SMED30000550

Overview
NameSMED30000550
Smed IDSMED30000550
Length (bp)705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000550 (SMED30000550) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000550 (SMED30000550) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000550

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 27

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000550h1SMcG0009890 SmedASXL_004369SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000550h1SMcG0009890 SmedASXL_017252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000550h1SMcG0009890 SmedASXL_017257SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30000550h1SMcG0009889 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000550h1SMcG0009889 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000550h1SMcG0009890 Contig53784newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000550h1SMcG0009890 Contig53784uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000550h1SMcG0009890 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000550h1SMcG0009890 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30000550h1SMcG0009890 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000550h1SMcG0009890 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000550h1SMcG0009890 dd_Smed_v4_13603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000550h1SMcG0009890 dd_Smed_v4_11640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000550h1SMcG0009890 dd_Smed_v4_11640_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000550h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000550h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000550h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000550h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000550h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000550h1SMcG0009890 dd_Smed_v4_9830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000550h1SMcG0009890 dd_Smed_v4_16650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000550h1SMcG0009890 dd_Smed_v4_16650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000550h1SMcG0009890 dd_Smed_v4_16650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000550h1SMcG0009890 dd_Smed_v6_9830_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30000550h1SMcG0009890 dd_Smed_v6_16650_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30000550h1SMcG0009890 Contig53784newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000550h1SMcG0009890 Contig53784uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000550 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000055:316375..317432 -3386
v31.000055:316960..317798 -1697
v31.000055:317207..317832 -1275
Homology
BLAST of SMED30000550 vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 386.341 bits (991), Expect = 1.515e-123
Identity = 207/235 (88.09%), Postives = 221/235 (94.04%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLDVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNVVDETDHSANPNKSEPSESKIKEVDEADWK 705
            +DLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLE+VSNVFETDPSVDLNENEPTESNINKVDEEETTQ+QLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDE+EKKQHKQINLDVSKLDETD+SVDTNES+P ESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELA Q II+ID+ EKNILDQVNV+ +TDHS +PNK + +E  I EVD  + K
Sbjct: 1804 IDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLDVSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPK 2038          

HSP 2 Score: 213.001 bits (541), Expect = 5.255e-63
Identity = 140/231 (60.61%), Postives = 167/231 (72.29%), Query Frame = 1
Query:   16 VSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNVVDETDHSANPNKSEPSESKIKEVDEADWK 705
            VS +D+TDHS D+NESK  E NIIEVD GE    EQ N E+VSNV +T  SVD NE+E    NI K+D+ E      I ++V+ + + D SVDPN+    E NI +VD  E KQ +Q+N D VSK+D  D SVDTNESE  E N+IE+D+ E    E+ N +E+ NV++T HS DQN+ ELAKQIIIEIDEVEKNILDQVNVVDETDHSAN NKSEPSESKI EVDEADWK
Sbjct: 1930 VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKN----ILDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWK 2156          

HSP 3 Score: 189.889 bits (481), Expect = 5.150e-55
Identity = 127/238 (53.36%), Postives = 161/238 (67.65%), Query Frame = 1
Query:   13 EVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-DQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDEADWK 705
            E+S +D+ D S   NESKLAE  IIE+D  + NI++  NL ++S V E   S DLNENEP+E NIN+VDE E  Q +Q+  E VSKV EKD S DPNE +  +HNI ++D+ E      +N+D VSK+DE  +S D+ ESEP+E NI EVD+GE  QQEQ N EEV  V+K  +S D N+SEL +  IIEID+ E NI D VNV     V+ETDH+ N N+SEP ES IKEVDE + K
Sbjct: 2938 ELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPK 3175          

HSP 4 Score: 177.563 bits (449), Expect = 9.046e-51
Identity = 143/283 (50.53%), Postives = 174/283 (61.48%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETT-QDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVD-----------------------------------------KTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDEADWK 705
            V+ EEVSNVD TDHS + NE +LAEQNIIEVDV +RNISE+ NL++VS V E D  VD NE+E  ESNIN VDE ET  Q+Q+  EEVS V E + SV  NE+   E   K+VD  E  Q+   N  + SK+DETD+S+  N+SEPAESNI +VD+ E  QQEQVNS+EV NVD                                         +T HSVDQNE EL +Q IIEID+ EKNI DQVNV     VDE DHSA+PN+SE + S I EV++ + K
Sbjct: 2202 VNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETK 2484          

HSP 5 Score: 157.532 bits (397), Expect = 8.463e-44
Identity = 126/282 (44.68%), Postives = 161/282 (57.09%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEK----------------------------KQHKQINLD--------------VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDEADWK 705
            V+++EVS V++TD +A+ NES+  E NI EVDVGE    EQ NLE+VS V E D S D N +EP +SNIN++  +  T ++   EEVSK  E D SVDPNE + V+ NIK +DE E                              +H  I +D              +SK+DE  +S D NE+EP+E NI EVD+GE  QQEQVN E VS V++  +S D NE ELA+  I EID+ E NI D VNV     VDE  HSA+  +SEPSE  I EVDE + K
Sbjct: 2813 VNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINELGGK-MTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPK 3093          

HSP 6 Score: 157.532 bits (397), Expect = 9.054e-44
Identity = 120/241 (49.79%), Postives = 164/241 (68.05%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNI-----LDQVNVVDETDHSANPNKSEPSESKIKEVDEADWK 705
            V+ +EVS VD  D S D+NES+L E N+IE+D  E+NISE+ N++++ NV ETD S D N+ E  +  I ++DE E      I ++V+ V E D S + N+S+  E  I +VDE + KQ K+++LD VSK+D+ D S++ NESE AESNI EVD+ E  Q EQVNSEEVSNVD T HS + NE ELA+Q IIE+D  ++NI     LD+V+ VDE D   +PN+SE +ES I +VDE + K
Sbjct: 2043 VNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKN----ILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETK 2279          

HSP 7 Score: 156.762 bits (395), Expect = 1.777e-43
Identity = 124/238 (52.10%), Postives = 158/238 (66.39%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETT-QDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDE 693
            V+ EEVSNVD TDHS + NE +LAEQNII VDV +RNISE+ NL++VS V E D  VD NE+E  ESNIN VDE ET  Q+Q+  EEVS V E + SV  NE+   E   K+VD  E  Q+   N  + SK+DETD+S+  N+SEPAESNI +VD+ E  QQ+QVNSE+V  V + Y+S D N  E     +  +DE EKNI+++ NV     VDE +HS +  KSE +E  I+ VDE
Sbjct: 1476 VNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDE 1713          

HSP 8 Score: 153.68 bits (387), Expect = 2.033e-42
Identity = 123/244 (50.41%), Postives = 160/244 (65.57%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-DQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-------VDETDHSANPNKSEPSESKIKEVDEADWK 705
            ++LEEV+NVD+ D+S D NE  L E  + EV   E    ++ N E+ S + ETD SVDLNE+E  ESNI++VDE ET Q +Q+ SEEVS V   D S +PNE +  E NI  VD +++   +++NLD VSK+DE D  VD NESE AESNI +VD+GE  QQEQVN EEVSNV +  +SV  NE+ L + I  E+D VE   +  V+        VDETDHS  PN+SEP+ES I +VDE + K
Sbjct: 1394 INLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVEN--IQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETK 1635          

HSP 9 Score: 150.214 bits (378), Expect = 3.835e-41
Identity = 112/239 (46.86%), Postives = 157/239 (65.69%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETT-QDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDEA 696
            V+ E VS V++ D+S D NE +LA+ NI E+D GE NI++  N+++VS V E   S D  E+EP+E NIN+VDE E   Q+Q   EEV KV +KD S DPN+S+ VE +I ++D+ E      +N+D VSK++ETD++ + NESEP ESNI EVD+GE  QQEQVN EEVS V++   S D NESE+ +  I  + E E +I ++ NV     +DE D S   N+S+ +E  I E+D+ 
Sbjct: 3016 VNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQG 3254          

HSP 10 Score: 148.288 bits (373), Expect = 1.842e-40
Identity = 113/241 (46.89%), Postives = 155/241 (64.32%), Query Frame = 1
Query:    4 DLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-DQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDEADWK 705
            ++ E S +D+ D S D N+S+L+E  IIE+D  E+NIS+  N+++VS V ETD + +LNE+EP ESNI +VD  E  Q +Q+  EEVSKV E D S DPN S+  + NI ++    K  H++ NL +VSK  E D SVD NE E  + NI  +D+GE    E+ N  E+S +D+   SV  NES+LA+  IIEID+ + NI D VN+     VDE  HSA+ N++EPSE  I EVDE + K
Sbjct: 2773 NINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINELG--GKMTHEKFNLEEVSKARENDDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPK 3011          

HSP 11 Score: 144.436 bits (363), Expect = 3.785e-39
Identity = 116/242 (47.93%), Postives = 156/242 (64.46%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISE-QDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNI-----LDQVNVVDETDHSANPNKSEPSESKIKEVDEADWK 705
             +L  ++ +D+ D+S D  ES   E  I ++D  E  I + Q NLE+V  V ET+  ++ N +E  + NI KV+EE   Q+Q+  EEV+ V E+D SVD NE    E  +K+V   E  Q +++N +  SKLDETD+SVD NESE AESNI EVD+GE  Q EQVNSEEVSNVD T HS + NE ELA+Q II +D  ++NI     LD+V+ VDE D   +PN+SE +ES I +VDE + K
Sbjct: 1314 FNLYVMTKMDQKDNSVDPYESAHIEAKINKID--EETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETK 1553          

HSP 12 Score: 139.813 bits (351), Expect = 1.438e-37
Identity = 122/283 (43.11%), Postives = 159/283 (56.18%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNEN-----------------------------------------EPTESNINKVDEEETTQ-DQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQV-----NVVDETDHSANPNKSEPSESKIKEVDEADWK 705
            V+L+EVS VD+ D   D NES+ AE NI +VD GE    EQ N E+VSNV+E + SV LNEN                                         EP ESNINKVDEEET Q DQ+ SE+V +V EK  S DPN  +F++ N+K VDEEEK   ++ N+  +S +DE ++S D  +SE AE NI  VD+ E       N +E S VDK  HSV+ NE  L + I  EID+ E+   D V     + +DE  +SA+PN+SEP+ES I EVD+A+ K
Sbjct: 1517 VNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERK 1799          

HSP 13 Score: 139.043 bits (349), Expect = 2.394e-37
Identity = 108/241 (44.81%), Postives = 149/241 (61.83%), Query Frame = 1
Query:   13 EVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNE----------NEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEV 687
            E+S +D+ D S  +NESKLAE  IIE+D GE N+++   +++ SN +  D S DLNE           EP ESNIN+  EEE TQ++   E++SKV EKD S D NES+  E  I +VDE E KQ +Q+N + VSK++E D S D NES  AE  I+E+D G+    + VN  E+S VD+  HS D NE+E ++  I E+DE E    +QVN      V+E D+S +P++ EP+ES I E 
Sbjct: 3225 ELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEF 3465          

HSP 14 Score: 139.043 bits (349), Expect = 2.874e-37
Identity = 126/296 (42.57%), Postives = 161/296 (54.39%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEE-----VSKVGEKDVSVDPNESDFVEHNIKKVDE--------------------------------------------------EEKKQHKQINL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDEADWK 705
            V+++EVS V++TDH+ + NES+  E NI EVD GE    EQ N E+VS V E   S D NE+E  E NI  V E ET     ISEE     +SK+ E D SV  NES   EH I ++D+                                                  EE+   ++ NL D+SK+ E D S D+NESEP+ES I EVD+GE  QQEQVN EEVS V++  +S D NES LA+  I+EID+ + NI D VN+     VDE DHSA+ N++EPSES I EVDE + K
Sbjct: 3139 VNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETD----ISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPK 3430          

HSP 15 Score: 137.887 bits (346), Expect = 6.203e-37
Identity = 114/234 (48.72%), Postives = 154/234 (65.81%), Query Frame = 1
Query:   25 VDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDE-EETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVDEADWK 705
             D+T++S D  E + AE NI EVD  E    E+ NL++VS V ETD SVD NE+EP+ SNIN++ + E+   D++  ++VSK  E D SVDPN+S+  +  I +++ E    HK+INLD V K+DE + SVD NE E  ESNI  V++G+    E+ N  E S +D+   SVD N+SEL++  IIEID+VEKNI D VNV     V+ETD +AN N+SEP ES IKEVD  + K
Sbjct: 2619 ADETEYSVDQIERESAESNIDEVD-EEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGE--ITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPK 2849          

HSP 16 Score: 137.502 bits (345), Expect = 1.003e-36
Identity = 118/248 (47.58%), Postives = 155/248 (62.50%), Query Frame = 1
Query:   10 EEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETT-QDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNV----------DKTYHSVDQNESELAKQIIIEIDE----VEKNILDQVNVVDETDHSANPNKSEPSESKIKEVDEADWK 705
            EEV  V+K D+S D N+S+L E +IIE+D GE NI++  N+++VS V ETD + +LNE+EP ESNI +VDE E   Q+Q+  EEVSKV EK  S D NES+ VE NIK V E E    ++ N++ +SK+DE D SV TNES+ AE  IIE+D GE    + V  +E SN           ++T HS DQ E E A+  I E  E     EK  L+ ++ V E D S + N+SEPSES I EVDE + K
Sbjct: 3101 EEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPK 3348          

HSP 17 Score: 136.732 bits (343), Expect = 1.517e-36
Identity = 117/278 (42.09%), Postives = 163/278 (58.63%), Query Frame = 1
Query:    4 DLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLI-SEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEK----------------KQH--------------KQIN------------LDVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDE----VEKNILDQVNVVDETDHSANPNKSEPSESKIKEVDEA 696
            +++E+  V +T+HS D NE +L EQNIIE+D  E+NIS+Q N++++S V E D S D NE+E   SNIN+V+++ET Q +L+ S+E+S+V EKD S +PN+ +FVE NIK VDE EK                 +H              K +N            ++VSK+DE  YS D NE+   E    EVD+ E  Q + V SEE+   D+T +SVDQ E E A+  I E+DE     EK  L +V+ VDETDHS +PN+SEPS S I E+ + 
Sbjct: 2408 NVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEELK-ADETEYSVDQIERESAESNIDEVDEEEITQEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQG 2684          

HSP 18 Score: 136.732 bits (343), Expect = 1.703e-36
Identity = 119/284 (41.90%), Postives = 164/284 (57.75%), Query Frame = 1
Query:    4 DLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLIS-EEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIE-----------------------------------------VDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-------VDETDHSANPNKSEPSESKIKEVDEADWK 705
            +++E+ NV++TDHS D N+ +LA+Q IIE+D  E+NI +Q N+ D     ETD S + N++EP+ES IN+VDE +  Q + +  + VSKV +KD S++ NES+  E NI +VDE E KQ +Q+N + VS +D TD+S + NE E AE NIIE                                         VD+GE  QQEQVN EEVSNV +  +SV  NE+ L + I  E+D VE   +  V+        VDETDHS  PN+SEP+ES I +VDE + K
Sbjct: 2085 NVKELLNVNETDHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVD-----ETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVEN--IQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETK 2361          

HSP 19 Score: 135.191 bits (339), Expect = 6.059e-36
Identity = 113/239 (47.28%), Postives = 153/239 (64.02%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEET--TQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQ-INLDVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNI-----LDQVNVVDETDHSANPNKSEPSESKIKEVDE 693
            V+ E+V  V +  +S D N  +  + N+  VD  E+NI E+ N++ +SNV E + S D  ++E  E NI  VDEEE   T D  + EE SKV + D SV+ NE    E   K++D+ E+ Q    I+ + SKLDE  YS D NESEPAESNI EVD  E  QQ++++ EEVSNVDKT HS D NES+LA+Q IIE+D  E+NI     L++V+ V ETD S + N++EP+ES I +VDE
Sbjct: 1640 VNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEE-SKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDE 1877          

HSP 20 Score: 132.109 bits (331), Expect = 7.377e-35
Identity = 112/277 (40.43%), Postives = 148/277 (53.43%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISE----------------------------------------EVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQ-INL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVD 690
            V+ EEVS V++ D+S D NES LAE  I+E+D G+ NI++  NL ++S V E D S DLNENEP+ESNIN+VDE E  Q + ++                                         E SK+ EKD S DPN+S+  E NI  VDEEE KQ +Q  N  + SK+ E D S D NE+E  E +I  + +GE    E+ N +E++ V    HS DQ          IE +  E+NI D VN      VDETDH+ + N+SEP+ES   EVD
Sbjct: 3353 VNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEFGGEMTNEKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQ----------IEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVD 3619          

HSP 21 Score: 128.642 bits (322), Expect = 8.973e-34
Identity = 103/235 (43.83%), Postives = 151/235 (64.26%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEV 687
             +L+EVS VD+TDHS D NES+ +  NI E+  GE+NIS++ N++ VS   E+D SVD N++EP +S IN++ E E T  ++  +EV KV E + SVDPNE + VE NI+ V+E +    ++ N++  S +DE D SVD N+SE +E  IIE+D  E    + VN +EVS V++T  + + NESE  +  I E+D  E    +QVN+     V+E D+S +PN SEP +S I E+
Sbjct: 2651 FNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI-EGEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINEL 2884          

HSP 22 Score: 121.709 bits (304), Expect = 2.590e-31
Identity = 117/276 (42.39%), Postives = 149/276 (53.99%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDE------EETTQDQL------------------------ISE------------EVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLDVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEV 687
            V+++E+S VD+ DHSAD NES+ A  NI EV+  E    E  N +++S V+E D S + N+ E  E NI  VDE      EE+    L                        ++E            EVSKV E   S DPNE+   E   K+VD  E  Q   +  +  K DET+YSVD  E E AESNI EVD+ E T QE+ N +EVS VD+T HSVD NESE +   I EI + EKNI D+VNV      DE+DHS +PNKSEP +S I E+
Sbjct: 2448 VNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEELKADETEYSVDQIERESAESNIDEVDEEEIT-QEKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEI 2722          

HSP 23 Score: 120.168 bits (300), Expect = 7.810e-31
Identity = 95/199 (47.74%), Postives = 126/199 (63.32%), Query Frame = 1
Query:  112 ISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNV-----VDETDHSANPNKSEPSESKIKEVD 690
            ++E  NL  ++ + + D SVD  E+   E+ INK+DEE   Q Q+  EEV KV E +  ++PN S+  +HNI KV+EE KKQ +QINL+ V+ +DE DYSVD NE    E  + EV + E  Q ++VNSEE S +D+T HSVD NESELA+  I E+DE E   L+QVN      VD TDHS  PN+ E +E  I  VD
Sbjct: 1310 VNETFNLYVMTKMDQKDNSVDPYESAHIEAKINKIDEETIKQKQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKKQ-EQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVD 1507          

HSP 24 Score: 108.612 bits (270), Expect = 1.031e-26
Identity = 107/234 (45.73%), Postives = 139/234 (59.40%), Query Frame = 1
Query:    7 LEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDE--VEKNI-LDQVNVVDETDHSANPNKSEPSESKIKEVDEA 696
            L+ +S +D T HS D NE +LAE NI  V+  ER++    NL +VS V E   S D NEN  TE    +VD  E  Q   +  E  K  E + SVD  E +  E NI +VDEEE  Q K  NL +VSK+DETD+SVD NESEP+ SNI E+  GE    ++VN ++VS  D++ HSVD N+SE  K  I EI+     K I LD+V  VDE + S +PN+ E  ES I+ V+E 
Sbjct: 2532 LKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEELKADETEYSVDQIERESAESNIDEVDEEEITQEK-FNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGEITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEG 2764          

HSP 25 Score: 100.523 bits (249), Expect = 5.012e-24
Identity = 100/290 (34.48%), Postives = 142/290 (48.97%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVF-------------------------------ETDPSVDLNENEPTESNIN-------------KVDEEETTQDQLISEEVSK------VGEKDVSVDPNESDFV-----EHNI--KKVDEEEKKQHKQINL-DVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNVVDETDHSANPNKSEPSESKIKEVDEA 696
             + EE S V + D+S D NE++L E +I  +  GE+NISE+ N+++++ VF                               ETD + D NE+EP ESN N             KVDE++ + D   +E V        VGEK++S +    D +     EH++   K   EE+      NL D+S++DE D+SV++NE      N+IEVD G+  Q E  N EE+S VD+ +HS + NESEL +  I E+DE E N   QV          NPN+S P E    EVD  
Sbjct: 3516 FNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEEESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQV----------NPNESTPIECNTNEVDGG 3795          

HSP 26 Score: 90.5077 bits (223), Expect = 1.385e-20
Identity = 80/198 (40.40%), Postives = 106/198 (53.54%), Query Frame = 1
Query:    7 LEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLIS-EEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLDVSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKN 597
            L+++  VDKT+HS           N ++  + ERNI++  NL D+S V E D SV+ NE   T  N+ +VD+ +  Q +  + EE+SKV E   S +PNES+  E NI +VDE E  Q KQ+N               NES P E N  EVD GE  Q E VN EE S VDK  + VD  ES   K  + ++ E EKN
Sbjct: 3666 LKDLLKVDKTEHSV----------NQMKCKIEERNITDDANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN--------------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKN 3839          

HSP 27 Score: 85.8853 bits (211), Expect = 6.149e-19
Identity = 86/268 (32.09%), Postives = 138/268 (51.49%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVD-----------------------------------VGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLD-VSKLDETDYSVDTNESEPAESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNILDQVNVVDETDHSANPNKSEPSESKIKEVDEA 696
            V+ ++VS+VD+TDH+ DSNES+ AE N  EVD                                   VGE+NIS +  L+D+  V +T+ SV+  +         K++E   T D  +  ++S+V E D SV+ NE      N+ +VD+ +K QH+  NL+ +SK+DE  +S + NESE  ESNI EVD+GE  QQ+QVN  E + ++   + VD  E    + + +E          + ++VD+ D+  +P +S  ++  + +V E 
Sbjct: 3588 VNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNSEEESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSVNQMKC--------KIEERNITDDANL-RDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIECNTNEVDGGEKYQTEHVNLE----------EESMVDKIDNFVDPKESPFTKPDVNKVSEG 3836          

HSP 28 Score: 61.6178 bits (148), Expect = 9.453e-11
Identity = 62/190 (32.63%), Postives = 91/190 (47.89%), Query Frame = 1
Query:    1 VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNVFETDPSVDLNENEPTESNINKVDEEETTQDQLIS---------------------------EEVSKVGEKDVSVDPNESDFVEHNIKKVDEEEKKQHKQINLDVSKLDETDYSVDTNESEP---------AESNIIEVDD 462
             +L ++S VD+ DHS +SNE  L   N+IEVD G++N  E  NLE++S V E   S + NE+E  ESNI +VDE ET Q + ++                           EE S V + D  VDP ES F + ++ KV E EK + +   +  + +D      D  E+           A  N+I ++D
Sbjct: 3695 ANLRDLSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVNPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAETQIVKSTDVDTIFVQNDVKENSKMYIENAQILASPNVISIND 3884          
The following BLAST results are available for this feature:
BLAST of SMED30000550 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000550 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064314.11.515e-12388.09SMESG000064314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000550 ID=SMED30000550|Name=SMED30000550|organism=Schmidtea mediterranea sexual|type=transcript|length=705bp
GTTGATTTGGAAGAAGTTTCAAATGTTGATAAAACAGATCATTCTGCTGA
TTCAAATGAGAGTAAACTTGCTGAGCAGAATATCATTGAAGTCGATGTTG
GTGAAAGAAATATATCCGAACAAGATAATTTAGAAGATGTGTCAAATGTA
TTTGAAACAGATCCTTCCGTCGATTTGAATGAAAATGAACCTACTGAATC
TAATATCAACAAAGTCGATGAAGAAGAAACGACACAAGACCAATTAATTT
CGGAAGAGGTATCAAAGGTTGGTGAAAAAGATGTTTCTGTTGATCCTAAT
GAAAGTGACTTTGTTGAGCATAATATCAAAAAGGTCGACGAAGAAGAAAA
GAAACAACACAAACAAATTAATTTGGATGTGTCAAAGCTGGATGAAACAG
ATTATTCTGTTGATACAAATGAAAGTGAACCTGCGGAGTCTAATATCATT
GAAGTCGATGACGGAGAATGGACACAGCAAGAGCAAGTTAATTCTGAAGA
AGTGTCAAATGTGGATAAAACATATCATTCCGTCGATCAAAATGAAAGTG
AACTTGCTAAGCAAATTATAATCGAAATCGATGAAGTTGAAAAGAATATA
TTAGATCAAGTTAATGTGGTTGATGAAACAGATCATTCTGCTAATCCAAA
TAAAAGTGAACCTTCTGAGTCTAAAATCAAGGAGGTAGATGAGGCAGATT
GGAAA
back to top

protein sequence of SMED30000550-orf-1

>SMED30000550-orf-1 ID=SMED30000550-orf-1|Name=SMED30000550-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
VDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEDVSNV
FETDPSVDLNENEPTESNINKVDEEETTQDQLISEEVSKVGEKDVSVDPN
ESDFVEHNIKKVDEEEKKQHKQINLDVSKLDETDYSVDTNESEPAESNII
EVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELAKQIIIEIDEVEKNI
LDQVNVVDETDHSANPNKSEPSESKIKEVDEADWK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ