Mitogen activated protein kinase kinase kinase

Overview
NameMitogen activated protein kinase kinase kinase
Smed IDSMED30000517
Length (bp)3012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen activated protein kinase kinase kinase (SMED30000517) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen activated protein kinase kinase kinase (SMED30000517) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen activated protein kinase kinase kinase (SMED30000517) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen activated protein kinase kinase kinase (SMED30000517) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000517

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30000517SMESG000017706.1 dd_Smed_v4_4486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000517SMESG000017706.1 dd_Smed_v4_4486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000517SMESG000017706.1 dd_Smed_v4_4486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000517SMESG000017706.1 dd_Smed_v4_4486_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Human
Match: MINK1 (misshapen like kinase 1 [Source:HGNC Symbol;Acc:HGNC:17565])

HSP 1 Score: 358.607 bits (919), Expect = 6.930e-112
Identity = 189/300 (63.00%), Postives = 229/300 (76.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+      N  QLWLVMEFC AGS+TDLVK T G + KED I+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSDIWSLGITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F  FID  L K    RP  +QL+  PF+     ER + IQL+D I +  ++RG
Sbjct:   10 LSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRIQLKDHIDRSRKKRG 309          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Human
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6866])

HSP 1 Score: 363.614 bits (932), Expect = 8.158e-108
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 270.011 bits (689), Expect = 8.040e-75
Identity = 128/338 (37.87%), Postives = 206/338 (60.95%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS-----------PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+             + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  829 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHVRKNPHSMIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1165          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Human
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6866])

HSP 1 Score: 363.229 bits (931), Expect = 8.311e-108
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 273.092 bits (697), Expect = 7.383e-76
Identity = 128/330 (38.79%), Postives = 206/330 (62.42%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  826 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1154          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Human
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6866])

HSP 1 Score: 363.614 bits (932), Expect = 9.394e-108
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 270.011 bits (689), Expect = 8.271e-75
Identity = 128/338 (37.87%), Postives = 206/338 (60.95%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS-----------PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+             + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  829 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHVRKNPHSMIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1165          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Human
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6866])

HSP 1 Score: 363.999 bits (933), Expect = 1.451e-107
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 273.478 bits (698), Expect = 9.520e-76
Identity = 128/330 (38.79%), Postives = 206/330 (62.42%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  907 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1235          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 332.413 bits (851), Expect = 1.388e-97
Identity = 183/337 (54.30%), Postives = 242/337 (71.81%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXX-XXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----------------SKKNERRGYRRGANINIRDNPDKAT 1004
            L++L++P G + LIEVVG GTYG VYKG+     QL AIK+M+IN +E +EI LEIN +K+ S+++NVATY+G+F+    +      QLWLVMEFC +GSITDLVK T G S KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT++AEVKLVDFGVSAQLD+T+G+RNTFIGTP+WMAPEVI C+++P + YD RSD+WSLGITA+EMAEG PPLC+ HPMRALFLI +NPPPKLK  K  +  F++FI+  L K   +RP    L+ HPF+    +E+ I   +++ I                 S+ +E     RG ++ IRD+ + ++
Sbjct:   11 LNSLRDPAGIFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRRNTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWTKKFETFIETVLVKDYHQRPYTGALLRHPFIKEQPHEQTIRHSIKEHIDRNRRVKKDDADYEYSGSEDDEPSPNNRGPSMGIRDDSESSS 347          

HSP 2 Score: 271.937 bits (694), Expect = 3.742e-76
Identity = 136/324 (41.98%), Postives = 203/324 (62.65%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-------YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPP---MYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KKK +GEI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+ V+E  N L  ISG+  +I+ Y L     K+L  E        +K     N+G+  + A HFK V+Y+ I FL+V L +SI IY+WAP+PY KFM +K +  L   PLIV+LT+E++ ++K+LY +  GF+AI+ +     D++ P+       P+ I++LP  +G  LLLCY++E VYV+T G++ K+V+L+W   P +++ +S  Q +  G+KA+E+R ++TG L G+  HK+  K +FLCE+N ++  S  K   S QI   +L   G   W
Sbjct:  750 KKKFSGEILCAALWGVNLLIGTDSGLMLLDRSGQGKVYPLISRRRFDQMTVLEGQNILATISGRKRRIRVYYLSWLRQKILRTEGAGSANTTEKRNGWVNVGD-LQGAIHFKIVRYERIKFLVVGLESSIEIYAWAPKPYHKFMSFKSFGSLSHVPLIVDLTVEDNARLKVLYGSTGGFHAIDLDSAAVYDIYTPAQSGQTTTPHCIVVLPNSNGMQLLLCYDNEGVYVNTYGRMTKNVVLQWGEMPSSVAYISTGQIMGWGNKAIEIRSVDTGHLDGVFMHKKAQKLKFLCERNDKVFFSSAKGGGSCQIYFMTLNKPGLTNW 1072          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 332.413 bits (851), Expect = 1.611e-97
Identity = 183/337 (54.30%), Postives = 242/337 (71.81%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXX-XXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----------------SKKNERRGYRRGANINIRDNPDKAT 1004
            L++L++P G + LIEVVG GTYG VYKG+     QL AIK+M+IN +E +EI LEIN +K+ S+++NVATY+G+F+    +      QLWLVMEFC +GSITDLVK T G S KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT++AEVKLVDFGVSAQLD+T+G+RNTFIGTP+WMAPEVI C+++P + YD RSD+WSLGITA+EMAEG PPLC+ HPMRALFLI +NPPPKLK  K  +  F++FI+  L K   +RP    L+ HPF+    +E+ I   +++ I                 S+ +E     RG ++ IRD+ + ++
Sbjct:   11 LNSLRDPAGIFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRRNTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWTKKFETFIETVLVKDYHQRPYTGALLRHPFIKEQPHEQTIRHSIKEHIDRNRRVKKDDADYEYSGSEDDEPSPNNRGPSMGIRDDSESSS 347          

HSP 2 Score: 271.937 bits (694), Expect = 4.242e-76
Identity = 136/324 (41.98%), Postives = 203/324 (62.65%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-------YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPP---MYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KKK +GEI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+ V+E  N L  ISG+  +I+ Y L     K+L  E        +K     N+G+  + A HFK V+Y+ I FL+V L +SI IY+WAP+PY KFM +K +  L   PLIV+LT+E++ ++K+LY +  GF+AI+ +     D++ P+       P+ I++LP  +G  LLLCY++E VYV+T G++ K+V+L+W   P +++ +S  Q +  G+KA+E+R ++TG L G+  HK+  K +FLCE+N ++  S  K   S QI   +L   G   W
Sbjct:  765 KKKFSGEILCAALWGVNLLIGTDSGLMLLDRSGQGKVYPLISRRRFDQMTVLEGQNILATISGRKRRIRVYYLSWLRQKILRTEGAGSANTTEKRNGWVNVGD-LQGAIHFKIVRYERIKFLVVGLESSIEIYAWAPKPYHKFMSFKSFGSLSHVPLIVDLTVEDNARLKVLYGSTGGFHAIDLDSAAVYDIYTPAQSGQTTTPHCIVVLPNSNGMQLLLCYDNEGVYVNTYGRMTKNVVLQWGEMPSSVAYISTGQIMGWGNKAIEIRSVDTGHLDGVFMHKKAQKLKFLCERNDKVFFSSAKGGGSCQIYFMTLNKPGLTNW 1087          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 332.413 bits (851), Expect = 1.806e-97
Identity = 183/337 (54.30%), Postives = 242/337 (71.81%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXX-XXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----------------SKKNERRGYRRGANINIRDNPDKAT 1004
            L++L++P G + LIEVVG GTYG VYKG+     QL AIK+M+IN +E +EI LEIN +K+ S+++NVATY+G+F+    +      QLWLVMEFC +GSITDLVK T G S KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT++AEVKLVDFGVSAQLD+T+G+RNTFIGTP+WMAPEVI C+++P + YD RSD+WSLGITA+EMAEG PPLC+ HPMRALFLI +NPPPKLK  K  +  F++FI+  L K   +RP    L+ HPF+    +E+ I   +++ I                 S+ +E     RG ++ IRD+ + ++
Sbjct:   11 LNSLRDPAGIFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRRNTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWTKKFETFIETVLVKDYHQRPYTGALLRHPFIKEQPHEQTIRHSIKEHIDRNRRVKKDDADYEYSGSEDDEPSPNNRGPSMGIRDDSESSS 347          

HSP 2 Score: 271.552 bits (693), Expect = 4.803e-76
Identity = 136/324 (41.98%), Postives = 203/324 (62.65%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-------YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPP---MYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KKK +GEI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+ V+E  N L  ISG+  +I+ Y L     K+L  E        +K     N+G+  + A HFK V+Y+ I FL+V L +SI IY+WAP+PY KFM +K +  L   PLIV+LT+E++ ++K+LY +  GF+AI+ +     D++ P+       P+ I++LP  +G  LLLCY++E VYV+T G++ K+V+L+W   P +++ +S  Q +  G+KA+E+R ++TG L G+  HK+  K +FLCE+N ++  S  K   S QI   +L   G   W
Sbjct:  760 KKKFSGEILCAALWGVNLLIGTDSGLMLLDRSGQGKVYPLISRRRFDQMTVLEGQNILATISGRKRRIRVYYLSWLRQKILRTEGAGSANTTEKRNGWVNVGD-LQGAIHFKIVRYERIKFLVVGLESSIEIYAWAPKPYHKFMSFKSFGSLSHVPLIVDLTVEDNARLKVLYGSTGGFHAIDLDSAAVYDIYTPAQSGQTTTPHCIVVLPNSNGMQLLLCYDNEGVYVNTYGRMTKNVVLQWGEMPSSVAYISTGQIMGWGNKAIEIRSVDTGHLDGVFMHKKAQKLKFLCERNDKVFFSSAKGGGSCQIYFMTLNKPGLTNW 1082          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 332.413 bits (851), Expect = 2.162e-97
Identity = 183/337 (54.30%), Postives = 242/337 (71.81%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXX-XXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----------------SKKNERRGYRRGANINIRDNPDKAT 1004
            L++L++P G + LIEVVG GTYG VYKG+     QL AIK+M+IN +E +EI LEIN +K+ S+++NVATY+G+F+    +      QLWLVMEFC +GSITDLVK T G S KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT++AEVKLVDFGVSAQLD+T+G+RNTFIGTP+WMAPEVI C+++P + YD RSD+WSLGITA+EMAEG PPLC+ HPMRALFLI +NPPPKLK  K  +  F++FI+  L K   +RP    L+ HPF+    +E+ I   +++ I                 S+ +E     RG ++ IRD+ + ++
Sbjct:   11 LNSLRDPAGIFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNINEDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRRNTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRNPPPKLKRNKKWTKKFETFIETVLVKDYHQRPYTGALLRHPFIKEQPHEQTIRHSIKEHIDRNRRVKKDDADYEYSGSEDDEPSPNNRGPSMGIRDDSESSS 347          

HSP 2 Score: 271.552 bits (693), Expect = 4.979e-76
Identity = 136/324 (41.98%), Postives = 203/324 (62.65%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-------YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPP---MYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KKK +GEI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+ V+E  N L  ISG+  +I+ Y L     K+L  E        +K     N+G+  + A HFK V+Y+ I FL+V L +SI IY+WAP+PY KFM +K +  L   PLIV+LT+E++ ++K+LY +  GF+AI+ +     D++ P+       P+ I++LP  +G  LLLCY++E VYV+T G++ K+V+L+W   P +++ +S  Q +  G+KA+E+R ++TG L G+  HK+  K +FLCE+N ++  S  K   S QI   +L   G   W
Sbjct:  774 KKKFSGEILCAALWGVNLLIGTDSGLMLLDRSGQGKVYPLISRRRFDQMTVLEGQNILATISGRKRRIRVYYLSWLRQKILRTEGAGSANTTEKRNGWVNVGD-LQGAIHFKIVRYERIKFLVVGLESSIEIYAWAPKPYHKFMSFKSFGSLSHVPLIVDLTVEDNARLKVLYGSTGGFHAIDLDSAAVYDIYTPAQSGQTTTPHCIVVLPNSNGMQLLLCYDNEGVYVNTYGRMTKNVVLQWGEMPSSVAYISTGQIMGWGNKAIEIRSVDTGHLDGVFMHKKAQKLKFLCERNDKVFFSSAKGGGSCQIYFMTLNKPGLTNW 1096          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 220.705 bits (561), Expect = 6.427e-61
Identity = 137/304 (45.07%), Postives = 189/304 (62.17%), Query Frame = 3
Query:   45 VMIKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLS--NNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERR 950
            + I+ LD    PE  ++  E +G+G++G VYKG DN  G++VAIK++D+   E E   ++   I+ LS  +++ V  YFGSF+   K    LW++ME+   GS  DL K+       E  I+ I REI+KGL +LH    IHRDIK  NVL++ + +VK+ DFGV+ QL  T+ KR TF+G+PFWMAPE+I       S YD ++DIWSLGITAIE+A G PP  + HPMR LFLI KNPPP L+  +WS  FK F++  L K  + RP+A  L+ H F+     ++N I  L DLI +  E R
Sbjct:   23 IYIQKLD----PEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQE-IQVLSQCDSQYVTKYFGSFLKGSK----LWIIMEYLGGGSALDLTKSGK---LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIK-----QSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKRA--KKNSI--LVDLIERAAEYR 305          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333363)

HSP 1 Score: 358.607 bits (919), Expect = 8.021e-107
Identity = 194/340 (57.06%), Postives = 247/340 (72.65%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ--QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISK------KNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQ 1055
            L  LK+P G + LIEVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ SN++N+ATY+G+F+      +  QLWLVME+C AGS+TDLVK+T G S KE+WI+YI REI++GL +LH N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WSLGITA+EMAE +PPLC+ HPMRALFLI +N PP+LKS KWS  F  FID  L K   +RP  + L+ H F+     +R + IQL+D I +      + ER  YR   + N  D P  A  ++ ++      DT+++
Sbjct:   22 LTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLA-GEHSSIVQAPGGDTLRR 360          

HSP 2 Score: 272.707 bits (696), Expect = 2.676e-76
Identity = 129/322 (40.06%), Postives = 208/322 (64.60%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEK-----EYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KK+   EI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+EV+E  N L+ ISGK ++++ Y L    +K+L       + ++     N+G+  + A HFK VKY+ I FL++AL +SI IY+WAP+PY KFM +K + +L  +PL+V+LTIE+ +++K++Y + +GF+A++ +     D+++P      + P+ I+ LP  +G  LLLCY++E VYV+T G++ K+++L+W   P +++ +   Q +  G+KA+E+R + +G L G+  HK+  + +FLCE+N ++  S  K  SS QI   +L   G   W
Sbjct:  781 KKRFNSEILCAALWGVNLLIGTENGLMLLDRSGQGKVYQLISRRRFQQMEVLEGQNILVTISGKKNRVRVYYLSWLKSKILRTDGLSDQVERRNGWINVGD-LQGAVHFKIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKNFGELEHRPLLVDLTIEDQSRLKVIYGSAEGFHAVDLDSAEVYDIYLPKHTQGAIIPHCIVALPNSNGMQLLLCYDNEGVYVNTVGRVSKNIVLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVESGHLDGVFMHKKAQRLKFLCERNDKVFFSSAKGASSCQIYFMTLNKPGMANW 1101          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072959)

HSP 1 Score: 358.607 bits (919), Expect = 8.239e-107
Identity = 194/340 (57.06%), Postives = 247/340 (72.65%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ--QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISK------KNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQ 1055
            L  LK+P G + LIEVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ SN++N+ATY+G+F+      +  QLWLVME+C AGS+TDLVK+T G S KE+WI+YI REI++GL +LH N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WSLGITA+EMAE +PPLC+ HPMRALFLI +N PP+LKS KWS  F  FID  L K   +RP  + L+ H F+     +R + IQL+D I +      + ER  YR   + N  D P  A  ++ ++      DT+++
Sbjct:   22 LTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLA-GEHSSIVQAPGGDTLRR 360          

HSP 2 Score: 272.707 bits (696), Expect = 2.779e-76
Identity = 129/322 (40.06%), Postives = 208/322 (64.60%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEK-----EYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KK+   EI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+EV+E  N L+ ISGK ++++ Y L    +K+L       + ++     N+G+  + A HFK VKY+ I FL++AL +SI IY+WAP+PY KFM +K + +L  +PL+V+LTIE+ +++K++Y + +GF+A++ +     D+++P      + P+ I+ LP  +G  LLLCY++E VYV+T G++ K+++L+W   P +++ +   Q +  G+KA+E+R + +G L G+  HK+  + +FLCE+N ++  S  K  SS QI   +L   G   W
Sbjct:  782 KKRFNSEILCAALWGVNLLIGTENGLMLLDRSGQGKVYQLISRRRFQQMEVLEGQNILVTISGKKNRVRVYYLSWLKSKILRTDGLSDQVERRNGWINVGD-LQGAVHFKIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKNFGELEHRPLLVDLTIEDQSRLKVIYGSAEGFHAVDLDSAEVYDIYLPKHTQGAIIPHCIVALPNSNGMQLLLCYDNEGVYVNTVGRVSKNIVLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVESGHLDGVFMHKKAQRLKFLCERNDKVFFSSAKGASSCQIYFMTLNKPGMANW 1102          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072958)

HSP 1 Score: 358.607 bits (919), Expect = 8.239e-107
Identity = 194/340 (57.06%), Postives = 247/340 (72.65%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ--QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISK------KNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQ 1055
            L  LK+P G + LIEVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ SN++N+ATY+G+F+      +  QLWLVME+C AGS+TDLVK+T G S KE+WI+YI REI++GL +LH N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WSLGITA+EMAE +PPLC+ HPMRALFLI +N PP+LKS KWS  F  FID  L K   +RP  + L+ H F+     +R + IQL+D I +      + ER  YR   + N  D P  A  ++ ++      DT+++
Sbjct:   22 LTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLA-GEHSSIVQAPGGDTLRR 360          

HSP 2 Score: 272.707 bits (696), Expect = 2.779e-76
Identity = 129/322 (40.06%), Postives = 208/322 (64.60%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEK-----EYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KK+   EI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+EV+E  N L+ ISGK ++++ Y L    +K+L       + ++     N+G+  + A HFK VKY+ I FL++AL +SI IY+WAP+PY KFM +K + +L  +PL+V+LTIE+ +++K++Y + +GF+A++ +     D+++P      + P+ I+ LP  +G  LLLCY++E VYV+T G++ K+++L+W   P +++ +   Q +  G+KA+E+R + +G L G+  HK+  + +FLCE+N ++  S  K  SS QI   +L   G   W
Sbjct:  782 KKRFNSEILCAALWGVNLLIGTENGLMLLDRSGQGKVYQLISRRRFQQMEVLEGQNILVTISGKKNRVRVYYLSWLKSKILRTDGLSDQVERRNGWINVGD-LQGAVHFKIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKNFGELEHRPLLVDLTIEDQSRLKVIYGSAEGFHAVDLDSAEVYDIYLPKHTQGAIIPHCIVALPNSNGMQLLLCYDNEGVYVNTVGRVSKNIVLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVESGHLDGVFMHKKAQRLKFLCERNDKVFFSSAKGASSCQIYFMTLNKPGMANW 1102          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333364)

HSP 1 Score: 359.762 bits (922), Expect = 1.969e-106
Identity = 194/340 (57.06%), Postives = 247/340 (72.65%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ--QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISK------KNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQ 1055
            L  LK+P G + LIEVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ SN++N+ATY+G+F+      +  QLWLVME+C AGS+TDLVK+T G S KE+WI+YI REI++GL +LH N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WSLGITA+EMAE +PPLC+ HPMRALFLI +N PP+LKS KWS  F  FID  L K   +RP  + L+ H F+     +R + IQL+D I +      + ER  YR   + N  D P  A  ++ ++      DT+++
Sbjct:   22 LTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLA-GEHSSIVQAPGGDTLRR 360          

HSP 2 Score: 273.092 bits (697), Expect = 5.083e-76
Identity = 129/322 (40.06%), Postives = 208/322 (64.60%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEK-----EYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KK+   EI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+EV+E  N L+ ISGK ++++ Y L    +K+L       + ++     N+G+  + A HFK VKY+ I FL++AL +SI IY+WAP+PY KFM +K + +L  +PL+V+LTIE+ +++K++Y + +GF+A++ +     D+++P      + P+ I+ LP  +G  LLLCY++E VYV+T G++ K+++L+W   P +++ +   Q +  G+KA+E+R + +G L G+  HK+  + +FLCE+N ++  S  K  SS QI   +L   G   W
Sbjct:  893 KKRFNSEILCAALWGVNLLIGTENGLMLLDRSGQGKVYQLISRRRFQQMEVLEGQNILVTISGKKNRVRVYYLSWLKSKILRTDGLSDQVERRNGWINVGD-LQGAVHFKIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKNFGELEHRPLLVDLTIEDQSRLKVIYGSAEGFHAVDLDSAEVYDIYLPKHTQGAIIPHCIVALPNSNGMQLLLCYDNEGVYVNTVGRVSKNIVLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVESGHLDGVFMHKKAQRLKFLCERNDKVFFSSAKGASSCQIYFMTLNKPGMANW 1213          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333365)

HSP 1 Score: 359.377 bits (921), Expect = 2.120e-106
Identity = 194/340 (57.06%), Postives = 247/340 (72.65%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ--QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISK------KNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQ 1055
            L  LK+P G + LIEVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ SN++N+ATY+G+F+      +  QLWLVME+C AGS+TDLVK+T G S KE+WI+YI REI++GL +LH N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WSLGITA+EMAE +PPLC+ HPMRALFLI +N PP+LKS KWS  F  FID  L K   +RP  + L+ H F+     +R + IQL+D I +      + ER  YR   + N  D P  A  ++ ++      DT+++
Sbjct:   22 LTALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRLKSKKWSKKFHGFIDTVLVKDYHQRPYTENLLKHGFIKDQPTDRQVRIQLKDHIDRCKKRKQEKEREDYRYSGSDNDDDEPQLA-GEHSSIVQAPGGDTLRR 360          

HSP 2 Score: 273.092 bits (697), Expect = 5.529e-76
Identity = 129/322 (40.06%), Postives = 208/322 (64.60%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEK-----EYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL---GALKW 2966
            KK+   EI CAA WGVNLLIG+  GL  +DRSG GK+Y L+ RR+F Q+EV+E  N L+ ISGK ++++ Y L    +K+L       + ++     N+G+  + A HFK VKY+ I FL++AL +SI IY+WAP+PY KFM +K + +L  +PL+V+LTIE+ +++K++Y + +GF+A++ +     D+++P      + P+ I+ LP  +G  LLLCY++E VYV+T G++ K+++L+W   P +++ +   Q +  G+KA+E+R + +G L G+  HK+  + +FLCE+N ++  S  K  SS QI   +L   G   W
Sbjct:  880 KKRFNSEILCAALWGVNLLIGTENGLMLLDRSGQGKVYQLISRRRFQQMEVLEGQNILVTISGKKNRVRVYYLSWLKSKILRTDGLSDQVERRNGWINVGD-LQGAVHFKIVKYERIKFLVIALKDSIEIYAWAPKPYHKFMAFKNFGELEHRPLLVDLTIEDQSRLKVIYGSAEGFHAVDLDSAEVYDIYLPKHTQGAIIPHCIVALPNSNGMQLLLCYDNEGVYVNTVGRVSKNIVLQWGEMPTSVAYIGTGQIMGWGNKAIEIRSVESGHLDGVFMHKKAQRLKFLCERNDKVFFSSAKGASSCQIYFMTLNKPGMANW 1200          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: tnikb (TRAF2 and NCK interacting kinase b [Source:ZFIN;Acc:ZDB-GENE-051113-320])

HSP 1 Score: 368.237 bits (944), Expect = 3.094e-116
Identity = 189/304 (62.17%), Postives = 238/304 (78.29%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KE+W +YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFI+  L K   +RP+ +QLI HPF+  + NER + IQL+D I +  ++RG R
Sbjct:   15 LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSHHRNIATYYGAFI--KKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWTAYICREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHNQRPSTEQLIKHPFIKDLPNERQVRIQLKDHIDRTKKKRGER 316          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: tnikb (TRAF2 and NCK interacting kinase b [Source:ZFIN;Acc:ZDB-GENE-051113-320])

HSP 1 Score: 365.925 bits (938), Expect = 2.696e-115
Identity = 187/300 (62.33%), Postives = 236/300 (78.67%), Query Frame = 3
Query:   72 KEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            ++P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KE+W +YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFI+  L K   +RP+ +QLI HPF+  + NER + IQL+D I +  ++RG R
Sbjct:   19 RDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSHHRNIATYYGAFI--KKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWTAYICREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHNQRPSTEQLIKHPFIKDLPNERQVRIQLKDHIDRTKKKRGER 316          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: tnika (TRAF2 and NCK interacting kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-3767])

HSP 1 Score: 364.77 bits (935), Expect = 1.205e-107
Identity = 188/304 (61.84%), Postives = 232/304 (76.32%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIK MD+   E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KEDW +YISREI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+ +RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITA+EMAEG PPLCE HPMRALFLI +N PP+LKS KW+  F SFI+  L K    RP   QL+ HPF+  + NER I IQL+D I +  ++RG R
Sbjct:   15 LSTLRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKCMDVTGEEEEEIKAEINMLKKYSHHRNIATYYGAFI--KKNPPGVDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEDWTAYISREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVSRRNTFIGTPYWMAPEVIACDENPDATYDYKSDLWSLGITALEMAEGAPPLCELHPMRALFLIPRNAPPRLKSKKWTKRFHSFIESCLVKNHNMRPGTDQLLKHPFIRDMANERTIRIQLKDHIDRTRKKRGER 316          

HSP 2 Score: 275.404 bits (703), Expect = 1.692e-76
Identity = 126/311 (40.51%), Postives = 200/311 (64.31%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y+L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     ++L  + E +K      +GE      H+K VKY+ I FL++AL NS+ IY+WAP+PY KFM +K + +L  +P +V+LT+E   ++K++Y +  GF+ I+ +  +  D++IPS     + P+AI++LP   G  +LLCY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct:  986 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLITRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGE-LEGCIHYKVVKYERIKFLVIALKNSVEIYAWAPKPYHKFMAFKSFTELQHRPQLVDLTVEEGQRLKVIYGSSVGFHVIDVDSGSPYDIYIPSHIQSTVTPHAIVVLPKTDGMEMLLCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTL 1295          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: tnika (TRAF2 and NCK interacting kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-3767])

HSP 1 Score: 364.77 bits (935), Expect = 1.880e-107
Identity = 188/304 (61.84%), Postives = 232/304 (76.32%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIK MD+   E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KEDW +YISREI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+ +RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITA+EMAEG PPLCE HPMRALFLI +N PP+LKS KW+  F SFI+  L K    RP   QL+ HPF+  + NER I IQL+D I +  ++RG R
Sbjct:   15 LSTLRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKCMDVTGEEEEEIKAEINMLKKYSHHRNIATYYGAFI--KKNPPGVDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEDWTAYISREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVSRRNTFIGTPYWMAPEVIACDENPDATYDYKSDLWSLGITALEMAEGAPPLCELHPMRALFLIPRNAPPRLKSKKWTKRFHSFIESCLVKNHNMRPGTDQLLKHPFIRDMANERTIRIQLKDHIDRTRKKRGER 316          

HSP 2 Score: 275.404 bits (703), Expect = 1.958e-76
Identity = 126/311 (40.51%), Postives = 200/311 (64.31%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y+L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     ++L  + E +K      +GE      H+K VKY+ I FL++AL NS+ IY+WAP+PY KFM +K + +L  +P +V+LT+E   ++K++Y +  GF+ I+ +  +  D++IPS     + P+AI++LP   G  +LLCY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct: 1015 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLITRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGE-LEGCIHYKVVKYERIKFLVIALKNSVEIYAWAPKPYHKFMAFKSFTELQHRPQLVDLTVEEGQRLKVIYGSSVGFHVIDVDSGSPYDIYIPSHIQSTVTPHAIVVLPKTDGMEMLLCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTL 1324          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: mink1 (misshapen-like kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-45])

HSP 1 Score: 362.844 bits (930), Expect = 5.233e-107
Identity = 192/300 (64.00%), Postives = 230/300 (76.67%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+   E EEI  EIN +K+ S+++N+ATY+G+FV      +  QLWLVMEFC AGS+TDLVK T G S KEDWI+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP+S YD RSDIWSLGITAIEMAEG PPLC+ HPMRALFLI +NPPPKLKS KWS  F  FI+  L K    RP+ +QL+ H F+     ER + IQL+D I +  ++RG
Sbjct:   15 LAALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEEEEEEIKAEINMLKKYSHHRNIATYYGAFVKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTKGNSLKEDWIAYICREILRGLSHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDSTYDYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSKKWSKKFIDFIEGCLVKSYPNRPSTEQLLKHSFIRDQPTERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 266.159 bits (679), Expect = 2.352e-73
Identity = 127/311 (40.84%), Postives = 198/311 (63.67%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDD-LYC--QPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+  R+F Q++V+E +N LI ISGK +K++ Y L     K+L  + E +K      +GE      H+K VKY+ I FL++AL N++ +Y+WAP+PY KFM +K     LY   +P++V+LT+E   ++K++Y +  GF+AI+ +  N  D++IP   + P+AI+ LP   G  +LLCY  E VYV+T G+I+KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct:  954 KKRFNSEILCAALWGVNLLVGTENGLKLLDRSGQGKVYPLINSRRFQQMDVLEGLNLLITISGKKNKVRVYYLAWLRNKILHNDPEVEKKQGWTTVGE-MEGCVHYKVVKYERIKFLVIALKNAVEVYAWAPKPYHKFMAFKVLTQALYLPHRPVLVDLTVEEGQRLKVIYGSLAGFHAIDVDSGNNYDIYIPVH-ITPHAIVFLPNSDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAHICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTL 1262          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: limk1 (LIM domain kinase 1 [Source:Xenbase;Acc:XB-GENE-1011258])

HSP 1 Score: 357.451 bits (916), Expect = 1.577e-108
Identity = 189/297 (63.64%), Postives = 231/297 (77.78%), Query Frame = 3
Query:   69 LKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ--QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L+EP G + L+EVVG GTYG VYKG+    GQL AIKVM++   E EEI LEIN +K+ S+++N+ATY+G+FV      Q  QLWLVME+C AGS+TDLVK T G  FKEDWI+YI RE+++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP+S YD RSD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NPPPKLKS KWS    +F+D  L K    RP+   L+ H FV  + NER+I I L+D + +  +++G
Sbjct:   23 LQEPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMNVTEEEEEEIKLEINMLKKYSHHRNIATYYGAFVRKGLAGQDDQLWLVMEYCGAGSVTDLVKKTKGNCFKEDWIAYICREVLRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDSTYDYRSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSRKWSKKCINFVDSCLVKNYSHRPSTDTLLKHAFVRDLQNERHIRIMLKDHLDRARKKKG 319          

HSP 2 Score: 270.011 bits (689), Expect = 1.419e-76
Identity = 129/312 (41.35%), Postives = 200/312 (64.10%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKEYD--KNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLG 2954
            KKK   EI CAA WGVNLL+G+  GL  +DRSG G++Y L+ RR+F Q++V+E +N LI ISGK +K++ Y L     K+L  + D  K     ++G+      H+K VKY+ I FL++AL NS+ +Y+WAP+PY KFM +K +  L+ +PL V+LT+EN  ++K++Y +  GF+AI+ +     DL++P+     ++P+AI+ILP  +G  LL+ Y  E VY+DT G+  K+ IL+W   P +++ +  +Q +  G KA+E+R   TG L+G+  HK+  K +FLCE+N ++  S  +S    QI   +LG
Sbjct:  505 KKKFNSEILCAALWGVNLLVGTEHGLWLLDRSGQGRVYPLISRRRFYQMDVLEGLNILITISGKKNKLRVYYLSWLRNKILRNDPDVEKRQGWVSVGD-LEGCVHYKVVKYERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFSSLHHKPLFVDLTVENGQRLKVIYGSAVGFHAIDVDSGTAYDLYLPTHMQGNIHPHAIIILPNTNGMELLVSYEDEGVYIDTYGRFTKETILQWGEMPASVAYLQSNQIMGWGEKAIELRSGETGSLEGVFMHKKAQKLKFLCERNDKVFFSSVQSGGCSQIYFMTLG 815          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: limk1 (LIM domain kinase 1 [Source:Xenbase;Acc:XB-GENE-1011258])

HSP 1 Score: 357.451 bits (916), Expect = 1.780e-108
Identity = 189/297 (63.64%), Postives = 231/297 (77.78%), Query Frame = 3
Query:   69 LKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ--QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L+EP G + L+EVVG GTYG VYKG+    GQL AIKVM++   E EEI LEIN +K+ S+++N+ATY+G+FV      Q  QLWLVME+C AGS+TDLVK T G  FKEDWI+YI RE+++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP+S YD RSD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NPPPKLKS KWS    +F+D  L K    RP+   L+ H FV  + NER+I I L+D + +  +++G
Sbjct:   23 LQEPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMNVTEEEEEEIKLEINMLKKYSHHRNIATYYGAFVRKGLAGQDDQLWLVMEYCGAGSVTDLVKKTKGNCFKEDWIAYICREVLRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDSTYDYRSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSRKWSKKCINFVDSCLVKNYSHRPSTDTLLKHAFVRDLQNERHIRIMLKDHLDRARKKKG 319          

HSP 2 Score: 270.396 bits (690), Expect = 1.135e-76
Identity = 129/312 (41.35%), Postives = 200/312 (64.10%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKEYD--KNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLG 2954
            KKK   EI CAA WGVNLL+G+  GL  +DRSG G++Y L+ RR+F Q++V+E +N LI ISGK +K++ Y L     K+L  + D  K     ++G +     H+K VKY+ I FL++AL NS+ +Y+WAP+PY KFM +K +  L+ +PL V+LT+EN  ++K++Y +  GF+AI+ +     DL++P+     ++P+AI+ILP  +G  LL+ Y  E VY+DT G+  K+ IL+W   P +++ +  +Q +  G KA+E+R   TG L+G+  HK+  K +FLCE+N ++  S  +S    QI   +LG
Sbjct:  504 KKKFNSEILCAALWGVNLLVGTEHGLWLLDRSGQGRVYPLISRRRFYQMDVLEGLNILITISGKKNKLRVYYLSWLRNKILRNDPDVEKRQGWVSVG-DLEGCVHYKVVKYERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFSSLHHKPLFVDLTVENGQRLKVIYGSAVGFHAIDVDSGTAYDLYLPTHMQGNIHPHAIIILPNTNGMELLVSYEDEGVYIDTYGRFTKETILQWGEMPASVAYLQSNQIMGWGEKAIELRSGETGSLEGVFMHKKAQKLKFLCERNDKVFFSSVQSGGCSQIYFMTLG 814          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:100491719])

HSP 1 Score: 364.77 bits (935), Expect = 3.946e-108
Identity = 194/300 (64.67%), Postives = 237/300 (79.00%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G S KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP  +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPPTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 276.174 bits (705), Expect = 7.475e-77
Identity = 130/330 (39.39%), Postives = 207/330 (62.73%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLG---ALKW 2966
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +     D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG    L W
Sbjct:  855 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGDLVHRPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGAVYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRSSLLSW 1183          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:100491719])

HSP 1 Score: 364.385 bits (934), Expect = 3.959e-108
Identity = 194/300 (64.67%), Postives = 237/300 (79.00%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G S KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP  +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPPTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 276.174 bits (705), Expect = 6.829e-77
Identity = 128/319 (40.13%), Postives = 203/319 (63.64%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLG---ALKW 2966
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +     D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG    L W
Sbjct:  859 KKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGDLVHRPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGAVYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRSSLLSW 1176          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:100491719])

HSP 1 Score: 362.459 bits (929), Expect = 4.340e-108
Identity = 194/300 (64.67%), Postives = 237/300 (79.00%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G S KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP  +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPPTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 273.092 bits (697), Expect = 3.430e-76
Identity = 130/330 (39.39%), Postives = 207/330 (62.73%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLG---ALKW 2966
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     K+L  + E +K      +G+      H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +     D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG    L W
Sbjct:  754 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGD-LEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGDLVHRPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGAVYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRSSLLSW 1082          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Map4k4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1349394])

HSP 1 Score: 362.073 bits (928), Expect = 2.151e-115
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Map4k4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1349394])

HSP 1 Score: 364.385 bits (934), Expect = 6.239e-108
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 274.633 bits (701), Expect = 2.577e-76
Identity = 128/330 (38.79%), Postives = 206/330 (62.42%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  880 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELLHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1208          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Map4k4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1349394])

HSP 1 Score: 363.999 bits (933), Expect = 1.097e-107
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 273.863 bits (699), Expect = 4.260e-76
Identity = 128/330 (38.79%), Postives = 206/330 (62.42%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  906 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELLHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1234          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Map4k4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1349394])

HSP 1 Score: 363.999 bits (933), Expect = 1.219e-107
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 274.248 bits (700), Expect = 3.720e-76
Identity = 128/330 (38.79%), Postives = 206/330 (62.42%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  910 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELLHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1238          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Map4k4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1349394])

HSP 1 Score: 363.614 bits (932), Expect = 1.269e-107
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 274.248 bits (700), Expect = 3.824e-76
Identity = 128/330 (38.79%), Postives = 206/330 (62.42%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  893 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELLHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1221          
BLAST of Mitogen activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|O95819|M4K4_HUMAN (Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2)

HSP 1 Score: 363.999 bits (933), Expect = 7.748e-107
Identity = 193/300 (64.33%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+  L K   +RP+ +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 273.863 bits (699), Expect = 3.954e-75
Identity = 128/330 (38.79%), Postives = 206/330 (62.42%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW*FW 2975
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK  K++ Y L     K+L  + E +K      +G +     H+K VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+A++ +  +  D+++P+     + P+AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +LG      W
Sbjct:  911 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW 1239          
BLAST of Mitogen activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|P83510|TNIK_MOUSE (Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2)

HSP 1 Score: 364.77 bits (935), Expect = 1.449e-106
Identity = 187/302 (61.92%), Postives = 236/302 (78.15%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G + KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFI+  L K   +RP  +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFI--KKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRG 314          

HSP 2 Score: 276.174 bits (705), Expect = 9.452e-76
Identity = 126/311 (40.51%), Postives = 201/311 (64.63%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y+L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     ++L  + E +K      +G +     H+K VKY+ I FL++AL N++ IY+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K+++ +  GF+ I+ +  N  D++IPS     + P+AI+ILP   G  +L+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct: 1006 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVG-DLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTL 1315          
BLAST of Mitogen activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|Q9UKE5|TNIK_HUMAN (TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK PE=1 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.371e-106
Identity = 187/302 (61.92%), Postives = 236/302 (78.15%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G + KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFI+  L K   +RP  +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNIATYYGAFI--KKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNTLKEEWIAYICREILRGLSHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHSQRPATEQLMKHPFIRDQPNERQVRIQLKDHIDRTKKKRG 314          

HSP 2 Score: 275.789 bits (704), Expect = 1.319e-75
Identity = 126/311 (40.51%), Postives = 201/311 (64.63%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y+L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     ++L  + E +K      +G +     H+K VKY+ I FL++AL N++ IY+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K+++ +  GF+ I+ +  N  D++IPS     + P+AI+ILP   G  +L+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct: 1043 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVG-DLEGCIHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFADLQHKPLLVDLTVEEGQRLKVIFGSHTGFHVIDVDSGNSYDIYIPSHIQGNITPHAIVILPKTDGMEMLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVFFMTL 1352          
BLAST of Mitogen activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|Q9JM52|MINK1_MOUSE (Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3)

HSP 1 Score: 358.221 bits (918), Expect = 2.149e-104
Identity = 189/300 (63.00%), Postives = 229/300 (76.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+      N  QLWLVMEFC AGS+TDLVK T G + KED I+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSDIWSLGITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F  FID  L K    RP  +QL+  PF+     ER + IQL+D I +  ++RG
Sbjct:   15 LSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFTDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRIQLKDHIDRSRKKRG 314          

HSP 2 Score: 277.33 bits (708), Expect = 3.229e-76
Identity = 127/311 (40.84%), Postives = 200/311 (64.31%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N LI ISGK +K++ Y L     K+L  + E +K      +G +     H++ VKY+ I FL++AL NS+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +  N  D++IP      + P+AI+ LP   G  +LLCY  E VYV+T G+I+KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct:  991 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYGLIGRRRFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DMEGCGHYRVVKYERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAVDVDSGNSYDIYIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAYICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTL 1300          
BLAST of Mitogen activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|Q8N4C8|MINK1_HUMAN (Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1 PE=1 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 4.949e-104
Identity = 189/300 (63.00%), Postives = 229/300 (76.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+      N  QLWLVMEFC AGS+TDLVK T G + KED I+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSDIWSLGITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F  FID  L K    RP  +QL+  PF+     ER + IQL+D I +  ++RG
Sbjct:   15 LSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRIQLKDHIDRSRKKRG 314          

HSP 2 Score: 275.404 bits (703), Expect = 1.622e-75
Identity = 126/311 (40.51%), Postives = 200/311 (64.31%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N LI ISGK +K++ Y L     K+L  + E +K      +G +     H++ VKY+ I FL++AL +S+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +  N  D++IP      + P+AI+ LP   G  +LLCY  E VYV+T G+I+KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct: 1015 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYGLIGRRRFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG-DMEGCGHYRVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAVDVDSGNSYDIYIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAYICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTL 1324          
BLAST of Mitogen activated protein kinase kinase kinase vs. TrEMBL
Match: A0A504YG90 (Serine threonine-protein kinase mig-15 OS=Fasciola gigantica OX=46835 GN=FGIG_03595 PE=3 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 5.673e-116
Identity = 194/306 (63.40%), Postives = 235/306 (76.80%), Query Frame = 3
Query:   51 IKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXX-----XXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLIS--KKNER 947
            I  LDNL +P G +SLIEVVGKGTYGNVYKG+     QL AIKVM I   + EEI+LEINT+++LSN++N+ATY+G+F+        LWLVME+C AGS+TDLVK+T G S KEDWI+YI REI++GL+HLH+N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLD+T GKRNTFIGTP+WMAPEVIHCE +    YD RSD+WSLGITA+EMAEGRPPLCE HPMRALFLI +NPPP+LK         S  F  F++K L K   +RP    L+ H F+ ++ NER + IQL+D I   K+N+R
Sbjct:    8 ITNLDNLSDPSGIFSLIEVVGKGTYGNVYKGRHVRTSQLAAIKVMPITQEDEEEIILEINTLRKLSNHRNIATYYGAFIKKASPQDHLWLVMEYCGAGSVTDLVKSTRGQSLKEDWIAYICREILRGLVHLHNNRVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDKTFGKRNTFIGTPYWMAPEVIHCEQDSRCTYDARSDLWSLGITALEMAEGRPPLCEMHPMRALFLIMRNPPPRLKQAPNGSRHWSLRFHDFVNKCLTKDFTKRPNTADLLRHEFITNLPNERQVRIQLKDHIDRHKRNKR 313          
BLAST of Mitogen activated protein kinase kinase kinase vs. TrEMBL
Match: Q5EAR9 (Zgc:152783 protein (Fragment) OS=Danio rerio OX=7955 GN=tnikb PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.638e-114
Identity = 189/304 (62.17%), Postives = 238/304 (78.29%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KE+W +YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFI+  L K   +RP+ +QLI HPF+  + NER + IQL+D I +  ++RG R
Sbjct:   15 LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSHHRNIATYYGAFI--KKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWTAYICREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLVKNHNQRPSTEQLIKHPFIKDLPNERQVRIQLKDHIDRTKKKRGER 316          
BLAST of Mitogen activated protein kinase kinase kinase vs. TrEMBL
Match: A0A183QJJ9 (Protein kinase domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.344e-114
Identity = 187/305 (61.31%), Postives = 228/305 (74.75%), Query Frame = 3
Query:   51 IKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXX-----XXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERR 950
            I  LD+L++P G +SLIEVVGKGTYGNVYKG+    GQL AIKVM I   + EEI LEI+T+K+LSN++N+A+Y+G+F+        LWL ME+C AGS+ DL+K+T   S KEDWI+YISREI++GL+HLH N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLD+T GKRNTFIGTP+WMAPEVIHCE + +  YD RSDIWSLGITA+EMAEGRPPLCE HPMRALFLI +N           S  W+P F  F++K L K   +RP   +L  H F+ ++ NER I IQL+D I +    R
Sbjct:    9 ITNLDDLRDPSGIFSLIEVVGKGTYGNVYKGRYTRTGQLAAIKVMPITEEDEEEIKLEIDTLKKLSNHRNIASYYGAFIKKSSPRDHLWLAMEYCGAGSVADLIKSTRTKSLKEDWIAYISREILRGLMHLHANRVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDKTFGKRNTFIGTPYWMAPEVIHCEQDSSCTYDARSDIWSLGITALEMAEGRPPLCEMHPMRALFLIMRNSPPRLKQSPNGSRHWTPRFHDFVNKCLTKDFHKRPNTSELFRHEFITNLPNERQIRIQLKDHIDRHRRNR 313          
BLAST of Mitogen activated protein kinase kinase kinase vs. TrEMBL
Match: A0A1B6HXX0 (Protein kinase domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.33745 PE=3 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 4.366e-114
Identity = 194/324 (59.88%), Postives = 243/324 (75.00%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISK------KNERRGYRRGANINIRDNPDKATD 1007
            L+ LK+P G + LIEVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ SN++N+ATY+G+F+         QLWLVME+C AGS+TDLVK+T G S KE+WI+YI REI++GL +LH N VIHRDIKGQNVLLT+NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WSLGITA+EMAE +PPLC+ HPMRALFLI +NPPP+LKS KW+  F  FI+  L K   +RP  +QL+ HPF+     ERN+ IQL+D I +      + ER  YR   + N  + P  A +
Sbjct:   19 LNALKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNPPPRLKSKKWAKKFHGFIETVLVKDYHQRPYTEQLLKHPFIRDQPTERNVRIQLKDHIDRCKKRKQEKEREDYRYSGSENEEEEPALAGE 342          
BLAST of Mitogen activated protein kinase kinase kinase vs. TrEMBL
Match: A0A1S3PNS8 (mitogen-activated protein kinase kinase kinase kinase 4-like isoform X12 OS=Salmo salar OX=8030 GN=LOC106586477 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 1.043e-113
Identity = 194/300 (64.67%), Postives = 238/300 (79.33%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G + KEDWI+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SFI+ SL K   +RP  +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSTGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFCSFIEGSLVKNYTQRPPTEQLLKHPFIRDQPNERQVRIQLKDHIDRTKKKRG 314          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: TNIK (TRAF2 and NCK interacting kinase [Source:HGNC Symbol;Acc:HGNC:30765])

HSP 1 Score: 366.311 bits (939), Expect = 9.550e-109
Identity = 188/299 (62.88%), Postives = 235/299 (78.60%), Query Frame = 3
Query:   75 EPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            +P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+FV  +KN      QLWLVMEFC AGS+TDL+K T G S KE+W +YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFID  L K   +RP+ +QL+ HPF+  + NER + IQL+D I +  ++RG R
Sbjct:   16 DPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSHHRNIATYYGAFV--KKNPPGIDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWTAYICREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIDSCLVKNHTQRPSTEQLLKHPFIRDLTNERQVRIQLKDHIDRTKKKRGER 312          

HSP 2 Score: 270.781 bits (691), Expect = 3.267e-75
Identity = 125/311 (40.19%), Postives = 199/311 (63.99%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y+L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     ++L  + E +K      +G +     H+K VKY+ I FL++AL N++ IY+WAP+PY KFM +K + DL  +P +V+LT+E   ++K++Y +  GF+ I+ +  N  D++IPS     + P+AI++LP   G  +LLCY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FL E+N ++  +  +S  S Q+   +L
Sbjct:  900 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVG-DLEGCVHYKVVKYERIKFLVIALKNAVEIYAWAPKPYHKFMAFKSFTDLQHKPQLVDLTVEEGQRLKVIYGSSVGFHVIDVDSGNPYDIYIPSHIQGSVTPHAIVVLPKTDGMEMLLCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLSERNDKVFFASVRSGGSSQVFFMTL 1209          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:103041713])

HSP 1 Score: 366.696 bits (940), Expect = 7.697e-108
Identity = 191/300 (63.67%), Postives = 233/300 (77.67%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G   KED I+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS  WS  F SFI+  L K   +RP   QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNKLKEDQIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKTWSKKFFSFIESCLVKNYTQRPPTDQLLKHPFIRDQPNERQVRIQLKDQIDRTRKKRG 314          

HSP 2 Score: 275.789 bits (704), Expect = 1.973e-76
Identity = 130/330 (39.39%), Postives = 205/330 (62.12%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGA---LKW 2966
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     K+L  + E +K      +GE      H+K VKY+ I FL++AL NS+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +     D+++P+     +  +AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +   S Q+   +LG    L W
Sbjct: 1062 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGE-LEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLAHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYDIYLPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRQGGSSQVYFMTLGRTNLLSW 1390          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:103041713])

HSP 1 Score: 365.155 bits (936), Expect = 8.752e-108
Identity = 191/300 (63.67%), Postives = 233/300 (77.67%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G   KED I+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS  WS  F SFI+  L K   +RP   QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNKLKEDQIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKTWSKKFFSFIESCLVKNYTQRPPTDQLLKHPFIRDQPNERQVRIQLKDQIDRTRKKRG 314          

HSP 2 Score: 275.404 bits (703), Expect = 1.692e-76
Identity = 130/330 (39.39%), Postives = 205/330 (62.12%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGA---LKW 2966
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     K+L  + E +K      +GE      H+K VKY+ I FL++AL NS+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +     D+++P+     +  +AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +   S Q+   +LG    L W
Sbjct:  989 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGE-LEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLAHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYDIYLPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRQGGSSQVYFMTLGRTNLLSW 1317          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:103041713])

HSP 1 Score: 365.925 bits (938), Expect = 1.532e-107
Identity = 191/300 (63.67%), Postives = 233/300 (77.67%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G   KED I+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS  WS  F SFI+  L K   +RP   QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNKLKEDQIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKTWSKKFFSFIESCLVKNYTQRPPTDQLLKHPFIRDQPNERQVRIQLKDQIDRTRKKRG 314          

HSP 2 Score: 275.404 bits (703), Expect = 2.287e-76
Identity = 130/330 (39.39%), Postives = 205/330 (62.12%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGA---LKW 2966
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     K+L  + E +K      +GE      H+K VKY+ I FL++AL NS+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +     D+++P+     +  +AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +   S Q+   +LG    L W
Sbjct: 1071 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGE-LEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLAHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYDIYLPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRQGGSSQVYFMTLGRTNLLSW 1399          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: MAP4K4 (mitogen-activated protein kinase kinase kinase kinase 4 [Source:NCBI gene;Acc:103041713])

HSP 1 Score: 366.311 bits (939), Expect = 2.298e-107
Identity = 191/300 (63.67%), Postives = 233/300 (77.67%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L +L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGSITDLVK T G   KED I+YISREI++GL HLH +HVIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WS GITAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS  WS  F SFI+  L K   +RP   QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:   15 LSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNKLKEDQIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKTWSKKFFSFIESCLVKNYTQRPPTDQLLKHPFIRDQPNERQVRIQLKDQIDRTRKKRG 314          

HSP 2 Score: 275.404 bits (703), Expect = 2.773e-76
Identity = 130/330 (39.39%), Postives = 205/330 (62.12%), Query Frame = 3
Query: 2001 PSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGA---LKW 2966
            P  +T +    KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     K+L  + E +K      +GE      H+K VKY+ I FL++AL NS+ +Y+WAP+PY KFM +K + DL  +PL+V+LT+E   ++K++Y +  GF+A++ +     D+++P+     +  +AI+ILP   G  LL+CY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +   S Q+   +LG    L W
Sbjct: 1149 PQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGE-LEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLAHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYDIYLPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRQGGSSQVYFMTLGRTNLLSW 1477          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000169.1 (pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gene:ENSPMAG00000000147.1 transcript:ENSPMAT00000000169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 328.176 bits (840), Expect = 1.131e-98
Identity = 173/274 (63.14%), Postives = 214/274 (78.10%), Query Frame = 3
Query:  138 KGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            +G+    GQL AIKVMD+  +E EEI LEIN +K+ S+++N+ATY+G+F+      +  QLWLVMEFC AGS+TDLVK T G S KEDWI+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD RSD+WSLG+TAIEMAEG PPLC+ HPMRALFLI +NPPP+LKS KWS  F SF +  L K   +R   +QL+ HPF+    NER + IQL+D I +  ++RG
Sbjct:    1 QGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTKGNSLKEDWIAYICREILRGLSHLHAHRVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSLGVTAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKRFLSFAESCLVKNYLQRLPTEQLLKHPFIREQPNERQVRIQLKDHIDRTRKKRG 274          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 221.861 bits (564), Expect = 6.165e-64
Identity = 133/312 (42.63%), Postives = 185/312 (59.29%), Query Frame = 3
Query:   63 DNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXX-TIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKG--QNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYRRGANINIRDN 989
            ++  +PE  ++  E +GKG++G V+KG DN   ++VAIK++D+   E E   ++   T+    ++  V  YFGS++   K    LW++ME+   GS  DL+K       +E  I+ I REI+KGL +LH    IHRDIKG   NVLL+   +VKL DFGV+ QL  T  KRNTF+GTPFWMAPEVI       S YD ++DIWSLGITAIE+A+G PP  E HPMR LFLI     P      +S  FK F+D  L K  Q RPTAK+L+ H F+     + + + +L D   K+ +  G+  G++    D+
Sbjct:   17 NSCADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTK----LWIIMEYLGGGSALDLIKPGP---LEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIK-----QSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLI-PKNNPPTLEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKKTSYLTELIDRY-KRWKAEGHDEGSSSGESDD 314          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: myo3a (myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4])

HSP 1 Score: 231.491 bits (589), Expect = 9.559e-63
Identity = 132/304 (43.42%), Postives = 179/304 (58.88%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIK-------RLSNNKNVATYFGSFVHHQK---NVQQLWLVMEFCAAGSITDLVKTTSGLSFKED--WISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLI-XXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIIN-ERNIIIQLRDLI 929
             + LK+P   + L+E +GKGTYG VYK     +G   A+K +D   N           I+        L  + N+  +FG  +++QK   N  QLW+V+E C  GS+TDLVK       + D   I+YI R  + GL HLH +++IHRDIKG N+LLT +  ++LVDFGVSAQ+ +T  +RNT +GTPFWMAPEVI CE   +  YD R D+WS+GITAIE+ +G PPL E HPMRALF I +  PP   +   W P F  FI + L K  + R T  QL+  PF+  +   E+ +  QL +LI
Sbjct:   14 FEQLKDPSDTWELVETIGKGTYGKVYKATSRKDGSKAAVKTLDPVNNLETSNQDIDEEIEAEYSILTSLPEHPNIVRFFG--MYYQKDGVNGDQLWIVLELCNGGSVTDLVKGQLKRGERMDVMLIAYILRGALLGLNHLHSHNIIHRDIKGNNILLTTDGGIRLVDFGVSAQVSKTRVERNTAVGTPFWMAPEVIACEQQLDYMYDRRCDVWSMGITAIELGDGDPPLYELHPMRALFKIPRNPPPTLKQPELWPPLFNEFIAQCLVKDFERRATVSQLLEDPFIQQVEGREQELQKQLTELI 315          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 216.853 bits (551), Expect = 6.967e-59
Identity = 113/266 (42.48%), Postives = 174/266 (65.41%), Query Frame = 3
Query:   90 YSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXX---XXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFV 878
            + L E +G GTYG+V+K ++   G+LVAIK++ + P +   ++ +   + +   + N+  Y+GS++ H K    LW+ ME C  GS+ D+   T  L+  E  I+Y++RE ++GL +LH    +HRDIKG N+LLT++ +VKL DFGVSAQ+  T+ KR +FIGTP+WMAPEV   E      Y+ + D+W++GITAIE+AE +PP+ + HPMRALFL+ K+           KWSP F +FI  +L K  ++RPTA+++++H +V
Sbjct:   14 FELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDK----LWICMEHCGGGSLQDIYHVTGPLT--ERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGG--YNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSYV 271          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010511.1 (pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1 gene:ENSPMAG00000009510.1 transcript:ENSPMAT00000010511.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 1.261e-54
Identity = 113/277 (40.79%), Postives = 172/277 (62.09%), Query Frame = 3
Query:  135 YKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXX---XXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGY 956
            ++ ++  +G L AIKV+ +   +   ++ +   + +   + N+  YFGS++   K    LW+ ME+C  GS+ D+   T  LS ++  I+Y+SRE +KGL +LH    +HRDIKG N+LLT++ EVKL DFGVSAQ+  T+ KR +FIGTP+WMAPEV   E      Y+++ D+W++GITAIE+AE +PP+ + HPMRALFL+ K+           KWS  F +FI +SL K  ++RPTA +L+  PFV   +N R++  +L D +      R +
Sbjct:    1 FQARNVQSGALSAIKVIKLESGDDFTVIQQEIIMMQECQHINIVAYFGSYLRWDK----LWICMEYCGGGSLQDIYHVTGPLSERQ--IAYVSRETLKGLAYLHSKCKMHRDIKGANILLTDHGEVKLADFGVSAQITATIAKRMSFIGTPYWMAPEVAAVERKGG--YNQQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSNFQPPRLKDKVKWSGIFHNFIKQSLIKNPKKRPTADKLLQDPFVIQPLN-RSLATELLDQMKSPAPPRNF 268          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 186.422 bits (472), Expect = 1.174e-48
Identity = 108/261 (41.38%), Postives = 159/261 (60.92%), Query Frame = 3
Query:  102 EVVGKGTYGNVYKGKDNVNGQLVAIKVM--DXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFV 878
            EV+G+G +G VYKG +   G++ AIKV+  D + +E+E++  EI  +  L    N+  Y+GS++        LW++ME CA GS+  L++        E +I  I RE++  L  +H ++VIHRDIK  NVL+TN   VKL DFGV+AQ+++T  +R T  GTP+WMAPEVI        +YD + DIWSLGIT  E+A G PP C+   +RA+ LI K+ PP+L+   +S + K FI   L +  +ER +A  L+   F+
Sbjct:   27 EVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDT----SLWIIMEHCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIM----EGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFI 276          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 178.718 bits (452), Expect = 1.416e-48
Identity = 116/300 (38.67%), Postives = 172/300 (57.33%), Query Frame = 3
Query:   78 PEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKN--VATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLR---DLISKKNERRGYRR 962
            P   YS+   +G+G +G+VYK  D V  ++VAIKV+++  ++ +  LL    I  L+  K+  +  Y  + +        +W+VME+C  GS +DL+K +      E+ +S+I  E+  GL +LH+   IHRDIK  N+LL     VKL DFGVS  +  TL KR+TF+GTP+WMAPEV+ CE +    Y+E++DIWSLGIT  E+ +G PPL +  PM+ +  + K  PPKL+ P      K F+   L K   +RP+A  L+S  FV +I      I  L+   DLI +K  +  Y +
Sbjct:   14 PSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQE-IFFLAELKSPLITNYIATMLEDV----SMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTL-KRDTFVGTPYWMAPEVVCCEVDG---YNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAA-KDFVAGCLVKTPADRPSAYNLLSFEFVKNI-----TITNLKSDVDLIKQKKVQERYTK 298          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 166.392 bits (420), Expect = 1.162e-42
Identity = 107/311 (34.41%), Postives = 158/311 (50.80%), Query Frame = 3
Query:   75 EPEGYYSLIEVVGKGTYGNVYKGKDN-----------VN--------GQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTT-----SGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXX-XXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLIS 932
            +P   + +IE  G+G  G+VY  +             +N        G  VAIK M ++    +E+++    + + S +KN+  +  +++   +    LW+VMEF   GS+TD+++ +     S     E  I+YI RE  +GL  LHD H+IHRDIK  NVLL   A VK+ DFG  A+L     KR T +GTP+WMAPEV+   +     YDE+ D+WSLGI  IEM EG PP     P++AL+LI  N  P        S   K F+   L   ++ R + ++L+ H F        N+    +DL S
Sbjct:  541 DPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYL---RTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQRE-----YDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFF-------NMACDPKDLTS 836          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 162.155 bits (409), Expect = 3.116e-41
Identity = 95/285 (33.33%), Postives = 149/285 (52.28%), Query Frame = 3
Query:   75 EPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXX-XXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDL 926
            +P   Y+ +  +G+G  G VY   +      VAIK M++     +E+++    + + S + N+  +  S+V        LW++ME+   GS+TD+V   +     E  I  + RE + GL  LH   V+HRDIK  N+LL+   ++KL DFG  AQ++    KR T +GTP+WMAPEV+  ++     Y  + DIWSLGI  IEM EG PP     P+RAL+LI  N      +    S + K F+D  L  + ++R +A +L+   ++  I    + +  L  L
Sbjct:  615 DPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKG----DLWVIMEYMEGGSLTDVV---THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKE-----YGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKL 887          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 159.458 bits (402), Expect = 4.700e-41
Identity = 93/318 (29.25%), Postives = 160/318 (50.31%), Query Frame = 3
Query:   42 IVMIKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGK-----------------DNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTS-------GLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXX-XXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLR 920
            I+ +KT+     P  Y+ L+E  G+G  G VY  K                   V G+ VAIK + ++    +++++    +   S  +N+  +  +++      ++LW++ME+   G +TD++   +            E+ ++YI +E  +GL  LH+  +IHRDIK  N+LL +   VK+ DFG   +L     KR T +GTP+WMAPE+++        YDE+ D+WSLGI  IEM EG PP     P++AL+LI  N           S   K F+D  L+  ++ R + ++L++  F++   +   + + L+
Sbjct:  344 IMKMKTVAIDVNPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDD---EELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVN-----QKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLSMACSPEQLKVSLK 653          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 346.28 bits (887), Expect = 2.753e-111
Identity = 178/304 (58.55%), Postives = 230/304 (75.66%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ----QLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLI-XXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASI-INERNIIIQLRDLISKKNERRG 953
            L  LK+P G + L+EVVG GTYG V+KG+    GQL AIK+MD+  +E EEI LEIN +++ SN++N+ATY+G+F+  +K++Q    QLWLVMEFC AGS+TDLVKT    + KE+WISYI RE++ G+ HLH NHVIHRDIKGQNVLLT +AEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++ P++ YD R D+WS+GITAIEMAE +PPLC+ HPMRALFLI + +PP       WS  F  F++  L K  Q RPTA QL+ H F+  +  +ER I I+L+D I +  +++G
Sbjct:   10 LAALKDPAGIFDLVEVVGNGTYGQVHKGRHKRTGQLTAIKIMDVTEDEEEEIKLEINVLRKFSNHRNIATYYGAFI--KKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALFLIPRSDPPKLKSKKSWSKRFHHFVNTCLIKDYQHRPTADQLLQHEFIKDVRSSERKIRIELKDFIDRMRKKKG 311          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO40960 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T5])

HSP 1 Score: 253.447 bits (646), Expect = 1.848e-76
Identity = 129/313 (41.21%), Postives = 189/313 (60.38%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL---EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSN-QMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            K K   EI C A WGVNLLIG+  GL  +DRSG GK++ L+ RR+F QI+V+E IN LI ISGK HK++ Y L    AK+L   E ++++    +    +     H+K V +  I FL +A  N I +Y+WAP+PY KFM +K + DL   P+++N+TIE  N ++K+ YA+  GF++++ +     DL+IP+      YP+AI  LP   G  LLLC+N+E VY DT G++++   ++W   P  I+ V   Q +  G KA+EVR + TG L G+  HK     RFLCE+N +   +  +STSS Q+   +L
Sbjct:    8 KYKFRSEILCGALWGVNLLIGTETGLYLLDRSGNGKVFQLISRRRFQQIDVLEGINVLITISGKRHKLRVYYLSWLKAKILKGEEADHNRRQRGYTTVGSIEGCVHYKVVNFHRIKFLAMASRNRIEVYAWAPKPYHKFMAFKSFPDLKHNPVLLNMTIEKENSKLKVCYASDIGFHSVDLDSAAVSDLYIPTKLQERFYPHAITPLPSSGGRELLLCFNNEGVYADTFGQLVRHATMQWGETPYAIASVGVGQIMGWGEKAIEVRAVETGLLDGVFMHKRAQTFRFLCERNEKGFFA-SRSTSSGQVYFMTL 319          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO43631 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY41])

HSP 1 Score: 244.973 bits (624), Expect = 6.739e-67
Identity = 130/272 (47.79%), Postives = 183/272 (67.28%), Query Frame = 3
Query:   75 EPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQ-QLWLVMEFCAAGSITDLVKTT--SGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLI-XXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFV 878
            +P   + L+E +G+GTYG VYK ++   G++ A KV+D    +IEE+L E+  +K+ S++ N+A + G+F+    N Q QLWLVME C  GS+T+LVK     G S +ED ++YI  E +KG+ +LH  +V+HRDIKG NV+LTN A+++L+DFGVS++L   L K+N+ +GTPFWMAPEVI CE   +  YD R D+WS+GIT IE+A+G  PL + HPMRALF I +  PP      KWS  ++ FI   L K  +ERP   QL+ HPF+
Sbjct:   12 DPPVDWQLVESIGEGTYGEVYKVRNVKTGEIAAAKVIDSILEKIEEVLPELEILKKFSDHPNIAGFHGAFIQRDPNRQDQLWLVMELCRGGSVTNLVKNLIKKGKSLEEDLVAYILHETLKGVEYLHRKNVMHRDIKGANVMLTNEADIRLIDFGVSSELTNALMKKNSSVGTPFWMAPEVIACEQQLDYSYDMRCDVWSIGITGIELADGVAPLSDEHPMRALFKIPRNKPPTMKHPEKWSHEYRDFIAHCLIKDFEERPFVSQLLQHPFL 283          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 218.009 bits (554), Expect = 8.821e-63
Identity = 121/271 (44.65%), Postives = 170/271 (62.73%), Query Frame = 3
Query:   75 EPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXX-TIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVAS 884
            +PE  +S +E +GKG++G V+KG DN   ++VAIK++D+   E E   ++   T+    ++  V  Y GS++   K    LW++ME+   GS  DL+K  +    +E +I+ I RE++KGL +LH    +HRDIK  NVL++   +VKL DFGV+ QL  TL KRNTF+GTPFWMAPEVI       S YD ++DIWSLGITAIE+A+G PP  + HPMR LFLI     P   +  +S  FK F+   L K   +RPTAK+L+ H F+ +
Sbjct:    6 DPEKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYLKGTK----LWIIMEYLGGGSALDLMKAGN---IEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVIK-----QSAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLI-PKNNPPELTGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRFIKT 263          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 213.772 bits (543), Expect = 3.149e-62
Identity = 128/328 (39.02%), Postives = 191/328 (58.23%), Query Frame = 3
Query:   78 PEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXX---XXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYRRGANINIRDNPDKATDQYKNL-PTKSDDDTI 1049
            P+  + LIE VG GTYG+V+K +    G L A+KV+ + P +  E++ +   + +   + N+  Y G+++   K    LW+ ME+C  GSI D+   T   S  E  IS+++ E +KGL +LH+  ++HRDIKG N+LLT N EVKL DFG+SA++  T+ KR +FIGTP+WMAPE+   E      YD + DIW++GITAIEMAE +PP+ + HPMRAL++I K         +  KWS     FI  +L K  ++RP+A ++++HPF    + +      L+DL+ +      YRR +             Q KNL P  SDD+ +
Sbjct:   14 PDKVFDLIEKVGGGTYGDVFKARVIATGDLAAVKVVKVEPGDDFELIQQEIAMMQQCRHNNIINYIGAYMRRDK----LWIGMEYCGGGSIQDVYCVTGPCS--ETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMKKRKSFIGTPYWMAPEMAAVERTGG--YDLKCDIWAVGITAIEMAELQPPMFDLHPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKMLTHPFCCRHLTKA----VLQDLLDR------YRRKS-------------QEKNLQPDDSDDEQL 310          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Medaka
Match: TNIK (TRAF2 and NCK-interacting protein kinase [Source:NCBI gene;Acc:101166259])

HSP 1 Score: 370.933 bits (951), Expect = 8.205e-111
Identity = 190/304 (62.50%), Postives = 239/304 (78.62%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFI+  L K   +RP+ +QL+ HPF+  + NER + IQL+D I +  +RRG R
Sbjct:   15 LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSHHRNIATYYGAFI--KKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWIAYICREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLLKSHSQRPSTEQLLKHPFIRDLPNERQVRIQLKDHIDRTKKRRGER 316          

HSP 2 Score: 269.24 bits (687), Expect = 8.673e-75
Identity = 122/293 (41.64%), Postives = 193/293 (65.87%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRI 2897
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y+L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     ++L  + E +K      +GE    + H+K VKY+ I FL++AL NS+ IY+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+ I+ +  N  D+++PS     + P+AI++LP   G  +LLCY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FL E+N ++
Sbjct:  835 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGE-LEGSVHYKVVKYERIKFLVIALKNSVEIYAWAPKPYHKFMAFKSFTELQHRPLLVDLTVEEGQRLKVIYGSTVGFHVIDVDSGNPYDIYVPSHIQGQVTPHAIVVLPKTDGMEMLLCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLTERNDKV 1126          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Medaka
Match: tnika (TRAF2 and NCK-interacting protein kinase [Source:NCBI gene;Acc:101155647])

HSP 1 Score: 362.844 bits (930), Expect = 8.192e-110
Identity = 188/304 (61.84%), Postives = 232/304 (76.32%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            L  LK+P G + ++E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ SNN+N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KE+W SYI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+GKRNTFIGTP+WMAPEVI C++NP + YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS   +SFI+  L K   +RP  ++L  H F+  + N+R +  QL+D I +  +RRG R
Sbjct:   15 LSALKDPAGIFEVVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSNNRNIATYYGAFI--KKNPPGIDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWTSYICREILRGLAHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGKRNTFIGTPYWMAPEVIACDENPAATYDFKSDVWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSRKLQSFIEFCLVKNPGQRPNTEELSKHAFIRELTNDRQVRNQLKDHIDRTKKRRGER 316          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Medaka
Match: TNIK (TRAF2 and NCK-interacting protein kinase [Source:NCBI gene;Acc:101166259])

HSP 1 Score: 370.933 bits (951), Expect = 1.727e-109
Identity = 190/304 (62.50%), Postives = 239/304 (78.62%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNV----QQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYR 959
            L  L++P G + L+E+VG GTYG VYKG+    GQL AIKVMD+  +E EEI  EIN +K+ S+++N+ATY+G+F+  +KN      QLWLVMEFC AGS+TDL+K T G S KE+WI+YI REI++GL HLH + VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP++ YD +SD+WSLGITAIEMAEG PPLC+ HPMRALFLI +NP P+LKS KWS  F+SFI+  L K   +RP+ +QL+ HPF+  + NER + IQL+D I +  +RRG R
Sbjct:   15 LSALRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKAEINMLKKYSHHRNIATYYGAFI--KKNPPGMDDQLWLVMEFCGAGSVTDLIKNTKGNSLKEEWIAYICREILRGLTHLHQHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRLKSKKWSKKFQSFIESCLLKSHSQRPSTEQLLKHPFIRDLPNERQVRIQLKDHIDRTKKRRGER 316          

HSP 2 Score: 274.633 bits (701), Expect = 4.515e-76
Identity = 126/311 (40.51%), Postives = 201/311 (64.63%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPS---PPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KK+   EI CAA WGVNLL+G+  GL  +DRSG GK+Y+L+ RR+F Q++V+E +N L+ ISGK +K++ Y L     ++L  + E +K      +GE    + H+K VKY+ I FL++AL NS+ IY+WAP+PY KFM +K + +L  +PL+V+LT+E   ++K++Y +  GF+ I+ +  N  D+++PS     + P+AI++LP   G  +LLCY  E VYV+T G+I KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FL E+N ++  +  +S  S Q+   +L
Sbjct: 1027 KKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYNLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNRILHNDPEVEKKQGWITVGE-LEGSVHYKVVKYERIKFLVIALKNSVEIYAWAPKPYHKFMAFKSFTELQHRPLLVDLTVEEGQRLKVIYGSTVGFHVIDVDSGNPYDIYVPSHIQGQVTPHAIVVLPKTDGMEMLLCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIHSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLTERNDKVFFASVRSGGSSQVFFMTL 1336          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Medaka
Match: mink1 (misshapen like kinase 1 [Source:NCBI gene;Acc:101154799])

HSP 1 Score: 363.999 bits (933), Expect = 5.818e-108
Identity = 192/300 (64.00%), Postives = 231/300 (77.00%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQ--KNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+   E EEI  EIN +K+ S+++N+ATY+G+FV      +  QLWLVMEFC AGS+TDLVK T G S KEDWI+YI REI++GL HLH++ VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP+S YD RSDIWSLGITAIEMAEG PPLC+ HPMRALFLI +NPPPKLKS KWS  F  FI+  L K    RP+ +QL+ H F+     ER + IQL+D I +  ++RG
Sbjct:   15 LAALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEEEEEEIKAEINMLKKYSHHRNIATYYGAFVKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTKGSSLKEDWIAYICREILRGLCHLHNHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDSTYDFRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSKKWSKKFIDFIEGCLVKTYTSRPSTEQLLKHSFIRDQPTERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 276.174 bits (705), Expect = 5.322e-77
Identity = 128/311 (41.16%), Postives = 199/311 (63.99%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KKK   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+  R+F Q++V+E +N LI ISGK +K++ Y L     K+L  + E +K      +GE      H+K VKY+ I FL++AL N++ +Y+WAP+PY KFM +K + DL  +P++V+LT+E   ++K++Y +  GF+AI+ +  N  D++IP      + P+AI+ LP   G  +LLCY  E VYV+T G+I+KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct:  884 KKKFNSEILCAALWGVNLLVGTENGLKLLDRSGQGKVYPLINSRRFQQMDVLEGLNLLITISGKKNKVRVYYLAWLRNKILHNDPEVEKKQGWTTVGE-MEGCVHYKVVKYERIKFLVIALKNAVEVYAWAPKPYHKFMAFKSFADLPHRPVLVDLTVEEGQRLKVIYGSCAGFHAIDVDSGNNYDIYIPVHIQSQVIPHAIVFLPNSDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAHICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTL 1193          
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Medaka
Match: mink1 (misshapen like kinase 1 [Source:NCBI gene;Acc:101154799])

HSP 1 Score: 363.999 bits (933), Expect = 9.114e-108
Identity = 192/300 (64.00%), Postives = 231/300 (77.00%), Query Frame = 3
Query:   60 LDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQK--NVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRG 953
            L  L++P G + L+EVVG GTYG VYKG+    GQL AIKVMD+   E EEI  EIN +K+ S+++N+ATY+G+FV      +  QLWLVMEFC AGS+TDLVK T G S KEDWI+YI REI++GL HLH++ VIHRDIKGQNVLLT NAEVKLVDFGVSAQLDRT+G+RNTFIGTP+WMAPEVI C++NP+S YD RSDIWSLGITAIEMAEG PPLC+ HPMRALFLI +NPPPKLKS KWS  F  FI+  L K    RP+ +QL+ H F+     ER + IQL+D I +  ++RG
Sbjct:   15 LAALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEEEEEEIKAEINMLKKYSHHRNIATYYGAFVKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTKGSSLKEDWIAYICREILRGLCHLHNHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDSTYDFRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSKKWSKKFIDFIEGCLVKTYTSRPSTEQLLKHSFIRDQPTERQVRIQLKDHIDRTRKKRG 314          

HSP 2 Score: 275.789 bits (704), Expect = 6.930e-77
Identity = 128/311 (41.16%), Postives = 199/311 (63.99%), Query Frame = 3
Query: 2034 KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLL--EKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP---SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSL 2951
            KKK   EI CAA WGVNLL+G+  GL  +DRSG GK+Y L+  R+F Q++V+E +N LI ISGK +K++ Y L     K+L  + E +K      +GE      H+K VKY+ I FL++AL N++ +Y+WAP+PY KFM +K + DL  +P++V+LT+E   ++K++Y +  GF+AI+ +  N  D++IP      + P+AI+ LP   G  +LLCY  E VYV+T G+I+KDV+L+W   P +++ +  +Q +  G KA+E+R + TG L G+  HK   + +FLCE+N ++  +  +S  S Q+   +L
Sbjct:  908 KKKFNSEILCAALWGVNLLVGTENGLKLLDRSGQGKVYPLINSRRFQQMDVLEGLNLLITISGKKNKVRVYYLAWLRNKILHNDPEVEKKQGWTTVGE-MEGCVHYKVVKYERIKFLVIALKNAVEVYAWAPKPYHKFMAFKSFADLPHRPVLVDLTVEEGQRLKVIYGSCAGFHAIDVDSGNNYDIYIPVHIQSQVIPHAIVFLPNSDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAHICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTL 1217          
BLAST of Mitogen activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000017706.1 (SMESG000017706.1)

HSP 1 Score: 1864.74 bits (4829), Expect = 0.000e+0
Identity = 964/973 (99.08%), Postives = 964/973 (99.08%), Query Frame = 3
Query:   48 MIKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQVHXXXXXXXXXXXXXXXXXXXXXXXXXMQSKPNLNTEFDPDTLRQNFALLQELESEPSTKAPVRHKQNQKSPGQEVNIIHFQKPIDVQGSLTPKQNRRNSAGFESPLQINVHRVESPFLHRKASEGNPSRFDSRASDRIRFVTKPKFPNSRPMSTNIGEDIAAQRLIQSKFKPTDSAISLSTLLTNATISEETETSPNKNNNFILDKSHLDIIENLSRGDEININKSFEPQKNEIDDNKSKQNLPDVLPQSVTGKANKSGNQFSDNYQSNNPRLNNFQIKNIKTRHSLSGNMFQLANNTDIDFAAPRKLSSQLPEPSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW 2966
            MIKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDINPNEIEEILLEINTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIKKNPPPKLKSPKWSPTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQVHNNNKNNNNNANNNNNNN     N  MQSKPNLNTEFDPDTLRQNFALLQELESEPSTKAPVRHKQNQKSPG EVNI HFQKPIDVQGSLTPKQNRRNSAGFESPLQINVHRVESPFLHRKASEGNPSRFDSRASDRIRFVTKPKFPNSRPMSTNIGEDIAAQRLIQSKFKPTDSAISLSTLLTNATISEETETSPNKNNNFILDKSHLDIIENLSRGDEININKSFEPQKNEIDDNKSKQNLPDVLPQSVTGKANKSGNQFSDNYQSNNPRLNNFQIKNIKTRHSLSGNMFQLANNTDIDFAAPRKLSSQLPEPSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW
Sbjct:    1 MIKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDINPNEIEEILLEINTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIKKNPPPKLKSPKWSPTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNERRGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQVHNNNKNNNNNANNNNNNNIFNNKN--MQSKPNLNTEFDPDTLRQNFALLQELESEPSTKAPVRHKQNQKSPGPEVNISHFQKPIDVQGSLTPKQNRRNSAGFESPLQINVHRVESPFLHRKASEGNPSRFDSRASDRIRFVTKPKFPNSRPMSTNIGEDIAAQRLIQSKFKPTDSAISLSTLLTNATISEETETSPNKNNNFILDKSHLDIIENLSRGDEININKSFEPQKNEIDDNKSKQNLPDVLPQSVTGKANKSGNQFSDNYQSNNPRLNNFQIKNIKTRHSLSGNMFQLANNTDIDFAAPRKLSSQLPEPSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKEYDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIPSPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPVTISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRIVHSLYKSTSSQQIGIKSLGALKW 971          
BLAST of Mitogen activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000025153.1 (SMESG000025153.1)

HSP 1 Score: 390.578 bits (1002), Expect = 6.765e-119
Identity = 203/305 (66.56%), Postives = 245/305 (80.33%), Query Frame = 3
Query:   51 IKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----SKKNERR 950
            I  L++LK+P G +SLIE+VGKGTYGNVYKG+ N  GQL AIKVM I   + EEI LEIN +KRLSN++N+A+Y+G+F+  +K+   LWLVME+C AGS+TDLVK T G S KEDWI+YISREI++GL HLH+N VIHRDIKGQNVLLT NAEVKLVDFGVSAQLD+TLGKRNTFIGTP+WMAPEVIHCE + NS YD RSD+WSLGIT++EMAEGRPPLCE HPMRALFLI +N PP+LKS KWSP F  FI+K L K  ++RP   +L+ HPF+++I  ER + +QL D I     SK+ E R
Sbjct:    7 IVNLESLKDPAGIFSLIEIVGKGTYGNVYKGRHNKTGQLAAIKVMQITEEDEEEIKLEINMLKRLSNHRNIASYYGAFIKKEKDQDFLWLVMEYCGAGSVTDLVKNTKGQSLKEDWIAYISREILRGLAHLHNNRVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDKTLGKRNTFIGTPYWMAPEVIHCEQDMNSTYDARSDLWSLGITSLEMAEGRPPLCEMHPMRALFLIMRNAPPRLKSRKWSPRFHEFIEKCLTKDFKKRPHTDELLRHPFISNIPTERQVRMQLNDHIDRHKRSKRQEER 311          

HSP 2 Score: 155.992 bits (393), Expect = 2.136e-38
Identity = 92/251 (36.65%), Postives = 134/251 (53.39%), Query Frame = 3
Query: 1734 SFEPQKNEIDDNKSKQNLPDVLPQSVTGKANKSGNQFSDNYQSNN-PRLNNFQIKNIKTRHSLSGNMFQLANNTDIDFAAPRKLSSQLPEPSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQP 2480
            SFE   +      +K  +PD+LPQ +               Q N  P L  F  ++ K      G +  +A +T+              E  + T+   + KK+   EI CA  WG NLLIG   GL  +DRSG GK+Y L+ RRKF+Q++V+E  N L+ ISG  ++++ Y L     K+L+ +  DK     N+GEN + A HFK VKY  I FL++A+ +S+ IY+WAPRPY KFM +KK++ L  +P
Sbjct:  847 SFENISSRSRSGGNKDVMPDLLPQGL---------------QENGLPHLQQFTFQSDKRNQ---GTLDSVATSTNT-------------EDGLETH---LYKKRFGSEILCACLWGANLLIGLENGLSLLDRSGQGKVYSLISRRKFLQMDVLEGQNILVTISGSKNRLRVYFLSWLRGKILKSDGIDKKNGWVNVGENLQGAVHFKIVKYDKIKFLVIAMKDSVEIYAWAPRPYHKFMAFKKFETLQHRP 1063          
BLAST of Mitogen activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000025153.1 (SMESG000025153.1)

HSP 1 Score: 391.349 bits (1004), Expect = 1.181e-118
Identity = 203/305 (66.56%), Postives = 245/305 (80.33%), Query Frame = 3
Query:   51 IKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----SKKNERR 950
            I  L++LK+P G +SLIE+VGKGTYGNVYKG+ N  GQL AIKVM I   + EEI LEIN +KRLSN++N+A+Y+G+F+  +K+   LWLVME+C AGS+TDLVK T G S KEDWI+YISREI++GL HLH+N VIHRDIKGQNVLLT NAEVKLVDFGVSAQLD+TLGKRNTFIGTP+WMAPEVIHCE + NS YD RSD+WSLGIT++EMAEGRPPLCE HPMRALFLI +N PP+LKS KWSP F  FI+K L K  ++RP   +L+ HPF+++I  ER + +QL D I     SK+ E R
Sbjct:    7 IVNLESLKDPAGIFSLIEIVGKGTYGNVYKGRHNKTGQLAAIKVMQITEEDEEEIKLEINMLKRLSNHRNIASYYGAFIKKEKDQDFLWLVMEYCGAGSVTDLVKNTKGQSLKEDWIAYISREILRGLAHLHNNRVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDKTLGKRNTFIGTPYWMAPEVIHCEQDMNSTYDARSDLWSLGITSLEMAEGRPPLCEMHPMRALFLIMRNAPPRLKSRKWSPRFHEFIEKCLTKDFKKRPHTDELLRHPFISNIPTERQVRMQLNDHIDRHKRSKRQEER 311          

HSP 2 Score: 159.844 bits (403), Expect = 1.297e-39
Identity = 79/186 (42.47%), Postives = 114/186 (61.29%), Query Frame = 3
Query: 1941 ANNTDIDFAAPRKLSSQLPEPSINTNKDDIL-----KKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQP 2480
             +N    F + ++    L   + +TN +D L     KK+   EI CA  WG NLLIG   GL  +DRSG GK+Y L+ RRKF+Q++V+E  N L+ ISG  ++++ Y L     K+L+ +  DK     N+GEN + A HFK VKY  I FL++A+ +S+ IY+WAPRPY KFM +KK++ L  +P
Sbjct:  934 CDNQMFTFQSDKRNQGTLDSVATSTNTEDGLETHLYKKRFGSEILCACLWGANLLIGLENGLSLLDRSGQGKVYSLISRRKFLQMDVLEGQNILVTISGSKNRLRVYFLSWLRGKILKSDGIDKKNGWVNVGENLQGAVHFKIVKYDKIKFLVIAMKDSVEIYAWAPRPYHKFMAFKKFETLQHRP 1119          
BLAST of Mitogen activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000025153.1 (SMESG000025153.1)

HSP 1 Score: 390.963 bits (1003), Expect = 2.725e-118
Identity = 203/305 (66.56%), Postives = 245/305 (80.33%), Query Frame = 3
Query:   51 IKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----SKKNERR 950
            I  L++LK+P G +SLIE+VGKGTYGNVYKG+ N  GQL AIKVM I   + EEI LEIN +KRLSN++N+A+Y+G+F+  +K+   LWLVME+C AGS+TDLVK T G S KEDWI+YISREI++GL HLH+N VIHRDIKGQNVLLT NAEVKLVDFGVSAQLD+TLGKRNTFIGTP+WMAPEVIHCE + NS YD RSD+WSLGIT++EMAEGRPPLCE HPMRALFLI +N PP+LKS KWSP F  FI+K L K  ++RP   +L+ HPF+++I  ER + +QL D I     SK+ E R
Sbjct:    7 IVNLESLKDPAGIFSLIEIVGKGTYGNVYKGRHNKTGQLAAIKVMQITEEDEEEIKLEINMLKRLSNHRNIASYYGAFIKKEKDQDFLWLVMEYCGAGSVTDLVKNTKGQSLKEDWIAYISREILRGLAHLHNNRVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDKTLGKRNTFIGTPYWMAPEVIHCEQDMNSTYDARSDLWSLGITSLEMAEGRPPLCEMHPMRALFLIMRNAPPRLKSRKWSPRFHEFIEKCLTKDFKKRPHTDELLRHPFISNIPTERQVRMQLNDHIDRHKRSKRQEER 311          

HSP 2 Score: 156.377 bits (394), Expect = 2.088e-38
Identity = 92/251 (36.65%), Postives = 134/251 (53.39%), Query Frame = 3
Query: 1734 SFEPQKNEIDDNKSKQNLPDVLPQSVTGKANKSGNQFSDNYQSNN-PRLNNFQIKNIKTRHSLSGNMFQLANNTDIDFAAPRKLSSQLPEPSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQP 2480
            SFE   +      +K  +PD+LPQ +               Q N  P L  F  ++ K      G +  +A +T+              E  + T+   + KK+   EI CA  WG NLLIG   GL  +DRSG GK+Y L+ RRKF+Q++V+E  N L+ ISG  ++++ Y L     K+L+ +  DK     N+GEN + A HFK VKY  I FL++A+ +S+ IY+WAPRPY KFM +KK++ L  +P
Sbjct:  939 SFENISSRSRSGGNKDVMPDLLPQGL---------------QENGLPHLQQFTFQSDKRNQ---GTLDSVATSTNT-------------EDGLETH---LYKKRFGSEILCACLWGANLLIGLENGLSLLDRSGQGKVYSLISRRKFLQMDVLEGQNILVTISGSKNRLRVYFLSWLRGKILKSDGIDKKNGWVNVGENLQGAVHFKIVKYDKIKFLVIAMKDSVEIYAWAPRPYHKFMAFKKFETLQHRP 1155          
BLAST of Mitogen activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000025153.1 (SMESG000025153.1)

HSP 1 Score: 390.193 bits (1001), Expect = 3.531e-118
Identity = 203/305 (66.56%), Postives = 245/305 (80.33%), Query Frame = 3
Query:   51 IKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDXXXXXXXXXXXXXXTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGSITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLTNNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDERSDIWSLGITAIEMAEGRPPLCESHPMRALFLIXXXXXXXXXXXXXXXTFKSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLI-----SKKNERR 950
            I  L++LK+P G +SLIE+VGKGTYGNVYKG+ N  GQL AIKVM I   + EEI LEIN +KRLSN++N+A+Y+G+F+  +K+   LWLVME+C AGS+TDLVK T G S KEDWI+YISREI++GL HLH+N VIHRDIKGQNVLLT NAEVKLVDFGVSAQLD+TLGKRNTFIGTP+WMAPEVIHCE + NS YD RSD+WSLGIT++EMAEGRPPLCE HPMRALFLI +N PP+LKS KWSP F  FI+K L K  ++RP   +L+ HPF+++I  ER + +QL D I     SK+ E R
Sbjct:    7 IVNLESLKDPAGIFSLIEIVGKGTYGNVYKGRHNKTGQLAAIKVMQITEEDEEEIKLEINMLKRLSNHRNIASYYGAFIKKEKDQDFLWLVMEYCGAGSVTDLVKNTKGQSLKEDWIAYISREILRGLAHLHNNRVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDKTLGKRNTFIGTPYWMAPEVIHCEQDMNSTYDARSDLWSLGITSLEMAEGRPPLCEMHPMRALFLIMRNAPPRLKSRKWSPRFHEFIEKCLTKDFKKRPHTDELLRHPFISNIPTERQVRMQLNDHIDRHKRSKRQEER 311          

HSP 2 Score: 155.992 bits (393), Expect = 2.752e-38
Identity = 92/251 (36.65%), Postives = 134/251 (53.39%), Query Frame = 3
Query: 1734 SFEPQKNEIDDNKSKQNLPDVLPQSVTGKANKSGNQFSDNYQSNN-PRLNNFQIKNIKTRHSLSGNMFQLANNTDIDFAAPRKLSSQLPEPSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIYHLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKE-YDKNVEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFMEYKKYDDLYCQP 2480
            SFE   +      +K  +PD+LPQ +               Q N  P L  F  ++ K      G +  +A +T+              E  + T+   + KK+   EI CA  WG NLLIG   GL  +DRSG GK+Y L+ RRKF+Q++V+E  N L+ ISG  ++++ Y L     K+L+ +  DK     N+GEN + A HFK VKY  I FL++A+ +S+ IY+WAPRPY KFM +KK++ L  +P
Sbjct:  917 SFENISSRSRSGGNKDVMPDLLPQGL---------------QENGLPHLQQFTFQSDKRNQ---GTLDSVATSTNT-------------EDGLETH---LYKKRFGSEILCACLWGANLLIGLENGLSLLDRSGQGKVYSLISRRKFLQMDVLEGQNILVTISGSKNRLRVYFLSWLRGKILKSDGIDKKNGWVNVGENLQGAVHFKIVKYDKIKFLVIAMKDSVEIYAWAPRPYHKFMAFKKFETLQHRP 1133          
The following BLAST results are available for this feature:
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MINK16.930e-11263.00misshapen like kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
MAP4K48.158e-10864.33mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K48.311e-10864.33mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K49.394e-10864.33mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K41.451e-10764.33mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mig-151.388e-9754.30Serine/threonine-protein kinase mig-15 [Source:Un... [more]
mig-151.611e-9754.30Serine/threonine-protein kinase mig-15 [Source:Un... [more]
mig-151.806e-9754.30Serine/threonine-protein kinase mig-15 [Source:Un... [more]
mig-152.162e-9754.30Serine/threonine-protein kinase mig-15 [Source:Un... [more]
gck-16.427e-6145.07Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msn8.021e-10757.06gene:FBgn0010909 transcript:FBtr0333363[more]
msn8.239e-10757.06gene:FBgn0010909 transcript:FBtr0072959[more]
msn8.239e-10757.06gene:FBgn0010909 transcript:FBtr0072958[more]
msn1.969e-10657.06gene:FBgn0010909 transcript:FBtr0333364[more]
msn2.120e-10657.06gene:FBgn0010909 transcript:FBtr0333365[more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnikb3.094e-11662.17TRAF2 and NCK interacting kinase b [Source:ZFIN;Ac... [more]
tnikb2.696e-11562.33TRAF2 and NCK interacting kinase b [Source:ZFIN;Ac... [more]
tnika1.205e-10761.84TRAF2 and NCK interacting kinase a [Source:ZFIN;Ac... [more]
tnika1.880e-10761.84TRAF2 and NCK interacting kinase a [Source:ZFIN;Ac... [more]
mink15.233e-10764.00misshapen-like kinase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limk11.577e-10863.64LIM domain kinase 1 [Source:Xenbase;Acc:XB-GENE-10... [more]
limk11.780e-10863.64LIM domain kinase 1 [Source:Xenbase;Acc:XB-GENE-10... [more]
MAP4K43.946e-10864.67mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K43.959e-10864.67mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K44.340e-10864.67mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map4k42.151e-11564.33mitogen-activated protein kinase kinase kinase kin... [more]
Map4k46.239e-10864.33mitogen-activated protein kinase kinase kinase kin... [more]
Map4k41.097e-10764.33mitogen-activated protein kinase kinase kinase kin... [more]
Map4k41.219e-10764.33mitogen-activated protein kinase kinase kinase kin... [more]
Map4k41.269e-10764.33mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95819|M4K4_HUMAN7.748e-10764.33Mitogen-activated protein kinase kinase kinase kin... [more]
sp|P83510|TNIK_MOUSE1.449e-10661.92Traf2 and NCK-interacting protein kinase OS=Mus mu... [more]
sp|Q9UKE5|TNIK_HUMAN2.371e-10661.92TRAF2 and NCK-interacting protein kinase OS=Homo s... [more]
sp|Q9JM52|MINK1_MOUSE2.149e-10463.00Misshapen-like kinase 1 OS=Mus musculus OX=10090 G... [more]
sp|Q8N4C8|MINK1_HUMAN4.949e-10463.00Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YG905.673e-11663.40Serine threonine-protein kinase mig-15 OS=Fasciola... [more]
Q5EAR91.638e-11462.17Zgc:152783 protein (Fragment) OS=Danio rerio OX=79... [more]
A0A183QJJ92.344e-11461.31Protein kinase domain-containing protein OS=Schist... [more]
A0A1B6HXX04.366e-11459.88Protein kinase domain-containing protein (Fragment... [more]
A0A1S3PNS81.043e-11364.67mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNIK9.550e-10962.88TRAF2 and NCK interacting kinase [Source:HGNC Symb... [more]
MAP4K47.697e-10863.67mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K48.752e-10863.67mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K41.532e-10763.67mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K42.298e-10763.67mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000169.11.131e-9863.14pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gen... [more]
stk25a6.165e-6442.63serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
myo3a9.559e-6343.42myosin IIIA [Source:ZFIN;Acc:ZDB-GENE-041026-4][more]
MAP4K36.967e-5942.48mitogen-activated protein kinase kinase kinase kin... [more]
ENSPMAT00000010511.11.261e-5440.79pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIC11.174e-4841.38Protein kinase of the PAK/Ste20 family, required f... [more]
SPS11.416e-4838.67Putative protein serine/threonine kinase; localize... [more]
CLA41.162e-4234.41Cdc42p-activated signal transducing kinase; member... [more]
STE203.116e-4133.33Cdc42p-activated signal transducing kinase; involv... [more]
SKM14.700e-4129.25Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO409612.753e-11158.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409601.848e-7641.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436316.739e-6747.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319348.821e-6344.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490473.149e-6239.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNIK8.205e-11162.50TRAF2 and NCK-interacting protein kinase [Source:N... [more]
tnika8.192e-11061.84TRAF2 and NCK-interacting protein kinase [Source:N... [more]
TNIK1.727e-10962.50TRAF2 and NCK-interacting protein kinase [Source:N... [more]
mink15.818e-10864.00misshapen like kinase 1 [Source:NCBI gene;Acc:1011... [more]
mink19.114e-10864.00misshapen like kinase 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Mitogen activated protein kinase kinase kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017706.10.000e+099.08SMESG000017706.1[more]
SMESG000025153.16.765e-11966.56SMESG000025153.1[more]
SMESG000025153.11.181e-11866.56SMESG000025153.1[more]
SMESG000025153.12.725e-11866.56SMESG000025153.1[more]
SMESG000025153.13.531e-11866.56SMESG000025153.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000517 ID=SMED30000517|Name=Mitogen activated protein kinase kinase kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3012bp
AAAAATTTGAATTTACGTTTAATTATTATTATTAATTTTTTATAGTAATG
ATTAAAACGCTTGATAATTTAAAAGAACCAGAAGGTTATTATTCATTAAT
TGAAGTTGTAGGTAAAGGAACATATGGAAATGTTTACAAAGGGAAAGATA
ACGTTAATGGACAATTAGTCGCAATCAAAGTGATGGATATAAATCCAAAT
GAAATCGAAGAAATTCTGTTGGAAATAAATACAATCAAACGTCTTTCAAA
TAACAAAAATGTTGCAACTTATTTTGGATCATTTGTCCATCATCAGAAAA
ATGTTCAACAATTATGGCTTGTGATGGAATTTTGTGCAGCTGGTTCAATA
ACAGATTTAGTCAAAACTACCAGTGGCTTATCATTTAAAGAAGATTGGAT
TTCCTATATTTCTCGTGAAATAATAAAGGGCTTGATCCATTTACACGATA
ACCATGTCATCCATCGGGATATCAAGGGTCAAAATGTACTACTGACAAAT
AATGCTGAAGTGAAATTGGTAGATTTTGGAGTAAGTGCGCAATTAGACAG
GACGCTGGGGAAAAGAAATACTTTCATCGGCACGCCATTCTGGATGGCTC
CTGAGGTTATACACTGTGAAGATAATCCAAATAGCTTTTATGATGAACGC
AGTGACATTTGGTCATTGGGTATTACTGCCATAGAAATGGCTGAGGGCCG
CCCTCCGTTATGTGAGAGTCACCCAATGAGGGCTTTATTTCTCATCAAGA
AAAACCCCCCTCCCAAACTGAAATCCCCAAAATGGTCACCTACATTTAAA
AGTTTCATCGACAAGTCATTGAAGAAAAAAATCCAAGAAAGACCTACAGC
TAAGCAACTCATTAGTCATCCATTTGTCGCTTCAATAATCAATGAACGCA
ATATAATCATCCAATTGCGGGATTTGATTTCCAAGAAAAATGAAAGGAGA
GGCTATCGACGAGGTGCAAATATCAATATTCGAGACAATCCAGATAAAGC
CACAGATCAATACAAAAATCTTCCAACAAAATCAGATGATGACACCATCA
AACAAGTCCATAATAACAACAAAAATAACAACAACAATGCCAATAACAAC
AACAACAATAACAACAACATTTTCAATAACAAAAATATGCAATCGAAACC
GAATTTAAACACCGAATTTGATCCAGATACGCTGAGACAGAATTTTGCGC
TTTTGCAGGAATTGGAAAGTGAACCATCGACAAAAGCACCAGTTCGTCAC
AAACAAAACCAAAAGTCTCCTGGACAAGAAGTGAACATTATTCATTTTCA
GAAGCCCATCGATGTACAAGGATCATTAACTCCGAAGCAAAATCGAAGAA
ACAGTGCTGGGTTTGAATCTCCACTGCAAATCAATGTCCACCGTGTCGAA
TCGCCCTTTTTACATCGTAAAGCCAGTGAAGGCAACCCCAGTAGATTTGA
TTCACGAGCATCAGATCGTATCAGGTTTGTTACCAAGCCAAAGTTTCCTA
ATTCCAGACCAATGTCTACAAATATTGGAGAGGACATTGCCGCTCAAAGA
CTTATTCAAAGCAAATTCAAACCAACTGACAGTGCAATAAGTCTATCAAC
ATTATTAACCAATGCAACAATATCCGAAGAAACAGAAACCTCTCCCAATA
AGAATAATAATTTCATATTGGATAAATCACATTTAGATATTATAGAGAAT
TTATCTAGGGGAGACGAAATAAATATTAACAAATCCTTTGAACCGCAGAA
GAATGAAATAGATGACAATAAATCCAAACAAAATTTACCAGATGTCTTAC
CTCAGTCCGTAACGGGAAAAGCAAATAAATCGGGAAATCAGTTCTCTGAT
AATTACCAATCGAATAATCCACGTTTAAACAATTTCCAAATCAAAAACAT
CAAAACTCGCCACAGTCTGTCAGGAAATATGTTTCAATTGGCTAATAATA
CAGATATAGATTTTGCAGCCCCTAGAAAATTATCCTCCCAACTTCCAGAG
CCCAGTATTAATACAAACAAAGATGACATTTTAAAGAAGAAAATCACCGG
GGAAATATTTTGCGCGGCATTCTGGGGCGTCAATCTGTTGATTGGTAGTT
CGATTGGACTGGATTTCATTGACCGCAGTGGAATTGGCAAAATCTACCAT
TTGGTACCAAGAAGAAAATTTATTCAAATTGAAGTAATTGAGGAAATTAA
TTCATTAATAGCAATCTCTGGAAAAAGTCACAAAATCCAGCAATATTCAT
TGGAATGTTTCAGTGCCAAATTGCTTGAAAAAGAATACGATAAAAATGTT
GAAGTGTTTAATATTGGAGAAAATTTTCGCGACGCTCATCACTTCAAGAC
CGTGAAATATAAGGATATCATTTTCCTGATTGTTGCGTTACCCAACAGCA
TTGCCATTTACAGCTGGGCTCCACGGCCGTATCAGAAATTTATGGAATAT
AAAAAATATGATGACCTATATTGCCAACCACTTATTGTTAATTTGACCAT
TGAAAATTCCAACCAGATGAAGATATTGTATGCAACTAAGAAGGGCTTTT
ATGCAATTAATTTCAATGATAATAATCAAATTGATCTCCACATTCCATCA
CCTCCCATGTATCCATATGCTATCATGATTCTTCCCGGATATTCAGGAAC
CAACCTTTTACTTTGTTATAATAGTGAAGCAGTATATGTCGATACAACTG
GGAAAATAATGAAAGATGTCATTTTGAAATGGTCTGGTGATCCTGTAACT
ATTTCGCCGGTATCTCAGGATCAGTTTATCGTTTGTGGACATAAAGCATT
AGAAGTAAGATTGATGAATACAGGAGAGCTTAAAGGTATATTGCAACACA
AAGAAGATTATAAAGAAAGATTTCTATGTGAGCAAAACGGAAGAATTGTC
CATTCATTATACAAGTCAACGTCTTCACAACAAATTGGCATTAAAAGTTT
GGGAGCCTTAAAGTGGTGATTTTGGAATGTACATTTTACAATAATTTGTG
TATTTTGACGAC
back to top

protein sequence of SMED30000517-orf-1

>SMED30000517-orf-1 ID=SMED30000517-orf-1|Name=SMED30000517-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=974bp
MIKTLDNLKEPEGYYSLIEVVGKGTYGNVYKGKDNVNGQLVAIKVMDINP
NEIEEILLEINTIKRLSNNKNVATYFGSFVHHQKNVQQLWLVMEFCAAGS
ITDLVKTTSGLSFKEDWISYISREIIKGLIHLHDNHVIHRDIKGQNVLLT
NNAEVKLVDFGVSAQLDRTLGKRNTFIGTPFWMAPEVIHCEDNPNSFYDE
RSDIWSLGITAIEMAEGRPPLCESHPMRALFLIKKNPPPKLKSPKWSPTF
KSFIDKSLKKKIQERPTAKQLISHPFVASIINERNIIIQLRDLISKKNER
RGYRRGANINIRDNPDKATDQYKNLPTKSDDDTIKQVHNNNKNNNNNANN
NNNNNNNIFNNKNMQSKPNLNTEFDPDTLRQNFALLQELESEPSTKAPVR
HKQNQKSPGQEVNIIHFQKPIDVQGSLTPKQNRRNSAGFESPLQINVHRV
ESPFLHRKASEGNPSRFDSRASDRIRFVTKPKFPNSRPMSTNIGEDIAAQ
RLIQSKFKPTDSAISLSTLLTNATISEETETSPNKNNNFILDKSHLDIIE
NLSRGDEININKSFEPQKNEIDDNKSKQNLPDVLPQSVTGKANKSGNQFS
DNYQSNNPRLNNFQIKNIKTRHSLSGNMFQLANNTDIDFAAPRKLSSQLP
EPSINTNKDDILKKKITGEIFCAAFWGVNLLIGSSIGLDFIDRSGIGKIY
HLVPRRKFIQIEVIEEINSLIAISGKSHKIQQYSLECFSAKLLEKEYDKN
VEVFNIGENFRDAHHFKTVKYKDIIFLIVALPNSIAIYSWAPRPYQKFME
YKKYDDLYCQPLIVNLTIENSNQMKILYATKKGFYAINFNDNNQIDLHIP
SPPMYPYAIMILPGYSGTNLLLCYNSEAVYVDTTGKIMKDVILKWSGDPV
TISPVSQDQFIVCGHKALEVRLMNTGELKGILQHKEDYKERFLCEQNGRI
VHSLYKSTSSQQIGIKSLGALKW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001180CNH_dom
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 15..277
e-value: 1.1E-88
score: 310.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 15..277
e-value: 8.8E-58
score: 195.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 15..277
score: 48.951
IPR001180Citron homology (CNH) domainSMARTSM00036nik_2coord: 660..954
e-value: 1.1E-41
score: 154.4
IPR001180Citron homology (CNH) domainPFAMPF00780CNHcoord: 670..944
e-value: 5.9E-36
score: 124.5
IPR001180Citron homology (CNH) domainPROSITEPS50219CNHcoord: 665..948
score: 20.858
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 96..300
e-value: 2.8E-63
score: 215.0
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 2..95
e-value: 3.7E-29
score: 102.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..333
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 389..414
NoneNo IPR availablePANTHERPTHR24361MITOGEN-ACTIVATED KINASE KINASE KINASEcoord: 10..947
NoneNo IPR availablePANTHERPTHR24361:SF452MISSHAPEN, ISOFORM Acoord: 10..947
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 21..44
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 137..149
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 13..278