAACGTATTCAGCTGCATATAGCGGATCACAACCA
AGTGATGGAGTATATGCTTCATGGCCAAATACCGACGAGGATCCTGACTT
GGCTACGATTGATAAAGAAGAAGAAAAATGTCTTCTATCATCAGAAGTCG
GTGAAAGAAGTTCTATGAAAGAATATGCCACATATCAGTGTAGTGTCAAT
CCCACTGGAGCAAACGAATACATTCTCACTGACAATTCGCTATATAGACC
CAAGGGAAACACGAGATCTTCCTCAATCGCCACTACTATACCAAATATAT
CTACTTTATCAGTTCCACTTTTGAAAATTGTAGCATCTTATGAAACACCA
AAAACCACGCCAATTGTTACTTTTAGGTCTAATAAAAAGCTTTCTTCCAA
CAATATCGAATCAATGTGTTATCAACATTTATTAAACTACAGAGGTTCTT
GTGGGGAGGTAGATTTTCGGTATCACTCACCATTTCCTAGAGTTGATCAA
AACAATTCAGATTCAAATATTCGAGTTATTCCAATTTCCTCTTTGATTCC
GATCCAACAGGTTATTCGAGGAGAATTCGGAACAATATCAGTATGCACGA
TGCTTATTGAAGGCGACCACCAAACTACTGCTCGTTACTTTGTCAAGAAC
CTCAATATAGATTCAAAATCTTCAATAAAATCCAGCTTTATCATGGACCT
GAAAATTCTCAGCTCAATCAATTGTTCAAACCTTGTGAAACTAGAGACCA
TAGCGGTAGACAGTGACATGAGTAACATAGATTTGTTTTCAGTTATCAAG
TCCACCAGATTCTACATAATCATGGACTACCTTAATGGATACAATCTGAA
GGACTTCCTTCGTAGCACTTATTATTCGAACGTCTCACAGGATTTCAAAT
TGACACAATCAATGCCCTACAGCCAAATTAGTTTATCGTCATTAATGATA
ATTATCACACAACTCGCCAATGGGATGAAGCATTTGGAGGAGTTGGGATT
GACCCATCGAGATCTTGCTTGTAGAAATTGTGTCATAGATTTGAGGATGC
ATGTAAAAATTTATCCCGGTGGACTGGTTACCACTAAGCCAAATGAGGAT
TATTGCTCAATGGAAATTCTAAACCATTTAGTCACATTTCCTTTACGTTG
GATGGCTCCAGAATCTATAATTGCAGGTGTTTTCACAACAAAATCAGATA
TCTGGTCATTTGCTGTGACTTTGTGGGAAATATTTACCTTATGCAGTCTC
GTGCCCTATGGCTCCCTGACAAATGAGGCACTGCTGGACCTGATGTCTCA
TCGCAATAATACTCCACGACTACCATGTCCACAGAATTGTCCCAAAGATA
TATATGATTTAATGAATCGCTGTTGGAATTGGGATGAATCCGCCAGACCG
AAATTTGCTGATGTTCACAAGTTCCTTCAGTTTAAAACATCAAATTCTAC
TAGTCAAGCTCAAATCATTCTCCCGGCGCCCCCTCCAGATGATCATACCA
GTTGATTTAGTTGGGACTCAAGTTTAAAATATTAATCACAACTCTGAGAA
TATCAATATATTTAATCATCCACATTTTCTTGTATTTGTTTTAATGAGTA
TGAGTAATGAGCAAATGTGATAGTGCACGCACTTAGCACTTTGTCTATTG
TATATATTTATTAATGATTTCAGACCGTCGTTTTCGCTCATAATGCTTCA
ATAAAATTGTTTTGAAATATGTTTTCGGTTGTTTAGTGTTTTGAATTTTA
TTTCTACGACTCCTCGATCTTTAAAGTGTACAAGGCTTGCAGAATTTGGA
CTTACCATATGATGGATTTGTGGAGATTTTATAAGATGGATTATGGATTA
CAACTCTGGGATTTATGCATACAATCTTTAATCATATACGGTGTAAAATG
CAATTGAGAAGTACCTTGATAAGAAAGAGATCTTCAAGAACCATCTCATA
AACCTTCAACATTGTCACAGGCAATATGTAATTGGATAACAATGAAAAAT
TACTGAAAATAACAACAAATAAAAATGTATAATATATGACTAAATTCGAG
TAAAAATCATGACAAGTAGAGTCTATGAAGCTCGGCCTTTTTCGTAAGAT
GGAGTTTTTATTGACTGGAAAATGTCTGAAAAGTAAGAAAAACTTCCTTT
AACAACCATATAGTTGTCAATCTGAAAGTAAAATAATTTATTCAGTAAAA
TGTAACGCGAGGAGATTTGTTTCGGTTATTAATTGAACTAAGCAATATTT
TAAAAGTAAGCCCGG
back to top

protein sequence of SMED30000553-orf-1

>SMED30000553-orf-1 ID=SMED30000553-orf-1|Name=SMED30000553-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1002bp
MSLFGFWILFFIVIYNCLISAVKAFQESVRFSDNETNCISYLMSPKYLTD
DQFSASSFEYKFQPSAARLIEVHSQSGPDDGNAWCPNKNIHSKPEEWIEV
DFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNNQWRNYVNLNNES
VLTMNTDARTKLRSNLRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIE
DDAVSYDAPQGDLITIANISFDLRDYIYDGAILGTLQNGLGLLMDNIAWR
NKFDLFNNVNGEKEKIFTGWSCASRHKDPFIIIRFHFEQERDFKSITLYS
VKDFKHNIYLSGLITVTISDRDNNQVSLNATIAGGDSDANELLVTVQLNH
SKGYICSINITCGLNNFILLSEIEIKSAKSIRTNAANSPPKRPAIHYFNT
TDKYTTSLLSDKSESKISNWKQQDITAMILVILIILLLIFVIAMAALCYK
LQRSRRSKLTKKLELVAQCNNQITRSQTPGTVFTIQSKTPANTTNQQPKY
FSETKTTYSAAYSGSQPSDGVYASWPNTDEDPDLATIDKEEEKCLLSSEV
GERSSMKEYATYQCSVNPTGANEYILTDNSLYRPKGNTRSSSIATTIPNI
STLSVPLLKIVASYETPKTTPIVTFRSNKKLSSNNIESMCYQHLLNYRGS
CGEVDFRYHSPFPRVDQNNSDSNIRVIPISSLIPIQQVIRGEFGTISVCT
MLIEGDHQTTARYFVKNLNIDSKSSIKSSFIMDLKILSSINCSNLVKLET
IAVDSDMSNIDLFSVIKSTRFYIIMDYLNGYNLKDFLRSTYYSNVSQDFK
LTQSMPYSQISLSSLMIIITQLANGMKHLEELGLTHRDLACRNCVIDLRM
HVKIYPGGLVTTKPNEDYCSMEILNHLVTFPLRWMAPESIIAGVFTTKSD
IWSFAVTLWEIFTLCSLVPYGSLTNEALLDLMSHRNNTPRLPCPQNCPKD
IYDLMNRCWNWDESARPKFADVHKFLQFKTSNSTSQAQIILPAPPPDDHT
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0006468protein phosphorylation
GO:0007399nervous system development
GO:0008045motor neuron axon guidance
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0097376interneuron axon guidance
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000420parapharyngeal region
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000421FA58C
IPR020635Tyr_kinase_cat_dom
IPR008979Galactose-bd-like_sf
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030424axon
GO:0042995cell projection
GO:0043204perikaryon
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 828..846
score: 44.53
coord: 947..969
score: 43.64
coord: 775..788
score: 33.26
coord: 880..890
score: 57.92
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 686..976
e-value: 4.0E-57
score: 193.4
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 683..976
e-value: 6.0E-48
score: 175.3
IPR000421Coagulation factor 5/8 C-terminal domainSMARTSM00231disc_4coord: 38..197
e-value: 2.2E-8
score: 43.8
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 54..180
e-value: 7.3E-11
score: 42.3
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01285FA58C_1coord: 83..115
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 36..197
score: 19.125
NoneNo IPR availableGENE3DG3DSA:2.60.120.1190coord: 201..386
e-value: 2.1E-24
score: 88.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 666..990
e-value: 2.3E-51
score: 176.5
NoneNo IPR availablePANTHERPTHR24416:SF515coord: 80..979
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 80..979
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.899
NoneNo IPR availableTMHMMTMhelixcoord: 425..447
NoneNo IPR availableTMHMMTMhelixcoord: 4..22
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 37..198
e-value: 6.3E-26
score: 93.3
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 43..198
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 834..846
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 682..976
score: 27.312
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 669..978