cilia- and flagella-associated protein 61

Overview
Namecilia- and flagella-associated protein 61
Smed IDSMED30000512
Uniprot Best hitCilia- and flagella-associated protein 61 OS=Homo sapiens OX=9606 GN=CFAP61 PE=2 SV=3 (E=0)
Length (bp)3735
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 61 (SMED30000512) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 61 (SMED30000512) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 61 (SMED30000512) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 61 (SMED30000512) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000512

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000512SMESG000059955.1 SmedASXL_015055SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000512SMESG000059955.1 dd_Smed_v4_4908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000512SMESG000059955.1 dd_Smed_v4_4908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000512SMESG000059955.1 dd_Smed_v4_4908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000512SMESG000059955.1 dd_Smed_v4_4908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000512SMESG000059955.1 dd_Smed_v6_4908_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000512SMESG000059955.1 dd_Smed_v4_4908_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30000512SMESG000059955.1 dd_Smed_v4_4908_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30000512SMESG000059955.1 dd_Smed_v4_4908_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Human
Match: CFAP61 (cilia and flagella associated protein 61 [Source:HGNC Symbol;Acc:HGNC:15872])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 497/1238 (40.15%), Postives = 736/1238 (59.45%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPL-ANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSIT--DYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSG----------LNDIPNNFE-------------------------FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEG-YFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ++ RRTES D   I+ LI   +  +FGK N+I ++EKA L+VTL +   EI+  A+F DYPN   +    DW  + +  +  +   PLN+LFMH F++  E       EI+ TV+     +H+IF I      +     T F Q+ +I    Y+  F   I  R ++ P L++R A+ ED DDLMPIF    TILK+ YGE++LAE+++AQ+++   +V EV G AVGF+SV + +N+ LL+  F L  F G   P      E+ + L+ + S D++  S+      +V E     S       +      A     +  +++SG          L+DI   +                          + G S A  IQLF I+E YE RS+DF+  VF LF ++++ +I++P L PEF L++NFV++ P     L  +LY FH+  L+ +  IR A   D   ++ ++  + L+++IL DL++++ AR+   G  L A+VAE   +IVG+ V++ E DIEYIRSHYNIEDFIYF+HH R EHGH+ HFA+NPIFR  +K FLKE +R   K+ +YY VY      K  N   HSL + L  LVP+RPRRQI+Y ++KL  NAP++ + +    Y L H NRKL +EPK+T+N +I+VVGAS+ G+SFLE+L F  H+KFNNL L+S +GLP     D    + +  D  F+ K   L +L   V+VV G MT IDR  K + ++   ++PYDH+I+ TG QY +PCPTEA I    T +E  N   RRY+           VP N   +N+    FK L ++R+N +  E  II+YG++ ++Y  + T+L++G+ G RIH V+PP    +  +N+  VE AV   L  AGV ++ +  +AQ+ND    P+ I S SFTT   P RL+C +F S+ +K V+Y  F+A+ND+CLV+D+RLVIDT FHTND++IRAAG +TKF  RYY+ +W+H+ F+S+ +G +L+   L LFDPTL PV  PP     LIP+Y  + ++  ILPG +HYL +++P++  PL     QPNYG  L TG    + G YFR+H+N+YK VETITCL ++ +P  NY++L+G HE+ LNNL +R++ENLI DL+ +F + W +A +HDRF DL++E++++L ++      S E+    +  E +  T + R+ L   F  S  K+ V++  + ++ YN YHLPMYA P +V
Sbjct:   14 VHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCNDKEEIMAQATFLDYPN-WNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCKEILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHYPQLHVRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVEGTAVGFMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQDLSVRRSQDAELRSSSQGSQKIVEELQEPVSPDTMENIQGNIAREAASE-EALTAVQSGNVSEPEDIEKLSDISTGYAQYHHVSSRSLASLVLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFCVISLPHLTPEFFLIQNFVKMVPFNTCTLEQDLYVFHRAGLLKSINIRFATLLDTPGVENLVSTLMLNKSILEDLDRYNKARKDPDGTLLQAFVAEVAEQIVGIAVIRNEMDIEYIRSHYNIEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYRVYPKSREGKFQNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPMSYALNHTNRKLTLEPKITVNAKIIVVGASSVGISFLETLVFCSHMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYT---------GKVPCNHFTLNEEEDCFKALIWIRNNSITTEGNIIVYGNTIDTYTTVETLLNLGVSGSRIHLVQPPPASTITCINNYSVESAVADALGAAGVTMYRDAILAQWNDGLH-PDPIYSASFTTPTKPFRLQCSMFFSFCEKNVDYETFKALNDACLVYDSRLVIDTNFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLHLFDPTLEPVTEPPANLDRLIPMYKGAKIQGGILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLELVTGS--AKNGTYFRIHINKYKMVETITCLSREPFPASNYIRLFGQHEQLLNNLCARYDENLITDLYSYFTEPWCLALFHDRFIDLRKELRQILASKEEEDLPSIEQLAHQIEDEEINPTEKPRQYLKRVFEESIYKTLVERSTLDYLHYNRYHLPMYAWPGIV 1237          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Human
Match: CFAP61 (cilia and flagella associated protein 61 [Source:HGNC Symbol;Acc:HGNC:15872])

HSP 1 Score: 234.572 bits (597), Expect = 2.279e-68
Identity = 123/296 (41.55%), Postives = 176/296 (59.46%), Query Frame = 3
Query: 1827 YCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECE 2714
            Y L H NRKL +EPK+T+N +I+VVGAS+ G+SFLE+L F  H+KFNNL L+S +GLP     D    + +  D  F+ K   L +L   V+VV G MT IDR  K + ++   ++PYDH+I+ TG QY +PCPTEA I    T +E  N   RRY+           VP N   +N+    FK L ++R+N +  E  II+YG++ ++Y  + T+L++G+ G RIH V+PP    +  +N+  VE AV   L  AGV ++ +  +AQ+ND    P+ I S SFTT   P RL+C 
Sbjct:    3 YALNHTNRKLTLEPKITVNAKIIVVGASSVGISFLETLVFCSHMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYT---------GKVPCNHFTLNEEEDCFKALIWIRNNSITTEGNIIVYGNTIDTYTTVETLLNLGVSGSRIHLVQPPPASTITCINNYSVESAVADALGAAGVTMYRDAILAQWNDGLH-PDPIYSASFTTPTKPFRLQCS 288          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Human
Match: CFAP61 (cilia and flagella associated protein 61 [Source:HGNC Symbol;Acc:HGNC:15872])

HSP 1 Score: 228.409 bits (581), Expect = 2.325e-64
Identity = 150/458 (32.75%), Postives = 234/458 (51.09%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPL-ANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSIT--DYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSG----------LNDIPNNFE-------------------------FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQA 1301
            ++ RRTES D   I+ LI   +  +FGK N+I ++EKA L+VTL +   EI+  A+F DYPN   +    DW  + +  +  +   PLN+LFMH F++  E       EI+ TV+     +H+IF I      +     T F Q+ +I    Y+  F   I  R ++ P L++R A+ ED DDLMPIF    TILK+ YGE++LAE+++AQ+++   +V EV G AVGF+SV + +N+ LL+  F L  F G   P      E+ + L+ + S D++  S+      +V E     S       +      A     +  +++SG          L+DI   +                          + G S A  IQLF I+E YE RS+DF+  VF LF ++++ +I++P L PEF L++NFV++ P     L  +LY FH+  L+ N  + ++
Sbjct:   14 VHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCNDKEEIMAQATFLDYPN-WNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCKEILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHYPQLHVRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVEGTAVGFMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQDLSVRRSQDAELRSSSQGSQKIVEELQEPVSPDTMENIQGNIAREAASE-EALTAVQSGNVSEPEDIEKLSDISTGYAQYHHVSSRSLASLVLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFCVISLPHLTPEFFLIQNFVKMVPFNTCTLEQDLYVFHRAGLLKNICLGRS 469          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Human
Match: CFAP61 (cilia and flagella associated protein 61 [Source:HGNC Symbol;Acc:HGNC:15872])

HSP 1 Score: 228.409 bits (581), Expect = 2.325e-64
Identity = 150/458 (32.75%), Postives = 234/458 (51.09%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPL-ANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSIT--DYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSG----------LNDIPNNFE-------------------------FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQA 1301
            ++ RRTES D   I+ LI   +  +FGK N+I ++EKA L+VTL +   EI+  A+F DYPN   +    DW  + +  +  +   PLN+LFMH F++  E       EI+ TV+     +H+IF I      +     T F Q+ +I    Y+  F   I  R ++ P L++R A+ ED DDLMPIF    TILK+ YGE++LAE+++AQ+++   +V EV G AVGF+SV + +N+ LL+  F L  F G   P      E+ + L+ + S D++  S+      +V E     S       +      A     +  +++SG          L+DI   +                          + G S A  IQLF I+E YE RS+DF+  VF LF ++++ +I++P L PEF L++NFV++ P     L  +LY FH+  L+ N  + ++
Sbjct:   14 VHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCNDKEEIMAQATFLDYPN-WNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCKEILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHYPQLHVRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVEGTAVGFMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQDLSVRRSQDAELRSSSQGSQKIVEELQEPVSPDTMENIQGNIAREAASE-EALTAVQSGNVSEPEDIEKLSDISTGYAQYHHVSSRSLASLVLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFCVISLPHLTPEFFLIQNFVKMVPFNTCTLEQDLYVFHRAGLLKNICLGRS 469          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Human
Match: CFAP61 (cilia and flagella associated protein 61 [Source:HGNC Symbol;Acc:HGNC:15872])

HSP 1 Score: 211.846 bits (538), Expect = 1.147e-61
Identity = 110/251 (43.82%), Postives = 154/251 (61.35%), Query Frame = 3
Query: 1200 NFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTF 1946
            NFV++ P     L  +LY FH+  L+ +  IR A   D   ++ ++  + L+++IL DL++++ AR+                          + DIEYIRSHYNIEDFIYF+HH R EHGH+ HFA+NPIFR  +K FLKE +R   K+ +YY VY      K  N   HSL + L  LVP+RPRRQI+Y ++KL  NAP++ + +    Y L H NRKL +EPK+T+N +I+VVGAS+ G+SFLE+L F
Sbjct:    2 NFVKMVPFNTCTLEQDLYVFHRAGLLKSINIRFATLLDTPGVENLVSTLMLNKSILEDLDRYNKARK--------------------------DPDIEYIRSHYNIEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYRVYPKSREGKFQNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPMSYALNHTNRKLTLEPKITVNAKIIVVGASSVGISFLETLVF 226          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Fly
Match: CG30268 (gene:FBgn0050268 transcript:FBtr0273311)

HSP 1 Score: 99.3673 bits (246), Expect = 1.336e-20
Identity = 159/720 (22.08%), Postives = 286/720 (39.72%), Query Frame = 3
Query: 1545 LRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQ----ILYDIQKLEGNAPTERI-LQVQEGYCLTH---FNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFS-------PHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFD-------------------FSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESK-IIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPV----DEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTH--GPPLRLECELFVSYYKKVVNYSAFRAMNDSCL-VFDARLVIDTFFHTNDLSIRAAG------PVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTR--------SSPCNASFEETVRNMMVEGV-ELTREQRKELMDEF 3533
            L  + G I  F ++P F+   K  L+          +YY  +  ++   L N+      + +++PI PRR       Y    L       ++ + V    C +    F   L     +     +++VG S+T ++FL ++ F+        + K+N L ++    L  +     +IE     DF                    F +  ++   +R  V  V G + +I R++K++ ++    L YD +++    +Y                          + +  FK H    +P N +V N           V   + L ES  II+YG++   Y C+H +++ G     I +V+P V    ++   P  D  ++  + + + + GV I+ +   +QF  S +  N I  V    H     + L C+LFV+Y    ++ S    ++++ + + + R+V+++ + TND +I AAG      P   F+  Y + Q    +    +    + KV ++                      Y    + + ILP G+  + +++P    PL        +   LTT   Y    + R+ LN    V  I C+ KK   +       G H   LN+L  RF    I++  +FF   W     HDRF DL+ + + LL++         ++P N S E T R  + E V +  R  RK+   EF
Sbjct:  580 LTHKRGEIVMFRLHPFFQMWCKTILRTVALCDNYRELYYIHF--FSGISLPNDL-----MYNMMPIEPRRMKKNLFNYKCVSLRRRVAKGKMSVNVSMDICTSRMRLFCHNLQPTMHMGGKNSLLIVGFSSTCMAFLRTVIFAWNSKDLINYKKYNCLPMVDITVLVGHG----IIESAYDCDFSCNFCANARNCYVDTGNVNPFVRDTMQRMDVRHWVRFVSGEVKSIKRQEKVVELSDGCHLYYDKLVLMGATRYG-------------------------FEDKEFKGHP---IPLNYVVNNTRLDRIIFYHKVCEMVELMESYYIIVYGYNLCIYECIHFLVTHGCKAQNIIYVQPHVPIVMEDLGIPEKDSRLDPIILEMIADLGVTIYLSTNYSQFILSQDNMN-IEKVELIMHPSKKKIVLHCDLFVNYNDNTISSSMENVLSEAGIEISERRIVVNSRYCTNDRNIFAAGINVIMIPKPNFQYTYGSPQEMAEKLAYEL---NMIKVVMQ--------------------SRYSKPYMFTGILPMGYQIIKITQPK---PLLIGQLPIEFSETLTT---YDDGDFCRIRLNNKLIVIEIVCVTKKPKRLYFMEYFCGKHAMLLNDLRGRFQAGWIQNFLDFFQQPWTELLMHDRFEDLQLKNRRLLLSMLLMNNKDTNNPRN-SLENTQRLRLEENVIDFVRTYRKDFTHEF 1229          

HSP 2 Score: 64.3142 bits (155), Expect = 7.037e-10
Identity = 98/486 (20.16%), Postives = 199/486 (40.95%), Query Frame = 3
Query:   81 DAVEIEKLINSNSIYIFG---KPNLINIIEKALLSVTLTSKTGE---IVGYASFYDYPNIAEI--DTSSDWNEIVKLKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIP------ENFGTQFTQIKS-ITDYKNW---FILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAE-MVDAQ------NDQTKCLVA------EVGGFAVGFISVTTDINIDLLNY--------------------GFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNAL---FRFPSNASIRSGLNDIPNNFEFPGE-SNAIIIQLFAINEAYEMRSIDF-LQNVFDLFPNRDYLLITVPFLVP----EFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSR 1358
            D   IE L ++ S + FG    P L  +  K      +     E   ++ Y+ F ++PNI  +  D    W  +    + P+   LN++F ++F+ K +  S +L +++  VF T   ++Y+ +       P      + FGT +    S +++ K+     +++R + MP L  R A  ED DD++ + +++   L+  +G+FY+AE +++A+      ND+             V G  + ++S + DI +   NY                    GF + + E  K   +    + +E+  K   +   T   + +  ++  +                +  + L   F  P      S      N  ++  + SN  ++++F ++         + L  +F  FP+ DY +  VP  V     +  LL  F+ ++ RP   +   L+  H+ +L    ++ +   ++ +EI+ +I      R
Sbjct:   17 DQRRIEDLYDAKSTWHFGVKETPPLDTLFLKNQAQRLIVYNKQEYHLLLAYSEFANHPNIPVLANDLWLHWLNVRFCVDLPIT-LLNAIFFNFFICK-DGHSQMLKKVILEVFYTEHLVNYMLVFKPPDCPPGQYDAVQAFGTTYYPKHSKVSEQKHLPAVIVIQRRSTMPVLSFRKALPEDNDDIVEMIDSEDPELRKKHGDFYIAEHLLNAEGSDSDHNDKIIIAEFEEEIADNVKGAGLMWLSQSLDIKMLATNYHLERLGNLVRYTPGCTHAHVGFEVISVE-LKSYKELFTRKQMEERYKSHVSRINTDGQDETRNILFKKYKHIYEELREGVYYITAHQDKLEISFDLPDGEKSTS-----ENRLQYLAKASNGFLLKMFQLHPLVRYEYTFYSLSAMFSAFPDHDYCVTLVPANVSTSPCQRELLRFFLPVAHRPSSTVSENLFVAHRSTLFGELRVHRFESQEIDEIRTLISKQARKR 494          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Fly
Match: CG30275 (gene:FBgn0050275 transcript:FBtr0344660)

HSP 1 Score: 85.5001 bits (210), Expect = 2.618e-16
Identity = 110/460 (23.91%), Postives = 194/460 (42.17%), Query Frame = 3
Query: 2085 LRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNL--MLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKP------PVD-EEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPP---LRLECELFVSYYKKVVNYSAFRAMNDSCLVFDA-RLVIDTFFHTNDLSIRAAGPVTKFK-RRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELL 3422
            LR  VH V G +  +DR KK + ++   +  YD +++     + + C       + P                          P NL+ +N     F L   VR  L  M     +++YG++  +Y C+  ++  G+   R+ FV+P        D +E  P  D  ++  +   L E GV+I  +Y    +N   +  ++I  V F  H P    +  EC+LF+S+ +  ++    + + ++ +  D  +++++  + TND  + AAG   K +    Y  ++   R  +R +   L  V  + F+                   + + +L   ILP  +    V+ P   + LS +    N    LTT   Y  + + R+ L+    V+ I  + KK   ++  +   G HE  LN L+SR+  NLI    +FF + W     HD F +L+ E KELL
Sbjct:  809 LRCWVHFVPGKVEKVDRDKKFVKLDSCEIY-YDTLLLMCDRMFVLRCI------DVPVYSPR---------------------PCNLVEINFRLNKFLLFYKVRALLEDMPRTYLVLVYGNNLHTYECIAFLIGHGVDCSRMVFVQPHRITGRDADMKEKCPYWDKNLQMIMDDILVEKGVNIFTDYDFHHYN-LHKSTDFIMEVIFQ-HFPTQKQMTFECDLFISFQEGHLHQRHKQWLENAGIELDGNQILVNERYQTNDPDVYAAGSFIKMRITPNYQYKFVSERELARKILHHLGIVTDKNFEDR-----------------FAEPVLFQAILPLRYFITKVTMPRRYL-LSQVPVIKNCN--LTT---YKNKTFCRVGLSTRMMVDEIVVVTKKECNLDFLLYFCGKHELLLNKLKSRYRANLIHCFLKFFQEPWTELIMHDDFEELQAENKELL 1215          

HSP 2 Score: 70.4774 bits (171), Expect = 8.815e-12
Identity = 68/278 (24.46%), Postives = 128/278 (46.04%), Query Frame = 3
Query:   63 RRTESLDAVEIEKLINSNSIYIFG--------KPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLAN--PLNSLFMHYFLSKPEVESNILMEIVNTVFNTASN---------------IHYIFINTDKGKIPENFGTQFTQIKSITDYKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEV------GGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPV 803
            R  ++ D   + KLI S  +  FG        K +L N  +   + +   +++  +V YA F +YP+IA + T   W E +  + C   +   LN+LF ++ + K + +S +L+EI+  V    S                IH++    D  KI + F      +    + ++ +I+ R   +P +  R A  ED DD++ +   ++  +++  G++Y+AE V  QN ++  +VAE          A+ F+ +++DI+I      + +E F    KP 
Sbjct:    7 RLAQAGDQDGLNKLIRSPGVKWFGNIRPKFRGKDSLFNSYQTYRI-LAFCTESSALVAYAEFRNYPSIAALPTDC-WLEWLSTRYCLSMSISWLNALFFNFCVYKSD-QSPVLVEIIKDVLYRESRVWFLITVRCPYVPQPIHFVETFDDLEKISQVFYPLEYSMDKNNNTQSLYIVDRFVILPRITYRKALAEDNDDIIAMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAI-FLWLSSDIDIMFYVRNYEMEQFGNLVKPA 280          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Fly
Match: CG30275 (gene:FBgn0050275 transcript:FBtr0344659)

HSP 1 Score: 85.5001 bits (210), Expect = 2.630e-16
Identity = 110/460 (23.91%), Postives = 194/460 (42.17%), Query Frame = 3
Query: 2085 LRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNL--MLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKP------PVD-EEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPP---LRLECELFVSYYKKVVNYSAFRAMNDSCLVFDA-RLVIDTFFHTNDLSIRAAGPVTKFK-RRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELL 3422
            LR  VH V G +  +DR KK + ++   +  YD +++     + + C       + P                          P NL+ +N     F L   VR  L  M     +++YG++  +Y C+  ++  G+   R+ FV+P        D +E  P  D  ++  +   L E GV+I  +Y    +N   +  ++I  V F  H P    +  EC+LF+S+ +  ++    + + ++ +  D  +++++  + TND  + AAG   K +    Y  ++   R  +R +   L  V  + F+                   + + +L   ILP  +    V+ P   + LS +    N    LTT   Y  + + R+ L+    V+ I  + KK   ++  +   G HE  LN L+SR+  NLI    +FF + W     HD F +L+ E KELL
Sbjct:  796 LRCWVHFVPGKVEKVDRDKKFVKLDSCEIY-YDTLLLMCDRMFVLRCI------DVPVYSPR---------------------PCNLVEINFRLNKFLLFYKVRALLEDMPRTYLVLVYGNNLHTYECIAFLIGHGVDCSRMVFVQPHRITGRDADMKEKCPYWDKNLQMIMDDILVEKGVNIFTDYDFHHYN-LHKSTDFIMEVIFQ-HFPTQKQMTFECDLFISFQEGHLHQRHKQWLENAGIELDGNQILVNERYQTNDPDVYAAGSFIKMRITPNYQYKFVSERELARKILHHLGIVTDKNFEDR-----------------FAEPVLFQAILPLRYFITKVTMPRRYL-LSQVPVIKNCN--LTT---YKNKTFCRVGLSTRMMVDEIVVVTKKECNLDFLLYFCGKHELLLNKLKSRYRANLIHCFLKFFQEPWTELIMHDDFEELQAENKELL 1202          

HSP 2 Score: 66.6254 bits (161), Expect = 1.575e-10
Identity = 66/267 (24.72%), Postives = 128/267 (47.94%), Query Frame = 3
Query:   63 RRTESLDAVEIEKLINSNSIYIFG--------KPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLAN--PLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPE--NFGTQFTQIKSITD--YKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEV------GGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPV 803
            R  ++ D   + KLI S  +  FG        K +L N  +   + +   +++  +V YA F +YP+IA + T   W E +  + C   +   LN+LF ++ + K + +S +L+EI+  V    S + +  I      +P+  +F   F  ++ I+   Y   + + +     +LYI   + ED DD++ +   ++  +++  G++Y+AE V  QN ++  +VAE          A+ F+ +++DI+I      + +E F    KP 
Sbjct:    7 RLAQAGDQDGLNKLIRSPGVKWFGNIRPKFRGKDSLFNSYQTYRI-LAFCTESSALVAYAEFRNYPSIAALPTDC-WLEWLSTRYCLSMSISWLNALFFNFCVYKSD-QSPVLVEIIKDVLYRESRV-WFLITVRCPYVPQPIHFVETFDDLEKISQVFYPLEYSMDKNNNTQSLYI-VDRAEDNDDIIAMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAI-FLWLSSDIDIMFYVRNYEMEQFGNLVKPA 267          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Fly
Match: CG30275 (gene:FBgn0050275 transcript:FBtr0344661)

HSP 1 Score: 65.4698 bits (158), Expect = 7.459e-11
Identity = 66/267 (24.72%), Postives = 129/267 (48.31%), Query Frame = 3
Query:   63 RRTESLDAVEIEKLINSNSIYIFG--------KPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLAN--PLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPE--NFGTQFTQIKSITD--YKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEV------GGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPV 803
            R  ++ D   + KLI S  +  FG        K +L N  +   + +   +++  +V YA F +YP+IA + T   W E +  + C   +   LN+LF ++ + K + +S +L+EI+  V    S + ++ I      +P+  +F   F  ++ I+   Y   + + +     +LYI   + ED DD++ +   ++  +++  G++Y+AE V  QN ++  +VAE          A+ F+ +++DI+I      + +E F    KP 
Sbjct:    7 RLAQAGDQDGLNKLIRSPGVKWFGNIRPKFRGKDSLFNSYQTYRI-LAFCTESSALVAYAEFRNYPSIAALPTDC-WLEWLSTRYCLSMSISWLNALFFNFCVYKSD-QSPVLVEIIKDVLYRESRVWFL-ITVRCPYVPQPIHFVETFDDLEKISQVFYPLEYSMDKNNNTQSLYI-VDRAEDNDDIIAMQEVENPEMREELGDYYIAEEVMGQNPKSMLVVAETINQSQESEMAI-FLWLSSDIDIMFYVRNYEMEQFGNLVKPA 267          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Zebrafish
Match: si:zfos-223e1.2 (si:zfos-223e1.2 [Source:ZFIN;Acc:ZDB-GENE-110411-269])

HSP 1 Score: 327.791 bits (839), Expect = 3.499e-99
Identity = 197/558 (35.30%), Postives = 311/558 (55.73%), Query Frame = 3
Query: 1977 LLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRP-SLDIPLSTLTNQPNYGSVLTTGVPYCQE--GYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMT---RSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            L+S + LPD H +D+    L        + + ++S L   + VV G + AI+R  K + +     + +D++I+ TG+QY +P      + N     ++ N         +  K     VP NL ++ND         ++ HN        ++YG++ + + C+ T++ +G+ G RIH V PP D+      D  VE AV + L++  VH+H N  + Q ND       ++S SF+T G  L+LEC +F S+ +K V+  AFRA+ND+CLVFD RLV+D+ FHTND SI AAGP+TK+ RRY+ E+WSH  F S+ VG+ L+ V L   DPTL   V PP +++ LIP+Y  +  +   LPGG++YL V++P +   P +      + G  L TG   C E   YF +  +Q+  VE ITCL K   P+ N   LYG H+R LNN+ SR++E LI+D++ +F + W +A YHDRF D ++E+ +++ +   +    + S EE ++ +  +  E   +Q   L   F+ S A S +   ++ ++ YN YHL MYA+P ++
Sbjct:    1 LISTHALPD-HSSDDCSTFLATSHCYNDRDQCQIS-LCSWISVVTGKIKAINRADKHVELMDDSRVKFDYLILCTGLQYQMP-----NLSNADVITQTSNS--------LKPKETRPRVPSNLFLLNDHQDCSVAHHWLTHNFTQLTGDAVVYGNTIDVFTCIETLIGLGVSGRRIHVVHPPEDQPFSCFPDASVELAVKQALEKEEVHVHHNCLLLQINDGQHTEP-VTSASFSTDGAILQLECAVFFSFSRKSVDCDAFRAINDACLVFDGRLVVDSGFHTNDPSIYAAGPMTKYSRRYHAEEWSHCCFQSKEVGQSLASVLLAQCDPTLERPVDPPPDQLHLIPLYSQAKTQGGRLPGGYNYLHVAKPVARKTPSAHKVCFTSTGRDLVTG---CAETGNYFHIRHSQFDVVEKITCLSKTPLPVSNLQSLYGKHQRLLNNICSRYDEGLIQDMYSYFKENWCLALYHDRFADFEQEVCQIMDSAKLQDESGSVSLEEALQQIADDKAE--SDQLVSLSQTFQKSQAYSALRNSVLDYLKYNRYHLSMYARPGLL 537          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Xenopus
Match: cfap61 (cilia and flagella associated protein 61 [Source:NCBI gene;Acc:779967])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 331/869 (38.09%), Postives = 505/869 (58.11%), Query Frame = 3
Query: 1035 FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILK-SCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            + G+  A  IQLF I+E +E RS+DFL   F LFP++D+ +ITVP L PEF LL+NFVR+ P     L  ELY FH+ +LIS+ K+R     D   I+ ++  +    +IL DL+ ++ ARR D G  + A+VAE  N+IVGV V++ E+DIEYI SHYNIEDFIYF HH   EHGH+ HFA+NPIF    + FLKE +R S K+++YYP+Y     ++  N   HSL + L  +VP+RPRRQI++ ++KL  NAP++++ + Q  Y L HFNRKL +EPKVTIN RIVVVGAS  G+SF+E+L F PHLKFNN+ L+S  GLP+N P        +     ++ K   L +LR  V+VV G M+ IDR  K + +     +PYDH+I+ TG QY +PCPTEA ++   T KE+    ++RY+           +P NL  + +       + F++ +++  E K+I Y +  +      +++++G+ G RI  V P +      +N   ++ ++   +    ++ + +  V  F+  +  P+     +F     P R + + F ++ +K V+Y AF+A+ND+CLV+D RLVIDT FHTND SIRAAG +TK+  RY+  +WSH+ F+S+ +G +L+   L +FDPTL PV+    E   LIPIY   +++ S I+PGG HYL  + P   I L +   Q   G            GYF L    Y    ++T    K +     + +   H R L +L +RF+  L+     +F + W MA YHDRF D ++E++E+L         S ++  + +  + + L  + R+ L      +  K  +++++++++ YN  HL M+A+P M+
Sbjct:  381 YKGDVTAFSIQLFCIDEKHESRSVDFLSYAFSLFPDKDFCVITVPHLTPEFPLLQNFVRVVPLSTCTLSQELYVFHRAALISSIKVRAVRSNDIHNIRSLLETLHPQESILGDLQIYNQARRDDDGTPVQAFVAEVANQIVGVSVIRNEKDIEYIHSHYNIEDFIYFNHHQWEEHGHLHHFALNPIFMHFGRHFLKEILRLSHKSALYYPIYPSCNKEQFKNPCAHSLSSALHYMVPVRPRRQIVFPLEKLGINAPSKQVSKDQPSYSLNHFNRKLTLEPKVTINARIVVVGASEVGISFMETLVFCPHLKFNNITLISSTGLPENTPISTQEHGFLSTSHSYNDKDYALMSLRSWVNVVVGKMSGIDRAAKFVIVANGRKVPYDHLILCTGQQYQVPCPTEADVRKLLTNKEAPVSSNQRYT---------GKIPSNLFTLQNRQDCLAAMRFLKDSVVKQEGKVISYENRSDMQLISSSVIALGVSGCRIRMVSPKLHFNTCCINRYKIKTSITAGIGNEDINAYADCAVPSFSAGNH-PHPACMGTFRNVTTPCRKQIQAFFNFSRKSVDYEAFKAINDACLVYDGRLVIDTTFHTNDDSIRAAGTLTKYSNRYHASEWSHSNFSSKEIGFQLAANMLNIFDPTLEPVIEFTDEFDRLIPIYKGPVIQASGIIPGG-HYLHANLPVQPIQLRSQFKQARSGRAAIKD-SQTAGGYFFLKTKMYHMAISLTSSSGKPFQESKPICMSCHHLRLLESLIARFSNRLLNSENSYFMEAWCMAIYHDRFIDFQQEVREMLAAEQGEGRPSMKQLAQQIADDELNLKEQPRQYLKRILEENGHKKEIERKILNYLNYNSNHLSMFARPGMI 1237          

HSP 2 Score: 174.096 bits (440), Expect = 2.807e-43
Identity = 105/284 (36.97%), Postives = 161/284 (56.69%), Query Frame = 3
Query:   63 RRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLAN--PLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGK-IPENFGTQFTQIK-----SITDYKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKP-----VQTVNEENIEQLAKKPSNDSQTSST 875
            RRTESLD   I K   + +  IFG+ N+I ++EKA L+VT+ S    +V  A   DYPN   +D  ++W E +      L+N  PLN+LF+H F++K E     + EI+  VFNTA  +H+I +   + + +    G+ F Q K     ++    + ++  R  + P LY+R A+ ED DDL+PIF   +  LK  YGEF+LAE+++AQ++Q+  +V+E  G AVGF+SV+++IN  LL   F L  F G  KP     +    + +IE+       DS+TS+ 
Sbjct:   17 RRTESLDVHGIIKRKTTTTERIFGRVNVIYLLEKANLAVTVYSAKNGVVANAVLLDYPNCDIVD-QAEWEEKLPTHYEELSNCTPLNTLFLHLFVAKDEYSEQCIQEIIRVVFNTAPYLHFICLTAPRDEALGLALGSVFQQTKIVSASALAKQHSLYMCHRHNHCPQLYVRNARVEDYDDLIPIFMRHNDTLKATYGEFFLAELIEAQDEQSHAIVSEDKGKAVGFMSVSSEINARLLQSCFDLGPFHGLCKPHPDDILYASEKTSIEKDLMLSRQDSKTSAA 299          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Xenopus
Match: cfap61 (cilia and flagella associated protein 61 [Source:NCBI gene;Acc:779967])

HSP 1 Score: 422.165 bits (1084), Expect = 5.944e-128
Identity = 208/465 (44.73%), Postives = 293/465 (63.01%), Query Frame = 3
Query: 1035 FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESK 2423
            + G+  A  IQLF I+E +E RS+DFL   F LFP++D+ +ITVP L PEF LL+NFVR+ P     L  ELY FH+ +LIS+ K+R     D   I+ ++  +    +IL DL+ ++ ARR D G  + A+VAE  N+IVGV V++ E+DIEYI SHYNIEDFIYF HH   EHGH+ HFA+NPIF    + FLKE +R S K+++YYP+Y     ++  N   HSL + L  +VP+RPRRQI++ ++KL  NAP++++ + Q  Y L HFNRKL +EPKVTIN RIVVVGAS  G+SF+E+L F PHLKFNN+ L+S  GLP+N P        +     ++ K   L +LR  V+VV G M+ IDR  K + +     +PYDH+I+ TG QY +PCPTEA ++   T KE+    ++RY+           +P NL  + +       + F++ +++  E K
Sbjct:  381 YKGDVTAFSIQLFCIDEKHESRSVDFLSYAFSLFPDKDFCVITVPHLTPEFPLLQNFVRVVPLSTCTLSQELYVFHRAALISSIKVRAVRSNDIHNIRSLLETLHPQESILGDLQIYNQARRDDDGTPVQAFVAEVANQIVGVSVIRNEKDIEYIHSHYNIEDFIYFNHHQWEEHGHLHHFALNPIFMHFGRHFLKEILRLSHKSALYYPIYPSCNKEQFKNPCAHSLSSALHYMVPVRPRRQIVFPLEKLGINAPSKQVSKDQPSYSLNHFNRKLTLEPKVTINARIVVVGASEVGISFMETLVFCPHLKFNNITLISSTGLPENTPISTQEHGFLSTSHSYNDKDYALMSLRSWVNVVVGKMSGIDRAAKFVIVANGRKVPYDHLILCTGQQYQVPCPTEADVRKLLTNKEAPVSSNQRYT---------GKIPSNLFTLQNRQDCLAAMRFLKDSVVKQEGK 836          

HSP 2 Score: 173.711 bits (439), Expect = 2.604e-43
Identity = 105/284 (36.97%), Postives = 161/284 (56.69%), Query Frame = 3
Query:   63 RRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLAN--PLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGK-IPENFGTQFTQIK-----SITDYKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKP-----VQTVNEENIEQLAKKPSNDSQTSST 875
            RRTESLD   I K   + +  IFG+ N+I ++EKA L+VT+ S    +V  A   DYPN   +D  ++W E +      L+N  PLN+LF+H F++K E     + EI+  VFNTA  +H+I +   + + +    G+ F Q K     ++    + ++  R  + P LY+R A+ ED DDL+PIF   +  LK  YGEF+LAE+++AQ++Q+  +V+E  G AVGF+SV+++IN  LL   F L  F G  KP     +    + +IE+       DS+TS+ 
Sbjct:   17 RRTESLDVHGIIKRKTTTTERIFGRVNVIYLLEKANLAVTVYSAKNGVVANAVLLDYPNCDIVD-QAEWEEKLPTHYEELSNCTPLNTLFLHLFVAKDEYSEQCIQEIIRVVFNTAPYLHFICLTAPRDEALGLALGSVFQQTKIVSASALAKQHSLYMCHRHNHCPQLYVRNARVEDYDDLIPIFMRHNDTLKATYGEFFLAELIEAQDEQSHAIVSEDKGKAVGFMSVSSEINARLLQSCFDLGPFHGLCKPHPDDILYASEKTSIEKDLMLSRQDSKTSAA 299          

HSP 3 Score: 100.138 bits (248), Expect = 1.426e-20
Identity = 64/129 (49.61%), Postives = 86/129 (66.67%), Query Frame = 3
Query: 2742 VNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCIL-PGGHHYL-SVSRPSLDIPLSTLTN 3122
            V+Y AF+A+ND+CLV+D RLVIDT FHTND SIRAAG +TK+  RY+  +WSH+ F+S+ +G +L+   L +FDPTL PV+    E   LIPIY   +++      GG HYL  + R SLD  +S   N
Sbjct:  846 VDYEAFKAINDACLVYDGRLVIDTTFHTNDDSIRAAGTLTKYSNRYHASEWSHSNFSSKEIGFQLAANMLNIFDPTLEPVIEFTDEFDRLIPIYKGPVIQGLWYHSGGLHYLHPLMRGSLDNSISPFEN 974          

HSP 4 Score: 65.4698 bits (158), Expect = 6.472e-10
Identity = 26/96 (27.08%), Postives = 54/96 (56.25%), Query Frame = 3
Query: 3345 FFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            +F + W MA YHDRF D ++E++E+L         S ++  + +  + + L  + R+ L      +  K  +++++++++ YN  HL M+A+P M+
Sbjct:  976 YFMEAWCMAIYHDRFIDFQQEVREMLAAEQGEGRPSMKQLAQQIADDELNLKEQPRQYLKRILEENGHKKEIERKILNYLNYNSNHLSMFARPGMI 1071          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Xenopus
Match: ENSXETT00000049348.1 (cilia- and flagella-associated protein 61-like [Source:NCBI gene;Acc:108647660])

HSP 1 Score: 273.092 bits (697), Expect = 1.886e-81
Identity = 150/316 (47.47%), Postives = 209/316 (66.14%), Query Frame = 3
Query: 2394 RHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLF 3341
            R+NL+     +I+YG++ + Y  L T+LS+GI G RIH V+PP+   V   N+  +EEAV K L   G+  + N  +AQ+ND    P+ I   +FT+   PLRL+C  F ++ +K V+Y AF+A+ND+CLV+D RLVIDT FHTND SIRAAG +TK+  RY+  +WSH+ F+S+ +G +L+   L +FDPTL PV+    E   LIPIY   +++  I+PGG HYL V++P++  PL     Q +YG  + TG       YFRLH+NQY  VE+ITCL +K +P  NY+ LYG HER LNNL +RF+E LIKDL+
Sbjct:   56 RNNLVCC-CNVIVYGNTLDCYTTLSTLLSLGISGSRIHLVQPPLTMNVTCFNNYAIEEAVQKALLAEGISSYCNCVLAQWNDGAH-PDPICFATFTSDTKPLRLQCSAFFNFSRKSVDYEAFKAINDACLVYDGRLVIDTTFHTNDDSIRAAGTLTKYSNRYHASEWSHSNFSSKEIGFQLAANMLNIFDPTLEPVIEFTDEFDRLIPIYKGPVIQGGIIPGGFHYLHVNKPAIPCPLKAQMAQAHYGREIVTGSAV-DGDYFRLHINQYNMVESITCLSQKPFPESNYICLYGHHERLLNNLCARFDEGLIKDLY 368          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Mouse
Match: Cfap61 (cilia and flagella associated protein 61 [Source:MGI Symbol;Acc:MGI:1926024])

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 500/1235 (40.49%), Postives = 743/1235 (60.16%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKL--KECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSIT--DYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPS-NDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSGLNDIPNNFE------------------------------FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEG-YFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ++ RRTES D   I+ L+   +  +FG+ N+I ++EKA L+VT+ +   EI+ ++ F DYPN   +    +W  + +   KE P   PLN+LFMH+F++  E  +  L EI+ TVF     +++IF I      +     T F Q+ +I   +Y   F   I  R  + P L+IR A+ ED DDLMPIF      LK+IYGE++LAE+++AQ+     +V EV G AVGF+SV T +N+ LL+  F L  F GF  P    + ++I + +++PS  + + + ++ S  VV  +E       E  TE S S   AL       S      D+  N                                + G+  A  IQLF I+E YE RS+DF+  VF LFP +++ LI+VP L PEF L++NFV++ P     L H+LY FH+  L+ +  IR A   D   ++ ++  + LS  IL+DL Q++ A R   G +L  +VAE  ++IVG+ V+++E DIEYIRSHYNIEDFIYF+HH + EHG + HFA+NPIFR  +K FLKE +R   K+ +YYPVY      KL +   HSL + L  LVP+RPRRQI+Y ++KL  NAP++ + + Q  + L H NRKL +EPKVT+N RIVVVGAS+ G+SFLE+L F  HLKFNNL L+S +GLP          + +  D  F+ K   L +L   V+VV G MTAIDR  K + ++   ++ YDH+I+ TG+QY +PCPT A  +   T +E      +RY+           VP NL ++ND     ++L ++R++ +L E K+I+YG++ ++Y  + T+L++G+ G  I+FV PP +  +  +N+  VE AV   L  AGV +  +  +AQ+N     P+ I +  FTT   P+RLEC  F S+YKK V+Y  F+A ND+CLV+D RLVIDT FHTND++IRAAG +TKF  RYY+ +W+H+ F+S+ +G +L+   L LFDPTL PV  PP +   LIP+Y  + ++  ILPG +HYL +S+P++  PL+   +QP++GS + TG    ++G YFRL++N YK VE ITC  K+ +P  NY++L+G HE+ LNNL +RF++ LI DL+ +F + W MA +HDRF DLK+E++++L+++      + EE    +  E + L  + +K L   F +S  KS +++ ++ ++ YN YHLPMYA P ++
Sbjct:   14 VHCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYPN-WNVAKQDNWIPLFRELDKEIP-CTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVEDHDDLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVEGKAVGFMSVCTSVNLPLLHECFDLGPFHGFCTP----HPDDILKPSREPSLEEGEDAESQGSPKVVEEQEMAPEITQEKETETSASCEEALPTVLGLVSEERLKQDMEKNLSILSLVDEEDVASSLSSSLLLSVESSHFRPLYLGDPIAFCIQLFCIDERYEARSLDFMSFVFSLFPGKNFCLISVPHLTPEFVLIQNFVKVVPFNNCTLDHDLYVFHRAGLLRSITIRLAKFLDTAGVEKLVSTLLLSTKILDDLAQYNEAGRDPDGTALQVFVAEVADQIVGIAVIRKEMDIEYIRSHYNIEDFIYFSHHQQEEHGRLNHFALNPIFRHYTKFFLKEILRLGYKSCLYYPVYPQTREGKLQSSYSHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKEVSKDQVSFALNHTNRKLTLEPKVTVNARIVVVGASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKRLLHNEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTAIDRAAKQVVVSKSEIVFYDHLILCTGLQYQVPCPTGADTEQHLTNREVLELSKQRYT---------GTVPSNLFILNDEEDCVRMLCWLRNSSILTEGKVIVYGNTLDAYTTVETLLNIGMKGSGIYFVHPPTESNITCINNNDVESAVEDALSAAGVTVFHDALLAQWNHGQH-PDPIYNACFTTSTKPIRLECSAFFSFYKKNVDYETFKAFNDACLVYDGRLVIDTTFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLSLFDPTLEPVTEPPADLDRLIPMYKGAKIQGGILPGSYHYLHISKPAIPTPLNLQRSQPDFGSDVVTG--NAKKGTYFRLYINNYKLVEAITCFSKEPFPSSNYIRLFGQHEQVLNNLCTRFDDKLIPDLYSYFTEPWCMALFHDRFIDLKKELRQILISKQEEDKPTMEEIAYRLEEEEINLNEKPQKYLQRVFEDSIYKSLLEKSILDYLHYNQYHLPMYAWPGII 1230          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Mouse
Match: Cfap61 (cilia and flagella associated protein 61 [Source:MGI Symbol;Acc:MGI:1926024])

HSP 1 Score: 358.607 bits (919), Expect = 1.714e-109
Identity = 223/590 (37.80%), Postives = 327/590 (55.42%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKL--KECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSI--TDYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPS-NDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSGLNDIPNNFE------------------------------FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEH 1706
            ++ RRTES D   I+ L+   +  +FG+ N+I ++EKA L+VT+ +   EI+ ++ F DYPN   +    +W  + +   KE P   PLN+LFMH+F++  E  +  L EI+ TVF     +++IF I      +     T F Q+ +I   +Y   F   I  R  + P L+IR A+ ED DDLMPIF      LK+IYGE++LAE+++AQ+     +V EV G AVGF+SV T +N+ LL+  F L  F GF  P    + ++I + +++PS  + + + ++ S  VV  +E       E  TE S S   AL       S      D+  N                                + G+  A  IQLF I+E YE RS+DF+  VF LFP +++ LI+VP L PEF L++NFV++ P     L H+LY FH+  L+ +  IR A   D   ++ ++  + LS  IL+DL Q++ A R   G +L  +VAE  ++IVG+ V+++E DIEYIRSHYNIEDFIYF+HH + EHG + HFA+NPIFR  +K FLKE +R   K+ +YYPVY      K+   H
Sbjct:   14 VHCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYPN-WNVAKQDNWIPLFRELDKEIP-CTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVEDHDDLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVEGKAVGFMSVCTSVNLPLLHECFDLGPFHGFCTP----HPDDILKPSREPSLEEGEDAESQGSPKVVEEQEMAPEITQEKETETSASCEEALPTVLGLVSEERLKQDMEKNLSILSLVDEEDVASSLSSSLLLSVESSHFRPLYLGDPIAFCIQLFCIDERYEARSLDFMSFVFSLFPGKNFCLISVPHLTPEFVLIQNFVKVVPFNNCTLDHDLYVFHRAGLLRSITIRLAKFLDTAGVEKLVSTLLLSTKILDDLAQYNEAGRDPDGTALQVFVAEVADQIVGIAVIRKEMDIEYIRSHYNIEDFIYFSHHQQEEHGRLNHFALNPIFRHYTKFFLKEILRLGYKSCLYYPVYPQTREGKVRGWH 597          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Mouse
Match: Cfap61 (cilia and flagella associated protein 61 [Source:MGI Symbol;Acc:MGI:1926024])

HSP 1 Score: 212.231 bits (539), Expect = 4.917e-61
Identity = 113/300 (37.67%), Postives = 172/300 (57.33%), Query Frame = 3
Query: 1731 LVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNE--------------------------SKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLND 2552
            LVP+RPRRQI+Y ++KL  NAP++ + + Q  + L H NRKL +EPKVT+N RIVVVGAS+ G+SFLE+L F  HLKFNNL L+S +GLP          + +  D  F+ K   L +L   V+VV G MTAIDR  K + ++   ++ YDH+I+ TG+QY +PCPT A  +   T +E      +RY+           VP NL ++ND     ++L ++R++ +L E                           K+I+YG++ ++Y  + T+L++G+ G  I+FV PP +  +  +N+
Sbjct:    1 LVPVRPRRQIVYPLEKLGINAPSKEVSKDQVSFALNHTNRKLTLEPKVTVNARIVVVGASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKRLLHNEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTAIDRAAKQVVVSKSEIVFYDHLILCTGLQYQVPCPTGADTEQHLTNREVLELSKQRYT---------GTVPSNLFILNDEEDCVRMLCWLRNSSILTEVPTLLQTPPCCYWTMQNHLSTVNPRTGKVIVYGNTLDAYTTVETLLNIGMKGSGIYFVHPPTESNITCINN 291          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Mouse
Match: Cfap61 (cilia and flagella associated protein 61 [Source:MGI Symbol;Acc:MGI:1926024])

HSP 1 Score: 138.272 bits (347), Expect = 1.044e-35
Identity = 84/224 (37.50%), Postives = 128/224 (57.14%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKL--KECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSI--TDYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVG 701
            ++ RRTES D   I+ L+   +  +FG+ N+I ++EKA L+VT+ +   EI+ ++ F DYPN   +    +W  + +   KE P   PLN+LFMH+F++  E  +  L EI+ TVF     +++IF I      +     T F Q+ +I   +Y   F   I  R  + P L+IR A+ ED DDLMPIF      LK+IYGE++LAE+++AQ+     +V EVG
Sbjct:   14 VHCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYPN-WNVAKQDNWIPLFRELDKEIP-CTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVEDHDDLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVG 235          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Mouse
Match: Cfap61 (cilia and flagella associated protein 61 [Source:MGI Symbol;Acc:MGI:1926024])

HSP 1 Score: 92.4337 bits (228), Expect = 8.664e-21
Identity = 62/181 (34.25%), Postives = 98/181 (54.14%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKL--KECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSI--TDYKNWF---ILKREAYMPTLYIRAAKQED 572
            ++ RRTES D   I+ L+   +  +FG+ N+I ++EKA L+VT+ +   EI+ ++ F DYPN   +    +W  + +   KE P   PLN+LFMH+F++  E  +  L EI+ TVF     +++IF I      +     T F Q+ +I   +Y   F   I  R  + P L+IR A+ ED
Sbjct:   14 VHCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYPN-WNVAKQDNWIPLFRELDKEIP-CTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVED 192          
BLAST of cilia- and flagella-associated protein 61 vs. UniProt
Match: sp|Q8NHU2|CFA61_HUMAN (Cilia- and flagella-associated protein 61 OS=Homo sapiens OX=9606 GN=CFAP61 PE=2 SV=3)

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 497/1238 (40.15%), Postives = 736/1238 (59.45%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPL-ANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSIT--DYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSG----------LNDIPNNFE-------------------------FPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEG-YFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ++ RRTES D   I+ LI   +  +FGK N+I ++EKA L+VTL +   EI+  A+F DYPN   +    DW  + +  +  +   PLN+LFMH F++  E       EI+ TV+     +H+IF I      +     T F Q+ +I    Y+  F   I  R ++ P L++R A+ ED DDLMPIF    TILK+ YGE++LAE+++AQ+++   +V EV G AVGF+SV + +N+ LL+  F L  F G   P      E+ + L+ + S D++  S+      +V E     S       +      A     +  +++SG          L+DI   +                          + G S A  IQLF I+E YE RS+DF+  VF LF ++++ +I++P L PEF L++NFV++ P     L  +LY FH+  L+ +  IR A   D   ++ ++  + L+++IL DL++++ AR+   G  L A+VAE   +IVG+ V++ E DIEYIRSHYNIEDFIYF+HH R EHGH+ HFA+NPIFR  +K FLKE +R   K+ +YY VY      K  N   HSL + L  LVP+RPRRQI+Y ++KL  NAP++ + +    Y L H NRKL +EPK+T+N +I+VVGAS+ G+SFLE+L F  H+KFNNL L+S +GLP     D    + +  D  F+ K   L +L   V+VV G MT IDR  K + ++   ++PYDH+I+ TG QY +PCPTEA I    T +E  N   RRY+           VP N   +N+    FK L ++R+N +  E  II+YG++ ++Y  + T+L++G+ G RIH V+PP    +  +N+  VE AV   L  AGV ++ +  +AQ+ND    P+ I S SFTT   P RL+C +F S+ +K V+Y  F+A+ND+CLV+D+RLVIDT FHTND++IRAAG +TKF  RYY+ +W+H+ F+S+ +G +L+   L LFDPTL PV  PP     LIP+Y  + ++  ILPG +HYL +++P++  PL     QPNYG  L TG    + G YFR+H+N+YK VETITCL ++ +P  NY++L+G HE+ LNNL +R++ENLI DL+ +F + W +A +HDRF DL++E++++L ++      S E+    +  E +  T + R+ L   F  S  K+ V++  + ++ YN YHLPMYA P +V
Sbjct:   14 VHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCNDKEEIMAQATFLDYPN-WNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCKEILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHYPQLHVRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVEGTAVGFMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQDLSVRRSQDAELRSSSQGSQKIVEELQEPVSPDTMENIQGNIAREAASE-EALTAVQSGNVSEPEDIEKLSDISTGYAQYHHVSSRSLASLVLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFCVISLPHLTPEFFLIQNFVKMVPFNTCTLEQDLYVFHRAGLLKSINIRFATLLDTPGVENLVSTLMLNKSILEDLDRYNKARKDPDGTLLQAFVAEVAEQIVGIAVIRNEMDIEYIRSHYNIEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYRVYPKSREGKFQNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPMSYALNHTNRKLTLEPKITVNAKIIVVGASSVGISFLETLVFCSHMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYT---------GKVPCNHFTLNEEEDCFKALIWIRNNSITTEGNIIVYGNTIDTYTTVETLLNLGVSGSRIHLVQPPPASTITCINNYSVESAVADALGAAGVTMYRDAILAQWNDGLH-PDPIYSASFTTPTKPFRLQCSMFFSFCEKNVDYETFKALNDACLVYDSRLVIDTNFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLHLFDPTLEPVTEPPANLDRLIPMYKGAKIQGGILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLELVTGS--AKNGTYFRIHINKYKMVETITCLSREPFPASNYIRLFGQHEQLLNNLCARYDENLITDLYSYFTEPWCLALFHDRFIDLRKELRQILASKEEEDLPSIEQLAHQIEDEEINPTEKPRQYLKRVFEESIYKTLVERSTLDYLHYNRYHLPMYAWPGIV 1237          
BLAST of cilia- and flagella-associated protein 61 vs. UniProt
Match: sp|Q8CEL2|CFA61_MOUSE (Cilia- and flagella-associated protein 61 OS=Mus musculus OX=10090 GN=Cfap61 PE=1 SV=2)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 383/876 (43.72%), Postives = 563/876 (64.27%), Query Frame = 3
Query: 1041 GESNAIIIQLFAINEAYEMR---------SIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEG-YFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            G+  A  IQLF I+E YE R         S+DF+  VF LFP +++ LI+VP L PEF L++NFV++ P     L H+LY FH+  L+ +  IR A   D   ++ ++  + LS  IL+DL Q++ A R   G +L  +VAE  ++IVG+ V+++E DIEYIRSHYNIEDFIYF+HH + EHG + HFA+NPIFR  +K FLKE +R   K+ +YYPVY      KL +   HSL + L  LVP+RPRRQI+Y ++KL  NAP++ + + Q  + L H NRKL +EPKVT+N RIVVVGAS+ G+SFLE+L F  HLKFNNL L+S +GLP          + +  D  F+ K   L +L   V+VV G MTAIDR  K + ++   ++ YDH+I+ TG+QY +PCPT A  +   T +E      +RY+           VP NL ++ND     ++L ++R++ +L E K+I+YG++ ++Y  + T+L++G+ G  I+FV PP +  +  +N+  VE AV   L  AGV +  +  +AQ+N     P+ I +  FTT   P+RLEC  F S+YKK V+Y  F+A ND+CLV+D RLVIDT FHTND++IRAAG +TKF  RYY+ +W+H+ F+S+ +G +L+   L LFDPTL PV  PP +   LIP+Y  + ++  ILPG +HYL +S+P++  PL+   +QP++GS + TG    ++G YFRL++N YK VE ITC  K+ +P  NY++L+G HE+ LNNL +RF++ LI DL+ +F + W MA +HDRF DLK+E++++L+++      + EE    +  E + L  + +K L   F +S  KS +++ ++ ++ YN YHLPMYA P ++
Sbjct:  389 GDPIAFCIQLFCIDERYEARQVLISNVSLSLDFMSFVFSLFPGKNFCLISVPHLTPEFVLIQNFVKVVPFNNCTLDHDLYVFHRAGLLRSITIRLAKFLDTAGVEKLVSTLLLSTKILDDLAQYNEAGRDPDGTALQVFVAEVADQIVGIAVIRKEMDIEYIRSHYNIEDFIYFSHHQQEEHGRLNHFALNPIFRHYTKFFLKEILRLGYKSCLYYPVYPQTREGKLQSSYSHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKEVSKDQVSFALNHTNRKLTLEPKVTVNARIVVVGASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKRLLHNEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTAIDRAAKQVVVSKSEIVFYDHLILCTGLQYQVPCPTGADTEQHLTNREVLELSKQRYT---------GTVPSNLFILNDEEDCVRMLCWLRNSSILTEGKVIVYGNTLDAYTTVETLLNIGMKGSGIYFVHPPTESNITCINNNDVESAVEDALSAAGVTVFHDALLAQWNHGQH-PDPIYNACFTTSTKPIRLECSAFFSFYKKNVDYETFKAFNDACLVYDGRLVIDTTFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLSLFDPTLEPVTEPPADLDRLIPMYKGAKIQGGILPGSYHYLHISKPAIPTPLNLQRSQPDFGSDVVTG--NAKKGTYFRLYINNYKLVEAITCFSKEPFPSSNYIRLFGQHEQVLNNLCTRFDDKLIPDLYSYFTEPWCMALFHDRFIDLKKELRQILISKQEEDKPTMEEIAYRLEEEEINLNEKPQKYLQRVFEDSIYKSLLEKSILDYLHYNQYHLPMYAWPGII 1252          

HSP 2 Score: 165.236 bits (417), Expect = 8.356e-40
Identity = 103/274 (37.59%), Postives = 158/274 (57.66%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKL--KECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIF-INTDKGKIPENFGTQFTQIKSI--TDYKNWF---ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPS 851
            ++ RRTES D   I+ L+   +  +FG+ N+I ++EKA L+VT+ +   EI+ ++ F DYPN   +    +W  + +   KE P   PLN+LFMH+F++  E  +  L EI+ TVF     +++IF I      +     T F Q+ +I   +Y   F   I  R  + P L+IR A+ ED DDLMPIF      LK+IYGE++LAE+++AQ+     +V EV G AVGF+SV T +N+ LL+  F L  F GF  P    + ++I + +++PS
Sbjct:   14 VHCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYPN-WNVAKQDNWIPLFRELDKEIP-CTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVEDHDDLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVEGKAVGFMSVCTSVNLPLLHECFDLGPFHGFCTP----HPDDILKPSREPS 281          
BLAST of cilia- and flagella-associated protein 61 vs. UniProt
Match: sp|A8IF44|CFA61_CHLRE (Cilia- and flagella-associated protein 61 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP61 PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 2.643e-64
Identity = 194/815 (23.80%), Postives = 354/815 (43.44%), Query Frame = 3
Query: 1038 PGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERIL---QVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHI--HDNYCVAQFNDSDEV-PNWISSVSF---TTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYL------SVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSS 3437
            P +     + +  ++ A+E ++I+FL   F  + ++ Y ++T+P    E  L+    R++P PG + P  L+ FH+ +LI +F +R     D + +  ++  M  + +I+        A      +        C  ++VG++ +  E D+E +++++ + + +   +  R +HG I  + +NPIF    +  +   MR   KT++YY                          + P +Q    ++ LE  AP  R     Q+Q  + L  F R+ A + + ++N++IVVVGAS  GL+ +E L   P L+FN L LL+P G+           ++ G    F+   +    L  +V ++   +  +DR  KL+ ++    + Y+ +++A G+                     Q++   R++E      +  ++   L +  D         F  ++ M+  S I++YG++  +Y  L  + + G  G +  FV PP  +       P +   ++    EAGV +   +   +A  +    V P   +S +       GP   L  +L V      V+ S F  +ND+ LVFD RLV+D  F TND +I A G + K  RRY      H  +NSR VG  L+   +  F+              P   ++    +  C LPGG++++      ++ RPS        T  P  G  + T     + G  R+ L+   +V ++  L + A        L G+H   LN+L  ++    IK L  F  + W+   Y++ F +L+E + E+ +   S
Sbjct:  389 PADPTLFAVTMLCMDPAFEAQAIEFLTPAFAAYTDKLYCVVTLPHDSREPALMGTMTRVAPNPGSLFPEVLFMFHRHALIPDFAVRLGEPGDLDAVASLVAGMPNADDIVASFSGAAAAGSAAVAL--------CQGELVGLVTVNPEVDLELLQANFGLSNHVDLGYQPREQHGEIDMYTMNPIFVHRHRTLVAATMRLLGKTALYY-------------------------ALPPGQQPPDMLEVLEQVAPRHRTASDKQLQAEFALYVFTRQAAFKRRRSVNSQIVVVGASECGLAVVERLLLDPELQFNYLTLLAPGGI-----------KVGGMACQFTAGVIARLGLEARVMLLDAEVIGLDRGSKLLDLSDGSQIFYNQLVLAAGL---------------------QDQSRYRFAEA--DPEVAGLLVTELELAAD---------FSMNDAMVMNS-ILVYGNAMGAYHSLAVLEAKG-AGEKTRFVAPPGQQ-------PPLVGVLHALAGEAGVALPSPEPRDLAGLSVVQPVGPELHASATLIDPADPGPREELPVDLVVGCEPPSVSRSLFTCLNDASLVFDGRLVVDGAFRTNDPAIYAGGSLAKLSRRYGGTHLEH--YNSRDVGSRLASSLVSFFNAGPDEPQPAATAAAPPPALHRARAV-GCSLPGGNYFVYAGCPAALQRPS--------TAAPEGGYEMKTA---SERGLTRITLDGEGRVHSLMYLGRVAVNAPRLGSLVGLHANYLNSLAPKYQAGDIKCLLSFITEPWSELLYNESFPELRETLLEVALAELS 1104          

HSP 2 Score: 58.151 bits (139), Expect = 5.181e-7
Identity = 34/102 (33.33%), Postives = 52/102 (50.98%), Query Frame = 3
Query:  522 REAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDI---------YGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKP 800
            R+A +P L IR A+ ED DD++PI          +         +  F L  +V  Q+++ + LVAE  G  VGFI +T+D++   L   F L A++ F  P
Sbjct:  160 RDAVVPPLAIRPARVEDHDDMLPILQRCEVAFPALAKLPEASRPHEPFALTRVVAGQDERNRVLVAEAEGRLVGFIVMTSDVDTGSLAETFDLHAYDNFLPP 261          
BLAST of cilia- and flagella-associated protein 61 vs. UniProt
Match: sp|Q23F13|CFA61_TETTS (Cilia- and flagella-associated protein 61 OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=CFAP61 PE=4 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 2.865e-62
Identity = 241/999 (24.12%), Postives = 437/999 (43.74%), Query Frame = 3
Query: 1008 LNDIPNNFEFPGES-NAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISN-FKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLE--------GNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNH---PTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTT--------KESQNKPDRRYSEL------MFKKH-MEKIVPDNLMVVNDPF--GAFKLLEFVRHNLMLNESK-----IIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVF------------------------PLNDPVVEEAVYKTLDEA------GVHIH--------------------DNYCV----------------AQFNDSDEVPNWISSVSFTTHGPPLRLECEL-----------------FVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHA----RFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQE--GYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGV---ELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKP 3623
            L+ IP   E P ++ NAI+I LF I+E +E RS+DF++  F +F +RDY+++T PF VPE TLL+ F++I  +      H LY +HK  L+SN   IR++  +D + +  +  N+   + I +D     L     T     A+   C   ++G+ V+ +  +++Y  SH+ ++D I    H  + H  + H A+NP+F + ++  LKE +R   KT +Y+ V +      + NE   V   Q    ++ +    +D +  E         +   +   Q Q  + L+   +K+    KV  NTRIVVVGAS TG+SF+ESL     + F ++ LL+P G+   H   P D    QL     +++ ++L+   L  +V+V+   M  +D+K K I ++    LPYD+++   G+       TE + +   +T        ++  +K  R  +++      +F +H +       +  ++DP+    FK       N+ L   K     I IYG +  +   +  +++ G+   RIH+V PP   +VF                        P +DP VE+ +++ ++        G ++H                    DNY                  A   ++D+  +   S        P+ LE E+                  V+     ++   F  ++++ LV++ RL++ + F T +  I   G + +F +RY       +    ++N R +G++L+K  L   D   +  +T  +  +  +P  Y  I     LPG   Y  + +     P  T+  + N   +++  +   Q+   Y +   +    ++ +T L  +   +++ V   G+ E+ LN L+ RF   LI ++ EF  + WA+  YH+ F + +  I ++ M +S       +E  +     G    E   + + ++  E       S + Q  + FI  N  HLPMY  P
Sbjct:  722 LDSIP---EVPIDAQNAIVINLFCIDENFESRSLDFVEYAFSIFGDRDYIILTQPFTVPETTLLQQFIKIPMKKNSTFDHVLYIYHKDCLLSNTLFIRKSKLEDMQYVAPLFSNLINKQQIYDDT----LEAITQTASRKVAFSVFCDQSLIGIYVVSKNVNLDYYISHFCVQDHIILKEHPMTCHTKLIHTALNPLFTKNTRFILKEILRLMNKTCMYFEVQEKTLLPDVFNELVFVRARQFPHFLKRKWDFEHDKEHFERAGDLTEVQDGKRDAFDQEQAPFSLSVITKKMMSSVKVNNNTRIVVVGASDTGISFIESLLSVKDINFTHITLLAPGGIMTMHINLPGD----QLKALSTNYTLEELKNLMLDARVNVLDAKMVELDKKGKKIKLDKNAELPYDYLVNTVGL-----IDTELQNRRLISTGLFSSPYYQQLLDKYGRDRAQIEEGAPPIFGQHPVYGNYVQGVYSIDDPYLYEEFKKTGKKDSNIDLLTRKKRPQSITIYGRTLHTIAFISGMVNRGVHPNRIHYVIPP---KVFETQVQFKNNTERLIYEDKRINDPDPFDDPSVEQKIFEFMESKGIQVHKGYNLHQIDVDEETRICQGVVFRKKADNYEEIIQQIEIKKQQILERDANSENADKGFDDTQSRDGDEENQPITLEQEIEELERNKFDDIEITSRFLVTSGLVDIDKEIFYIIHENGLVYNGRLIVKSNFQTTEKDIFCCGKICEFSQRYKRLSIGRSLRLDKYNGRELGQKLAKCLL---DSLDLGYLTDQIYSLGELPNLYMPIGIGAFLPGDLFYYHIKKNDYARPSKTMEAEDNRQDIVSDNIDQKQQIGHYIKFKFDNNGIIDQVTYLGTEPVSVQSLVSFVGLSEKCLNQLDVRFKNGLIPNISEFLSENWAIGLYHEWFSEFR-HITKMEMLQSENIQQILDEAAKYAQGGGFLDPEFIEKIKAKISPEI-----ISQIQQGTLDFIRENQNHLPMYYVP 1692          

HSP 2 Score: 99.7525 bits (247), Expect = 1.270e-19
Identity = 85/304 (27.96%), Postives = 141/304 (46.38%), Query Frame = 3
Query:   45 DFNMYARRTESLDAVEIEKLI-----NSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPN--IAEIDTSSD--WNEIV----KLKECPLANPLNSLFMHYFLS-------KPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPENFGTQFTQIKSITD-------YKNWFILKR---------------EAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQN----------DQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKP 800
            +F +  R+++  D  E+ K+I      +N + ++  PNL+++ EK  LSVT+ ++  +I+G A F D+P     +ID   +  W   +       E     P N+L+M +F           E E  I  ++   V+ T   +  I     +G+  E+ G Q  QI SI +        K+  I+KR                A    + IR A+++D DDL  IFN QS +L   +GEF++A+++  QN          +  K +V +V   AVG +S++TDI+   L   F LE ++   KP
Sbjct:   32 EFQVLVRKSDLDDVDEVLKIIAQHEREANDL-LYDYPNLLSLFEKNYLSVTILNQQQQIIGAAVFNDFPQGLTGQIDFQHENFWENWIFDAFNFDESICITPFNTLWMTFFFVAKDQYKFSQEEELIICQKVFQNVYATLPQLEGILF-LKRGETMEDNGAQ-AQISSILENIFIEVPVKDRDIIKRVRGIHLNSEVFYSPKHACQEIIEIRMAREQDHDDLAEIFNRQSEVLTAQFGEFFIADLIATQNLTRRGTRKFLNNGKAIVGQVRDKAVGLMSISTDIDYKFLAQCFELETYDNLFKP 332          
BLAST of cilia- and flagella-associated protein 61 vs. TrEMBL
Match: gnl|BL_ORD_ID|23853531 (tr|V4B959|V4B959_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_107567 PE=4 SV=1)

HSP 1 Score: 1014.6 bits (2622), Expect = 0.000e+0
Identity = 527/1230 (42.85%), Postives = 771/1230 (62.68%), Query Frame = 3
Query:   60 ARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVK--LKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPENFGTQFTQ----IKSITDYKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKP------------------VQTVNEENI---EQLAKKPSND-------SQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRS-GLNDIPNNFEF----PGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ARRTESLDA  I KL    +  +FG+ +++ IIEKA+L++TL ++  EI+G+A+FYDYPN   ID  ++W + ++    E   ++  N+LF+HYF+++P   +    EI+ T F    ++H+I +    G  P+   ++  Q    I S+      F+ KR  ++P L++R A+ ED DDL PIFN QS +LK IYG+F+LAE+++AQ+D+ +CLV E  G A GF S+  ++N DLLN  F L  F G +KP                  V+T  E++I   E   + PS D       ++TS  E S  +    ++   S         I F   ++   S AS R  G       F F     GE+NA  IQLF I+E YEMRS D L   F LFP+ D+ +ITVP LVPEF LL  FVR++PR    L  ELY FH+  L+ NF +R AC KD   ++ ++ ++    ++L+D +QF  ARR + G  + A+VAEC  +IVGV ++++EEDIEYIRSHYNIEDFIYF HH R +HGH+ HFA+NP+F  LSK FLKE +R   KT +YYP+Y P+ S +L  ++++++ L DLVP+R RRQ+ Y+I  L  N+P++R+L+    + L H NRKL +EPKVTIN RIVVVGAS  G++FLE+L + PHL+FNN+ L+SP+G P       L   ++ K++  SK +   S LR  + +V G MT IDR +K + +N  +++PYDH+II TG QY +PCPTEA +++  T KE  N PDRRY             P+NL +VND + +  L   +++ LM + +KI++YG++ ++Y C+ ++L  GI G  I  V PP   +V   N+ V+E+ V K L++ G+ I++ + +A++  +D+    I+SVSFT+   PL L C  F S YKK V+  +F+A+ND+CLV+D +LV+D+ FHTND+SIR AG +TK++R+YY  +WSHA FNS+ +G  L+   L+LFDPT+ P   P  E+  LIP+Y    ++  +LPGG++YL V +P LD+PL       +YG  L TG P  ++GYFRLH+N Y  +ETITCL K+     N + LYG+HE+ LNNL SRF+E LI D + +F ++W +  YHDRF DL++E++ELL+T       + E+ +R ++ E + L  +Q  EL + ++ S AK  V+ RL++F++YNYYHLPMYAKP MV
Sbjct:   20 ARRTESLDAPHIIKLAQQTTSELFGRVDVVEIIEKAVLAITLNNEKDEILGHAAFYDYPNTKSID-QAEWVDWIRNNFDEVQKSSAFNTLFLHYFVARPGYANGCAKEIMRTAFTAIPDVHFIILMVPNGTFPDPSLSEIFQPLKRINSVGSEVTAFVCKRHDHVPVLHVRQARVEDNDDLTPIFNRQSDMLKSIYGDFFLAELIEAQDDEMQCLVVEAEGTACGFTSLNKNVNYDLLNECFELAPFHGLRKPHDEDDLVPPATPVPSPITVETRREDSIHSRESKTESPSLDKDETTLKTETSKLETSDKLKTSRQSSAASARGLLLFSLILFDTVVY---SRASERKKGFALSEQRFRFVPTYKGEANAFTIQLFCIDEKYEMRSKDILSKAFSLFPHCDFCIITVPHLVPEFPLLHGFVRVTPRSPSTLSQELYVFHRSGLLKNFNVRTACTKDIHGVENLVKSIHCQSDLLDDFKQFRAARRDEDGKEIQAFVAECSEQIVGVCIVRREEDIEYIRSHYNIEDFIYFNHHRREDHGHLHHFALNPVFSHLSKHFLKEVLRLGHKTCLYYPLYPPYISHELTTKNTMISALNDLVPVRARRQVNYNIDILGENSPSDRVLKQTHPFALCHINRKLTLEPKVTINARIVVVGASDVGVAFLETLAYCPHLRFNNVTLISPHGFPGEIDPSLLQHPMLTKNYPTSKDEEIWSFLRTWISIVYGKMTGIDRTRKQVKVNSSFIVPYDHLIICTGQQYQVPCPTEASLEHGVTNKELPNSPDRRYKGSQ---------PNNLYLVNDYYDSLTLQHAIQNKLMPSNNKILLYGNNIDTYTCIQSLLQYGITGDNILLVLPPQAYDVTCFNNKVIEDTVRKALNDNGIKIYEGFLLAEWTLNDDTD--ITSVSFTSDDEPLTLSCHAFFSLYKKAVDMDSFKAINDACLVYDGKLVVDSLFHTNDVSIRGAGTLTKYQRKYYGNKWSHANFNSKEIGIALATEILKLFDPTVEPEAYPREEQFNLIPLYRAPKIQVTMLPGGYNYLHVKKPGLDVPLEIQMANEDYGKELVTGEPDSEKGYFRLHVNLYNSIETITCLAKQEVTCSNLLCLYGLHEKYLNNLVSRFDEGLITDFYSYFKESWCVGLYHDRFSDLRDELRELLITSPEEGKETLEDQIRQLIDEEMSLNSKQHDELNEIYKLSGAKQAVETRLLNFLSYNYYHLPMYAKPGMV 1234          
BLAST of cilia- and flagella-associated protein 61 vs. TrEMBL
Match: gnl|BL_ORD_ID|15738002 (tr|R7TM94|R7TM94_CAPTE DUF4821 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_159925 PE=4 SV=1)

HSP 1 Score: 1008.82 bits (2607), Expect = 0.000e+0
Identity = 537/1229 (43.69%), Postives = 767/1229 (62.41%), Query Frame = 3
Query:   60 ARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVK----LKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPEN-FGTQFTQIKSITDYKN-----WFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFK--------------KPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSGLN----DIPNNFEF----PGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQ---KLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKI-KNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDE--VPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ARRTESLDA  I KL+ S++  +FG+ N++N+IEKA+L+VTL++   +++G+A+F+DYPN  ++D  ++W + +     LK+C   + LNSLFMHYF++K E       EIV T+FN   ++HY F+    G  PE+     F Q+       N      F+  R  ++P L++R A+ ED DDL+PIFN QS +LK  YGE++LAE+++AQ++  KC+VAEV G A+GF+S+  D+NIDLLN  F L  F G +               PV    +E     ++  S  S   S +   P  +  +  + + S  S         +             LN    D+  N +F     G S+A  IQLF I+E++EMRS DF+   F+LF + ++ +ITVP LVPEF LL+ FVR++PR       ELY F +  LI +F +R AC KD E ++ ++  +     +L DL+Q++ ARR D G  + A+VAE  ++IVGV +++ EEDIEYIRSHYNIEDF+YF HH RSEHGH+ H+A+NP+FR  SK FLKE +R   KT +YYP+Y  + +    + L +H+LV+ L D+VP+R RRQI+  I+ L GNAP+ERIL+ QE Y L H NRKL +EPKVTIN RIVVVGAS  G++ +E+    PHL+FNNL L+S +GLP   P D L + +M     +S+++     +R  V+VV G MT+IDRKKK + +N   ++PYDH+++ATG+QY I  PTEA   + +    +  N PDRR+             P+N  VVND + A   L +V  N++  +  ++IYG + ++Y C+ +++S+G+   RI  V+P    E    N+ VVEEA+   L+ AGV + + Y +AQ+ND  +      I+S SFT+    LR EC  F S+YK +V+Y +F+A+ND+CLVFD RLVID  FHTND+ IR AGP+TKF+R Y+ ++W+HA FNS+ VG +L+   L LFDPTL P   PP + + LIP+Y    +    LPGG HYL V++P L  PL  L  Q +YG  + TG P  +  YFRLH+NQ+  +ETITCL KK  P  N + L+G+HER LNN+ SR  E LIKDL+ +F++ W MA +HDRF D ++EI+ELL+TR +    + EE VR  + E + L    RK L+D++++S AK  V+ RL+SF++YNYYHL MYAKP MV
Sbjct:   16 ARRTESLDAPGILKLVQSSTEALFGRVNVVNLIEKAVLAVTLSNDEDDLLGHAAFFDYPNQTDVD-QAEWEKWITENYGLKKC---DALNSLFMHYFVAKQEYSHGCAREIVRTMFNAVPDLHYCFLIVPPGVFPEHAISDIFKQVDKAGSIPNQQSGSLFVCHRHDHVPVLHVRTARVEDHDDLVPIFNRQSDLLKSTYGEYFLAELIEAQDENMKCIVAEVEGTAIGFMSINKDVNIDLLNQCFELGPFHGLRVPHEDDELEPTPTPNPVSEGQKEATSATSRASSKISLKGSAKVEEPPAIQGKLSDGNASLLSEHSEKGSRKSSASQAREPVEELKLNQVFIDVKTNLQFVPVYKGVSSAFAIQLFCIDESFEMRSCDFMFKAFELFESCNFGIITVPHLVPEFPLLQQFVRMTPRVPSTFSQELYVFSRAGLIRSFNVRLACTKDFEGVESLVKTLDQKEILLADLQQYNQARRDDDGTQIQAFVAETRDQIVGVAIIRAEEDIEYIRSHYNIEDFVYFNHHRRSEHGHLHHYALNPVFRHYSKHFLKEVLRLGHKTCLYYPLYPGYINHLIFQTLGKHTLVSALSDMVPVRARRQIVQPIEDLGGNAPSERILKQQEMYALNHINRKLTLEPKVTINARIVVVGASDVGVALMETFAHCPHLRFNNLVLISRHGLPGELPPDPLRDSMMASSHCYSQEEYAQMGIRAWVNVVYGNMTSIDRKKKHVVVNSNTIVPYDHLVLATGVQYQIAAPTEADPDQQYADVSDLPNSPDRRWL---------AACPENAFVVNDQYEAAVALYWVETNILHTDGSVLIYGSTMDTYSCVQSLISLGLPAKRIVIVEPLQTSETSCFNNRVVEEAIMLELNNAGVKVVNGYLLAQWNDGKDGNCVTRINSASFTSPLGSLREECCAFFSFYKPMVDYLSFKAINDACLVFDGRLVIDANFHTNDVCIRGAGPLTKFQRNYHADKWTHANFNSKDVGVQLASAMLTLFDPTLEPEPEPPKDLLKLIPMYRSPKICKATLPGGFHYLHVAKPQLTSPLEILMQQNDYGQEIITGTPGGEIEYFRLHINQFNTIETITCLSKKPLPTNNLICLFGLHERFLNNIVSRHQEGLIKDLYSYFNEKWCMAIFHDRFPDFRDEIRELLITRPNDDVPALEEQVRKYIDEDLNLAPSVRKHLLDDYKDSGAKRAVETRLLSFLSYNYYHLTMYAKPGMV 1231          
BLAST of cilia- and flagella-associated protein 61 vs. TrEMBL
Match: gnl|BL_ORD_ID|17515475 (tr|A7SG85|A7SG85_NEMVE Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g245069 PE=4 SV=1)

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 525/1208 (43.46%), Postives = 747/1208 (61.84%), Query Frame = 3
Query:   60 ARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLK-ECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPENF--GTQFTQIKSITDYKNWF---------ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSGLNDIPNNFEFPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXX--XXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQE---GYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ARRTESLDA +I KL+ + +  +FG+ N++NIIEK+ L+VTL +   ++V +A+F+DYPNI  +D +S W+  +K K +C  A PLNSLFM+YF++KP+      +EI+ TVFN    +HYIF+      +P +   G   T++     YK  F         +  R  + P L+IR A+ ED DDLMPIFN Q+ +L  +YG F+LAE+++AQ+ + KCLVA+V G AVGF+S+ + +   +LN  F LE F   +K        +I +    P N+S         P ++H+ +                 + + R P+                  G  +A  IQLF I+E YEMRSIDFL   F  FP+RDY ++T+P LV EF LL+ F+R++P+    L  ELY +H+  LI +F +R     D + I+ +I  +K S  IL D+EQ++ ARR   G  L  +VAEC+ ++VG  V+++EEDIEYIRSHY+IEDF+YF HH R EH H+ H  +NP+F++ SK FLKE +R + K+ +YYPV+  +AS  +   HS+VT+L DLVPI  RRQI+Y +++L GNAP+ERILQ +E + L H NRKL +EPKV IN RIVVVGAS  G+SFLE+  F PHL+FNNL L+SP GLP     D+L+   +     +        +LR  ++VVKG MTAIDR  K++ ++G + +PYD+++I TG Q+ +P PT A I    TT E        Y  ++         PDN+  VN      K++++V +  + ++ K ++YG + E++  +  +LS GI   R+  V+PP        N+  +EEA  + L  +GV +H  Y +A++ND     N +S  +FT+   PLR++C+ F  + +K V++ AF+A+NDSCLVFD RLV+D  F TND  IRAAGP+TK++RRY+ E WSHA FNSR VG+EL++  L LFDPTL          EE  L+P+Y    + S +LPGG+HYL V +P L+IPL +L  QP YG  L TG     E   GYFRLH+NQY+ VETITC  KK+    N   LYG+HER LNNL  RF+E LI+D + FF ++W +A +HDRF D +EEI+ELL+ + S    S EE VR M+ E + L+++QR+ L D + +S AK  ++QRL+SF++YN YHLPMYAKP MV
Sbjct:   12 ARRTESLDAPDILKLVTATTDKLFGRVNVVNIIEKSNLAVTLVNSANKVVAHAAFFDYPNITGVDQAS-WDTWLKSKYDCDKATPLNSLFMNYFVAKPDFAYGCAVEIIRTVFNAVPFLHYIFL-----AVPRSVETGAALTEVFKPMSYKESFTGKLNCEVQVCHRHEHCPKLHIRPARVEDHDDLMPIFNRQNDVLTSMYGNFFLAELIEAQDSENKCLVADVNGTAVGFMSICSQMEARILNRCFDLEPFNRLQKTA------DIGEEPDDPINES---------PEIIHKLSE---------------EHLVQRCPTPPH---------------GPCSAFCIQLFCIDEKYEMRSIDFLPAAFAQFPDRDYCVLTMPHLVSEFPLLQAFIRVTPKRHSTLSQELYVYHRWGLIESFNVRPCISSDSDAIRKVIKKLKASDKILMDVEQYNRARRDPDGTELQVFVAECIGQVVGAAVLRREEDIEYIRSHYSIEDFVYFNHHQREEHAHLHHLILNPVFQQYSKHFLKEVLRLAHKSCLYYPVFPVYASGSVTKNHSVVTSLNDLVPIAARRQIIYPVKELGGNAPSERILQEKEAFALNHLNRKLTLEPKVVINARIVVVGASDVGISFLETFVFCPHLRFNNLTLVSPQGLPGQTAPDKLVNSCLPSSMCYDDDIYANMSLRTWINVVKGSMTAIDRTNKILKVSGGFGVPYDYLVICTGQQFQVPAPTGADISTLVTTSEVPRPRTAVYRGML---------PDNVFTVNSHGDCAKVVKWVNNYFLNSQGKALVYGCTLEAFTFVQGLLSAGIPADRLVMVQPPPPVPSC-FNNIDIEEATDQALQASGVEVHVGYVLAEWNDGKYDSN-LSCATFTSENKPLRVDCQAFFCFQEKRVDFQAFKAINDSCLVFDGRLVVDANFRTNDPFIRAAGPLTKYQRRYHAESWSHANFNSREVGDELARSMLALFDPTLEGFMPGPVSEEEDKLVPLYKKPKMVSAVLPGGYHYLHVGKPGLNIPLDSLMVQPEYGRELLTGNAKEAESGPGYFRLHVNQYRSVETITCYSKKSLDTTNLKCLYGIHERYLNNLLQRFDEGLIQDFYSFFQESWCLAVFHDRFNDFREEIRELLVNKPSDDVLSLEEKVRKMIDEDLVLSKDQRRNLSDNYVSSPAKKAIEQRLLSFLSYNGYHLPMYAKPGMV 1157          
BLAST of cilia- and flagella-associated protein 61 vs. TrEMBL
Match: gnl|BL_ORD_ID|23477998 (tr|A0A210QNZ2|A0A210QNZ2_MIZYE Uncharacterized protein C20orf26 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09429 PE=4 SV=1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 435/877 (49.60%), Postives = 600/877 (68.42%), Query Frame = 3
Query: 1008 LNDIPNNF--EFPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            L+ +P  F   + GE NA  IQLF I+E +EMRS DFL   F LFP  D+ +ITVP LVPEF LL+ FVR++PR    L  ELY FH+  L+ +F +R AC KD   ++ ++  + L  N++ DL+Q++ ARR + G+ + A+VAEC  +IVG  V+++EEDIEYIRSHYNIEDFIYF HH R EHGH+ HFA+NPIF  LSK F+KE +R+  KT +YYP+Y P+  ++++ +HSLV  L D+VP+R RRQI+Y ++KL  NAP+ER+L  ++ Y L H NRKL MEPKVTIN RIVV+GAS  G++FLE+L +SPHL+F+NL L+SP+GLP     DE+ +Q++G  F +++ +   ++LR  V+VV G MTAIDRKKK + +    ++PYDH+I+ TG QY IP PTEA I+   T  +  N PD RY          K  P NL ++ND + A   L ++ ++L+ +  K++IYG + ++YCC+ ++L+MG+ G RI  V+P    +    N+P ++  + K++ EAGV ++  Y +AQ+ND       I+S SFT++  PL LEC  F +YYK  V+  +FRA+ND+CLV+D +LVID  FHTND++IR AG +TK++R+Y+ EQW+HA FNS+ VG  L+   LRLFDPT+ P   PP E + LIPIY +  ++  ILPGG+HYL V++P LD PLS    QP+YG    TG      GYFRLH+NQY  +ETITCL K+  P  N+  LYG+HER LNNL SRFNE L+KD   +F + W +A YHDRF D ++E++ELL+T   P   S EE VR ++ E V +   Q+ EL+D +RNS AK  V+ RL+SFI+YNYYHLPMYAKP MV
Sbjct:  421 LSSLPKRFVPSYKGEVNAFSIQLFCIDERFEMRSSDFLTKAFSLFPQFDFSVITVPHLVPEFPLLQGFVRVTPRCPSTLSQELYVFHRSGLMKDFNVRPACTKDTAGVEKLVKTVSLQDNLMADLKQYNQARRDEDGMEIQAFVAECQGQIVGTAVIRKEEDIEYIRSHYNIEDFIYFNHHRREEHGHLHHFALNPIFSHLSKHFIKEILRQGHKTCLYYPLYPPYTDKQIVEKHSLVCCLNDMVPVRSRRQIIYPVEKLGVNAPSERVLADRDAYALNHINRKLVMEPKVTINARIVVIGASNVGIAFLETLAYSPHLRFHNLTLISPHGLPGEMAPDEVRDQMLGNSFCYNQNEFSKTSLRTWVNVVYGKMTAIDRKKKFVVVENSSMVPYDHLILCTGEQYQIPAPTEADIEGGATNADLPNSPDMRYM---------KAQPKNLFLINDEYDAAVALYWIENSLLKSSRKVVIYGGTLDAYCCVQSLLAMGVTGDRISLVEPSAAYQTTCFNNPTLDATILKSVKEAGVQVYSGYYLAQWNDGIGEIGEITSASFTSNKEPLILECGAFFAYYKASVDTDSFRAINDACLVYDGKLVIDAAFHTNDVAIRGAGTLTKYQRKYHAEQWTHANFNSKEVGIHLATEMLRLFDPTMEPQSAPPEEALNLIPIYRNPKIQGGILPGGYHYLHVAKPGLDTPLSNQMAQPDYGKEYITGTVDGDPGYFRLHINQYNTIETITCLSKQPIPSSNFNCLYGLHERGLNNLMSRFNEGLVKDFISYFMEKWCLAVYHDRFADFRDEVRELLITSPGPGQESVEERVRQVVDEDVAMNESQKGELLDIYRNSGAKRAVETRLLSFISYNYYHLPMYAKPGMV 1288          

HSP 2 Score: 205.297 bits (521), Expect = 1.042e-49
Identity = 106/254 (41.73%), Postives = 159/254 (62.60%), Query Frame = 3
Query:   60 ARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLK-ECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPEN----FGTQFTQIKSITD--YKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKP 800
            ARRTESLDA  I KL+  N+  +FG+ N++N+IEKA+L+VTL +   +I+G+A+F+DYPNI E+D +S W   +K       +  LN+LFMHYF+ K +       EI+ T FN   ++H++++       PE+       Q  + + ++D      F+  R  ++P L++R A  ED DDL PIF  QS +L   YG+F+LAE+V+AQ++  +CLVAEV G A+GF+S++ D+N  LLN  F L  F G +KP
Sbjct:   17 ARRTESLDAPHIIKLVKENTDALFGRVNIVNLIEKAVLAVTLCNDKEDILGHAAFFDYPNIPEVDQAS-WESWIKNSYGNEKSTALNTLFMHYFVGKSDYAHGCCREIIRTAFNAVPDLHFLYLFVPMKAYPESALDEVFKQVDKTEGVSDGVSGALFVCHRHDHVPVLHVRKATVEDHDDLTPIFTRQSDMLNMTYGDFFLAELVEAQDEHMQCLVAEVEGTAIGFMSISDDVNAPLLNECFELGPFHGLRKP 269          
BLAST of cilia- and flagella-associated protein 61 vs. TrEMBL
Match: gnl|BL_ORD_ID|175190209 (tr|A0A151NDD8|A0A151NDD8_ALLMI Cilia-and flagella-associated protein 61 OS=Alligator mississippiensis OX=8496 GN=CFAP61 PE=4 SV=1)

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 501/1246 (40.21%), Postives = 747/1246 (59.95%), Query Frame = 3
Query:   60 ARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKL----KECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYI--FINTDKGKIPENFGTQFTQIKSITDYK-----NWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKP-----VQTVNEENIEQLAKKPSNDSQTSST---EHSVPVVVHXXXXXXXXXXX----XXXXXXXFHNALFRFPSNASIRSGLNDIPNNFEFP------------------------------GESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLN--EHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ARRTES D   I  L++ ++   FG+ N++ ++EKA L+VTL+++  +++ +A+F+DYPN   +D  +DW   +       +C    PLN+LFMH+F++K E       EI+ TVFN    +H+I  FI + + ++     T F ++ S+ D         F+  R  Y P LYIR A+ ED DDLMPIF   S  L++ YGE++LAEM++AQ++    +V E  G AVGF+SV   +NI LL+  F L  F G  KP     ++   E +IE    K S  SQ + +   + S  +  H+ +I+              +++  + +    +N S + G N I +N E P                              G  +A  IQLF I+E +E RS+DFL  +F+LFP++D+ +ITVP LVPEF L++NFVR+ P     L  ELY FH+  L+ +F +R+A   D   ++ +I  + L+++IL+DL  F LARR   G  + A+VAE  ++IVGV V++ E DIEYIRSHYNIEDFIYF HH + EHGH+ HFA+NPIF   +K FLKE +R + K+ +YYP+Y      K  N   HSL + L  +VP+RPRRQI+Y ++KL  NAP++++ + Q  Y L H NRKL +EPKVT+N RIVVVGAS  G+SFLE+L F PHLKFNNL L+S +GLP  +  D    + +     F+ K   L +L   V+VV G MT IDR  K + ++    +PYDH+++ TG QY +PCPT A I    T +E      +RY+           VP NL +++D     K  ++++ N +     +I+YG++ ++Y  + T+LS+GI G RIH ++PP+   V  LN+  +E AV + L  A V ++ +  +AQ+N+    P+ I+  SFTT+  P +L+C  F+++  K V+Y  F+A+N++CLV+D RLVIDT FHTND++IRAAGP+TKF   YY  +W+H+ F+S+ +G + +   L LFDPTL PV  PP +   LIP+Y    ++  +LPGG++YL +S+P +   L     QPNYG  + TG    +  YFR+H+NQY  VETITC  KK +P+ NY+ L+G HER LNNL SR+ E LI DL+ +F ++W++A YHDRF DLK+E++++L ++      S E+    ++     L+ + +K L   F+ S  +  V++ ++S++ YN+YHLPMYA P +V
Sbjct:   43 ARRTESNDIPGIVSLVSYSTEIYFGRINVVYLLEKANLAVTLSNEKNKVLAHAAFFDYPNWNVVD-QADWEPFLHQNYSNSKC---TPLNTLFMHFFVAKEEYAVGCCQEIIRTVFNAVPELHFILLFIPSQE-ELGSGLATIFEEMVSVPDSALDMDFTLFVCHRHQYGPLLYIRKARVEDHDDLMPIFMRHSDTLRETYGEYFLAEMIEAQDEDNHAVVCEDNGAAVGFMSVCAQVNIQLLHECFDLATFHGLCKPHPDDVLKLPQEPSIETDKDKSSQTSQRAESVFSQSSECISAHDMDIQIDAKTEDVPPQALDTVATPSPIGSVQTNVSEKDGTN-IVSNAELPLGDVTGTDFKTTGIPTLETDEEDAFHPVYRGAVSAFCIQLFCIDEKHEARSMDFLHFIFNLFPDKDFCIITVPHLVPEFLLIQNFVRVVPFRNSTLDQELYVFHRAGLLKSFNVRRATTSDLPAVEILIKTLDLNKSILDDLRIFTLARRDPDGAPVQAFVAEVSDQIVGVSVVRNEMDIEYIRSHYNIEDFIYFNHHQKEEHGHLYHFALNPIFHHYTKYFLKEILRLAYKSCLYYPIYPQSEEGKFQNPYAHSLTSALHYMVPVRPRRQIVYPLEKLGINAPSKQVSKDQLSYALNHINRKLTLEPKVTVNARIVVVGASNVGISFLETLIFCPHLKFNNLTLISTHGLPGKNLPDLKYRRFLINSHCFNDKDYALMSLCSWVNVVVGKMTGIDRAAKHVVVSKGKKVPYDHLVLCTGQQYQVPCPTGADISKLLTNREVTKSCKQRYT---------GKVPTNLFILHDDQDCLKAAQWLKENFINLGGNVIVYGNTIDTYTTVETLLSLGINGSRIHLIQPPLSSNVTCLNNNAIERAVKEALSMADVSVYYDSILAQWNEGSH-PDPITCASFTTNTKPFKLQCSAFLNFSHKGVDYETFKAINEACLVYDGRLVIDTNFHTNDITIRAAGPLTKFSNIYYTNEWTHSNFSSKEIGFQFAASILNLFDPTLEPVSEPPDDMDRLIPMYKGCKIQGGVLPGGYNYLYISKPGIPTRLDVQITQPNYGMEIITG-EAIRGNYFRIHINQYGMVETITCFSKKPFPVSNYICLFGQHERVLNNLCSRWKEGLISDLYSYFSESWSLAIYHDRFIDLKKELRQILTSKQGDGLPSLEQLACEIVDGEFHLSEKPKKYLKRFFQQSIYRKLVEESILSYLNYNHYHLPMYAWPGIV 1271          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Cavefish
Match: si:zfos-223e1.2 (cilia and flagella associated protein 61 [Source:NCBI gene;Acc:103034939])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 462/1211 (38.15%), Postives = 714/1211 (58.96%), Query Frame = 3
Query:   63 RRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLA-NPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPE-NFGTQFTQIKSITDYKNW--FILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTS-STEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNAS----IRSGLNDI--PNNFEFPGES-NAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNE--HSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPD-RRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEG-YFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFE----ETVRNMMVEGVELTREQRKELMDE-FRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            RRTES DA +I +L++  +  +FG+ N+I ++EKA L+VTL++   +I+ +A+F D+P I ++   + W E +++     A  PLN+LF+H F+++    +    EI+ TVF+  + + YI + T      E      F  +  +T+      F+  R  + P L++R A+ ED+DD+  +   Q+      YG ++LA++++AQ++     V E  G AVGF+SV++++N+ LLN  F L  F+G  K    +N  +     ++P  D  T  +TEH   +++  +      +    E+       + R     S    IR+   D    N    P +S NA  IQLFAI++ +EMRS+DFL  VF +FP RD+ +I+VP L PEF LL+ F+R +PRP   LP ELY FH+  L+ + ++R     D   +Q ++ N+ L + +++DL+ F  ARR   G  + A+V E   +IVG+++++ E+DIEYIR++YNIE+F+YF+H+   EHG + HFA++P F+  +K  LKE +R + K+ +YY VY  + SQ+  N     L   L+ +VP++PRRQI+Y +++L  NAP+  I + Q  Y L H NRKL +EPKVT+NTRIVVVGAS TG++FLESL F PHL+FNNL L+S +GLPD   TD      +     +S++   L +L   V VV G MTAIDR  K + ++   ++PYDH+++ TG QY IPCPT   I  + +T +  +KP  R+Y++          VP N   +ND     +   ++  N +  +   ++YG S + Y C+ T+L +G+ G RIH V  P D+      +  V++AV   L +  VH+H    +AQ ND    P  +++VSFTT GPPLRLEC +F ++  K V++ AF+A+ND+CLVFD RLVIDT FHTND +IRAAGP+TK+ RRYY +QWSH  FNS+ VG+EL  V L  FDPTL     P   E  LIPI+    ++   LPGG+ YL V++PS  I  +T  +    G  + TG    + G YF L  N +  +E  TCL  +  P+ NY+ LYG H+  LN+L  RF+++LI DL+ +F +TW MA +HDRF D ++E+++ +M  ++      +      +  M+V G  +  E+ +  +++ F+NS     + + ++ ++ YN YHLPMYA+  ++
Sbjct:   17 RRTESSDAEQICELLSPTAAAVFGRVNVIYLLEKANLAVTLSTAKNQILAHAAFLDHP-IGDLVDQASWEEFLQIHYNGAAFTPLNTLFLHLFVAQSSFAAESAKEIIRTVFSAITELEYICLVTPYNSCLEPALDGIFEPMHCVTEGLQCAAFVCNRHNHCPRLHVRKARVEDLDDITTLLVEQTKAQASSYGPYFLADLIEAQDETNHVAVCENEGIAVGFMSVSSEVNLTLLNQCFELSPFDGLLK----INPADQTDETEEPQQDQPTEENTEHHSEIIL-TQESNEVPAVEGPEEGSECGAGISRVSCGTSETEPIRAHTKDCTGSNVGSEPAQSPNAFCIQLFAIDKRFEMRSVDFLPYVFKVFPERDFCIISVPKLDPEFPLLQTFLRAAPRPFSNLPQELYIFHRTGLLKSLQVRLPVCDDTVAVQRLVENLSLDKALMDDLDMFLKARRDPDGTPIQAFVVEIEEQIVGIVLIRNEQDIEYIRANYNIENFVYFSHYQLEEHGQLCHFALHPNFQHYTKHILKEVLRLAHKSCLYYLVYPTYCSQQENNAFVSYLTAALKCMVPVQPRRQIIYPLEELGINAPSTLITKQQVPYALNHINRKLTLEPKVTVNTRIVVVGASDTGIAFLESLVFCPHLQFNNLTLISTHGLPDCQGTDGTT--FLTTSHCYSERDYALLSLSSWVSVVTGKMTAIDRTAKHVQVSEGRVVPYDHLVLCTGQQYQIPCPTGIDISKWSSTSQEPDKPRCRKYTDH---------VPSNFFTLNDQHDCTQAYNWLLENFIEQDGNAVVYGDSIDMYSCVETLLCLGVRGSRIHVVHTPADKPQSSFKNSAVDQAVRSALQKKEVHVHHGCLLAQLNDGQH-PEPLTAVSFTTDGPPLRLECAVFFNFSCKGVDFDAFKAINDACLVFDGRLVIDTAFHTNDCAIRAAGPLTKYSRRYYADQWSHTDFNSKEVGQELVSVLLPFFDPTLETPNNPAPAEDRLIPIHTQPKIRGGRLPGGYSYLHVAKPS--IYTNTAPSADRSGREMVTG--RVETGNYFHLQFNTHGLLEAFTCLSHRTLPVSNYLCLYGKHQLLLNHLYMRFDQDLIHDLYSYFRETWCMAIFHDRFADFEQEVRQ-IMESTTKVQVDLDLVSIPKLAEMIVYGTLVAAEEPRLYLNQMFKNSEGPDALKRSVLDYLKYNRYHLPMYAQARLL 1204          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Cavefish
Match: si:zfos-223e1.2 (cilia and flagella associated protein 61 [Source:NCBI gene;Acc:103034939])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 424/1102 (38.48%), Postives = 645/1102 (58.53%), Query Frame = 3
Query:  387 TVFNTASNIHYIFINTDKGKIPE-NFGTQFTQIKSITDYKNW--FILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTS-STEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNAS----IRSGLNDI--PNNFEFPGES-NAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNE--HSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPD-RRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEG-YFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFE----ETVRNMMVEGVELTREQRKELMDE-FRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            TVF+  + + YI + T      E      F  +  +T+      F+  R  + P L++R A+ ED+DD+  +   Q+      YG ++LA++++AQ++     V E  G AVGF+SV++++N+ LLN  F L  F+G  K    +N  +     ++P  D  T  +TEH   +++  +      +    E+       + R     S    IR+   D    N    P +S NA  IQLFAI++ +EMRS+DFL  VF +FP RD+ +I+VP L PEF LL+ F+R +PRP   LP ELY FH+  L+ + ++R     D   +Q ++ N+ L + +++DL+ F  ARR   G  + A+V E   +IVG+++++ E+DIEYIR++YNIE+F+YF+H+   EHG + HFA++P F+  +K  LKE +R + K+ +YY VY  + SQ+  N     L   L+ +VP++PRRQI+Y +++L  NAP+  I + Q  Y L H NRKL +EPKVT+NTRIVVVGAS TG++FLESL F PHL+FNNL L+S +GLPD   TD      +     +S++   L +L   V VV G MTAIDR  K + ++   ++PYDH+++ TG QY IPCPT   I  + +T +  +KP  R+Y++          VP N   +ND     +   ++  N +  +   ++YG S + Y C+ T+L +G+ G RIH V  P D+      +  V++AV   L +  VH+H    +AQ ND    P  +++VSFTT GPPLRLEC +F ++  K V++ AF+A+ND+CLVFD RLVIDT FHTND +IRAAGP+TK+ RRYY +QWSH  FNS+ VG+EL  V L  FDPTL     P   E  LIPI+    ++   LPGG+ YL V++PS  I  +T  +    G  + TG    + G YF L  N +  +E  TCL  +  P+ NY+ LYG H+  LN+L  RF+++LI DL+ +F +TW MA +HDRF D ++E+++ +M  ++      +      +  M+V G  +  E+ +  +++ F+NS     + + ++ ++ YN YHLPMYA+  ++
Sbjct:   49 TVFSAITELEYICLVTPYNSCLEPALDGIFEPMHCVTEGLQCAAFVCNRHNHCPRLHVRKARVEDLDDITTLLVEQTKAQASSYGPYFLADLIEAQDETNHVAVCENEGIAVGFMSVSSEVNLTLLNQCFELSPFDGLLK----INPADQTDETEEPQQDQPTEENTEHHSEIIL-TQESNEVPAVEGPEEGSECGAGISRVSCGTSETEPIRAHTKDCTGSNVGSEPAQSPNAFCIQLFAIDKRFEMRSVDFLPYVFKVFPERDFCIISVPKLDPEFPLLQTFLRAAPRPFSNLPQELYIFHRTGLLKSLQVRLPVCDDTVAVQRLVENLSLDKALMDDLDMFLKARRDPDGTPIQAFVVEIEEQIVGIVLIRNEQDIEYIRANYNIENFVYFSHYQLEEHGQLCHFALHPNFQHYTKHILKEVLRLAHKSCLYYLVYPTYCSQQENNAFVSYLTAALKCMVPVQPRRQIIYPLEELGINAPSTLITKQQVPYALNHINRKLTLEPKVTVNTRIVVVGASDTGIAFLESLVFCPHLQFNNLTLISTHGLPDCQGTDGTT--FLTTSHCYSERDYALLSLSSWVSVVTGKMTAIDRTAKHVQVSEGRVVPYDHLVLCTGQQYQIPCPTGIDISKWSSTSQEPDKPRCRKYTDH---------VPSNFFTLNDQHDCTQAYNWLLENFIEQDGNAVVYGDSIDMYSCVETLLCLGVRGSRIHVVHTPADKPQSSFKNSAVDQAVRSALQKKEVHVHHGCLLAQLNDGQH-PEPLTAVSFTTDGPPLRLECAVFFNFSCKGVDFDAFKAINDACLVFDGRLVIDTAFHTNDCAIRAAGPLTKYSRRYYADQWSHTDFNSKEVGQELVSVLLPFFDPTLETPNNPAPAEDRLIPIHTQPKIRGGRLPGGYSYLHVAKPS--IYTNTAPSADRSGREMVTG--RVETGNYFHLQFNTHGLLEAFTCLSHRTLPVSNYLCLYGKHQLLLNHLYMRFDQDLIHDLYSYFRETWCMAIFHDRFADFEQEVRQ-IMESTTKVQVDLDLVSIPKLAEMIVYGTLVAAEEPRLYLNQMFKNSEGPDALKRSVLDYLKYNRYHLPMYAQARLL 1128          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006807.1 (pep scaffold:Pmarinus_7.0:GL482520:855:11431:1 gene:ENSPMAG00000006133.1 transcript:ENSPMAT00000006807.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 345/786 (43.89%), Postives = 480/786 (61.07%), Query Frame = 3
Query: 1290 IRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNE--HSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXX--XXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEG-YFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            +R A   D + ++ ++  +   + +L D  QF+ ARR   G  +  YVAE + KIVGV V++ EEDIEYIRSHYNIEDFIY++HH R +H H+ HF +NP     +K FLKE +R S  TS+YYPVY P  S+K   E  H+L + L  LVP+RPR QI Y + +L  N+P++R+L  Q+ Y L HFNRKL +EPKVT+N RIVVVGAS TG+SFLE+L F PHL+FNNL L+S +GLP   P   + E  +     +S   L L +L  +V VV G + AI+R  K + + G   + YDH+I+ TG QY +PCPTEA +    T  E  N PDRRYS           VP NL  +ND       LE++R N +  +   I+YG S ++Y  + T+L +G+ G RIH  +PP    V   N+  VE A+   L +AGV +H +  +A +N++ +  + I+S SFTT   P  LEC  F ++Y+K V+Y AFRA NDSCLVFD RLVID  F T+D ++RAAG +TK+ RRYY +  +HA +NS+ VG  L+   L L DPTL              L+P +    ++  ILP G+HYL + +P + IPL     +P+YG  L TG P  ++G YFRLH+ ++  VET+TCL  K  PI NYV LYG HE+ LN L SRF+E LI DL+ +F   W MA +HDRF+DL+ E+++L+ T  +    S  E    ++   + L     + L ++F+    K  V+ RLIS++ YN+YHLPMY +P ++
Sbjct:    5 VRAARSNDSDAVKSLVETLDQHKLLLADFNQFNQARRDPNGTQIRVYVAEMLEKIVGVAVVRAEEDIEYIRSHYNIEDFIYYSHHRRDQHAHLCHFVLNPASYLYTKHFLKEVLRLSHCTSLYYPVY-PGYSKKSWTEKHHTLSSVLHCLVPVRPRSQISYPLHELGENSPSQRVLMEQDKYALNHFNRKLTLEPKVTVNARIVVVGASDTGISFLETLAFCPHLRFNNLTLISTHGLPGELPPCPIREGFLASSHCYSTNDLALLSLHSRVSVVVGKVAAINRSAKHVVVTGGGHVSYDHLILCTGQQYEVPCPTEADLSKLLTNAEVPNSPDRRYS---------GPVPTNLFTLNDQDDCQHALEWLRRNFLGGQGNAIVYGSSLDAYTTVQTLLKLGVAGSRIHLAEPPHGYTVCCFNNFAVESAIRGALLQAGVKVHSSCLLAHWNENAQQSDLITSASFTTDTKPFSLECSAFFAFYRKGVDYEAFRAANDSCLVFDGRLVIDASFCTSDGAVRAAGTLTKYARRYYADHAAHAGYNSKEVGFHLAAGMLPLLDPTLEPPSSDDLSDSLNRLVPTFTAPNIQGGILPRGYHYLHIVKPGVVIPLEAQMARPDYGRELVTGRP--EDGDYFRLHVGRHGTVETLTCLSAKPLPISNYVHLYGQHEQLLNTLLSRFDEGLIPDLYSYFRQPWCMAIFHDRFQDLQRELRQLVSTAQAESVPSMLELATQLVQGDLSLLDGGPQSLHEQFKKLGYKKAVETRLISYLQYNHYHLPMYFRPGII 778          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000113.1 (pep scaffold:Pmarinus_7.0:GL477060:118666:121010:1 gene:ENSPMAG00000000100.1 transcript:ENSPMAT00000000113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 3.931e-31
Identity = 62/177 (35.03%), Postives = 105/177 (59.32%), Query Frame = 3
Query:   51 NMYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFI----NTDKGKIPENFGTQFTQIKSITD-YKNWFILKREAYMPTLYIRAAKQ 566
             + ARRTES D   +E L++  +  +FG+   +++IEKA L+VTL + T EI+ +A+F DYPN A +D +   + + K  +     PLN+LFMHYF++K  VE++   +I+ TVFN   ++H++F+    N   G + EN  T+      ++D   + ++  R  + P L+IR A++
Sbjct:   22 GVCARRTESSDVHHLEALVSPATEQLFGRVIPVSLIEKANLAVTLCNDTNEIIAHAAFLDYPNTACVDQAEWPSWMCKHFDSGKCTPLNTLFMHYFVAKSGVETDCAKQIIRTVFNAVPDLHFVFLLLKKNASPGAVLENIFTKMKMHGHVSDPGGSLYVCHRHNHFPILHIRQARE 198          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Nematostella
Match: EDO37268 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG85])

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 525/1208 (43.46%), Postives = 747/1208 (61.84%), Query Frame = 3
Query:   60 ARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLK-ECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPENF--GTQFTQIKSITDYKNWF---------ILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSGLNDIPNNFEFPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXX--XXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQE---GYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            ARRTESLDA +I KL+ + +  +FG+ N++NIIEK+ L+VTL +   ++V +A+F+DYPNI  +D +S W+  +K K +C  A PLNSLFM+YF++KP+      +EI+ TVFN    +HYIF+      +P +   G   T++     YK  F         +  R  + P L+IR A+ ED DDLMPIFN Q+ +L  +YG F+LAE+++AQ+ + KCLVA+V G AVGF+S+ + +   +LN  F LE F   +K        +I +    P N+S         P ++H+ +                 + + R P+                  G  +A  IQLF I+E YEMRSIDFL   F  FP+RDY ++T+P LV EF LL+ F+R++P+    L  ELY +H+  LI +F +R     D + I+ +I  +K S  IL D+EQ++ ARR   G  L  +VAEC+ ++VG  V+++EEDIEYIRSHY+IEDF+YF HH R EH H+ H  +NP+F++ SK FLKE +R + K+ +YYPV+  +AS  +   HS+VT+L DLVPI  RRQI+Y +++L GNAP+ERILQ +E + L H NRKL +EPKV IN RIVVVGAS  G+SFLE+  F PHL+FNNL L+SP GLP     D+L+   +     +        +LR  ++VVKG MTAIDR  K++ ++G + +PYD+++I TG Q+ +P PT A I    TT E        Y  ++         PDN+  VN      K++++V +  + ++ K ++YG + E++  +  +LS GI   R+  V+PP        N+  +EEA  + L  +GV +H  Y +A++ND     N +S  +FT+   PLR++C+ F  + +K V++ AF+A+NDSCLVFD RLV+D  F TND  IRAAGP+TK++RRY+ E WSHA FNSR VG+EL++  L LFDPTL          EE  L+P+Y    + S +LPGG+HYL V +P L+IPL +L  QP YG  L TG     E   GYFRLH+NQY+ VETITC  KK+    N   LYG+HER LNNL  RF+E LI+D + FF ++W +A +HDRF D +EEI+ELL+ + S    S EE VR M+ E + L+++QR+ L D + +S AK  ++QRL+SF++YN YHLPMYAKP MV
Sbjct:   12 ARRTESLDAPDILKLVTATTDKLFGRVNVVNIIEKSNLAVTLVNSANKVVAHAAFFDYPNITGVDQAS-WDTWLKSKYDCDKATPLNSLFMNYFVAKPDFAYGCAVEIIRTVFNAVPFLHYIFL-----AVPRSVETGAALTEVFKPMSYKESFTGKLNCEVQVCHRHEHCPKLHIRPARVEDHDDLMPIFNRQNDVLTSMYGNFFLAELIEAQDSENKCLVADVNGTAVGFMSICSQMEARILNRCFDLEPFNRLQKTA------DIGEEPDDPINES---------PEIIHKLSE---------------EHLVQRCPTPPH---------------GPCSAFCIQLFCIDEKYEMRSIDFLPAAFAQFPDRDYCVLTMPHLVSEFPLLQAFIRVTPKRHSTLSQELYVYHRWGLIESFNVRPCISSDSDAIRKVIKKLKASDKILMDVEQYNRARRDPDGTELQVFVAECIGQVVGAAVLRREEDIEYIRSHYSIEDFVYFNHHQREEHAHLHHLILNPVFQQYSKHFLKEVLRLAHKSCLYYPVFPVYASGSVTKNHSVVTSLNDLVPIAARRQIIYPVKELGGNAPSERILQEKEAFALNHLNRKLTLEPKVVINARIVVVGASDVGISFLETFVFCPHLRFNNLTLVSPQGLPGQTAPDKLVNSCLPSSMCYDDDIYANMSLRTWINVVKGSMTAIDRTNKILKVSGGFGVPYDYLVICTGQQFQVPAPTGADISTLVTTSEVPRPRTAVYRGML---------PDNVFTVNSHGDCAKVVKWVNNYFLNSQGKALVYGCTLEAFTFVQGLLSAGIPADRLVMVQPPPPVPSC-FNNIDIEEATDQALQASGVEVHVGYVLAEWNDGKYDSN-LSCATFTSENKPLRVDCQAFFCFQEKRVDFQAFKAINDSCLVFDGRLVVDANFRTNDPFIRAAGPLTKYQRRYHAESWSHANFNSREVGDELARSMLALFDPTLEGFMPGPVSEEEDKLVPLYKKPKMVSAVLPGGYHYLHVGKPGLNIPLDSLMVQPEYGRELLTGNAKEAESGPGYFRLHVNQYRSVETITCYSKKSLDTTNLKCLYGIHERYLNNLLQRFDEGLIQDFYSFFQESWCLAVFHDRFNDFREEIRELLVNKPSDDVLSLEEKVRKMIDEDLVLSKDQRRNLSDNYVSSPAKKAIEQRLLSFLSYNGYHLPMYAKPGMV 1157          
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Medaka
Match: CFAP61 (cilia and flagella associated protein 61 [Source:NCBI gene;Acc:101163868])

HSP 1 Score: 508.449 bits (1308), Expect = 8.497e-160
Identity = 294/859 (34.23%), Postives = 476/859 (55.41%), Query Frame = 3
Query: 1050 NAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPD 3626
            NA  I+ F   + + +RS+D +Q +F LFP+ DY + T      EF  L+NF+R+   P  + P  LY FH+  L     +R+A   D+  +  ++ ++  ++++L DL+ F+        V L AYVA+  ++IVG++++K E+D++Y+R+HYNI+++I F+ +   EH HI+HF + P    LSK F KE +R + K+ +YY  Y    S +      L   L   VPI PR+QI+Y +++L  +AP+ R+ + Q  + L+   RK  ++P+  INTRIVVVGAS TGLSFLE+L   P LKFNNL L+S +G P +   +++    +     ++ K L L  +   ++VVKG M +I+RK K + ++G   +PY+++I+ TG+QY++P  T   + N P+  + Q +P  + +          +VP NL  +N+         ++  N +  +   IIYG + + Y  + T+LS+GI G RIH V PP +  V    + VVE AV   L  A VH+H ++ +AQ N SDE P+ ++SV+FT    PL L+C +F++   K ++     ++  S L+ D RLVI   F T D SI  AGP+T+F   Y++++WSHA FNS+ VG++L++  L   D  +  +      E  LIPIY  + +++  LPGG ++L V++PS   P +          ++T GV      YF + L+    VETI CL  +  PI NY+ LYG HE+ L  +  R+ + L++DL+ FF   W M  +HDR+ DL++E+ E +  + +      EE              +        F ++  ++TV      F+A N   LPM+++P+
Sbjct:  304 NAFCIRFFLTKKRFNLRSVDCIQYMFQLFPDLDYCIFTFDLSCAEFGFLQNFLRVPTEPTNLSPCALYIFHRSGL-GRVGVRKAVDSDRAAVSDLVKDLNCNKSLLQDLDSFY---NDPVSVMLQAYVAQMDSQIVGILIVKDEQDVDYLRAHYNIDNYIQFSQYRSEEHVHIRHFVLKPFLGLLSKHFFKEVLRLAHKSCLYYRTYPRHCSHQDSCVDPLDFVLNYAVPISPRKQIIYPLEELGNDAPSIRLTEEQAPFALSLIRRKFLVQPRRNINTRIVVVGASDTGLSFLETLCLRPKLKFNNLALVSTHGFPGDCDHNDM--GFLSTSHAYNSKDLAL--IHSNINVVKGKMVSINRKSKYVLVSGVGKVPYNYLILCTGLQYSVPNVTVENVSN-PSNDQLQPQPTEQTN--------PGVVPSNLFTLNNVHDCMAARHWLCANFLDQKDNAIIYGDNIDVYISVETLLSLGIPGARIHLVLPPPEPAVCTFPNSVVENAVAAALKVANVHVHRDFVLAQMN-SDEHPDRLTSVTFTKDSEPLHLQCGVFLNLSGKEIDCDVLESIQKSLLLSDDRLVIRATFLTTDSSIYGAGPLTRFSHWYHSDEWSHANFNSKEVGQDLAETLLSKLDAIVENLEEESPVEGRLIPIYKQAKIQAGKLPGGFNFLHVTKPS---PTTARRPFTPTTQIVTGGVK--TGNYFCIELDCNGLVETIICLSLEPLPISNYLTLYGKHEKLLGQMLRRYRQGLLQDLYSFFRQRWCMPIFHDRYSDLEKELWEKVRLKDTGSQRVTEE--------------DSDSSPPGSFLDAEGRATVRNVTQRFLANNKDLLPMFSEPE 1125          

HSP 2 Score: 83.5741 bits (205), Expect = 1.137e-15
Identity = 68/286 (23.78%), Postives = 132/286 (46.15%), Query Frame = 3
Query:   75 SLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIV-KLKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYI-FINTDKGKIPENFGTQFTQIKSITDYKNWFI---LKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDI---NIDLLNYGFYLEAFEGFKK-------------------PVQTVNEENIEQLAKKPS 851
            S D   IE L  S S  IFG+ N++ + +KA  ++T+ ++  +IV +A F D+P I ++   + W + + K    P    LN+LF+H F+++ +  +  +  I+ T F+    + YI  ++ +  ++       F   +S TD     +     RE   P +++R  +  D++++M I + ++    D          ++ +++    +  E     VGFI V+  I   N+++L++ F L  F+GF K                   P  T+ E+   Q+ + PS
Sbjct:   27 SADIEWIESLTTSTSP-IFGRVNVVQLEDKASFALTVVNENQDIVAHAVFVDHP-IGDLVDQAQWEQFLHKHFSSPQCTSLNTLFLHLFVAREDFATTTVHTIMRTAFHVVPEVEYICLVSPNVAELEPALQVIFDPFQSRTDSALQCLACFCCREKIYPQVHMRPFRASDLNEVMDIIDGETASSSD---------SIELESEHCHAITVEADKAVVGFIKVSDVIDIYNLEILDH-FDLRQFKGFYKIQEKQAEAAAAYLSGEEQEPSSTLEEQRETQMTEAPS 300          
BLAST of cilia- and flagella-associated protein 61 vs. Planmine SMEST
Match: SMESG000059955.1 (SMESG000059955.1)

HSP 1 Score: 2379.36 bits (6165), Expect = 0.000e+0
Identity = 1189/1193 (99.66%), Postives = 1192/1193 (99.92%), Query Frame = 3
Query:   54 MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPENFGTQFTQIKSITDYKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHXXXXXXXXXXXXXXXXXXFHNALFRFPSNASIRSGLNDIPNNFEFPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDXXXXXXXXXXXXXXXXXXXYYDSILKSCILPGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 3632
            MYARRTESLDAVEIEKLINSNSIYIFGKPNLI+IIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPENFGTQFTQIKSITDYKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHEENIETSLSETSTEKSISFHNALFRFPSNASIRSGLNDIPNNFEFPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQ MIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDPTLVPVVTPPVEEVPLIPIYYDSILKSCILPGG+HYLSVS+PSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV
Sbjct:    1 MYARRTESLDAVEIEKLINSNSIYIFGKPNLISIIEKALLSVTLTSKTGEIVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLANPLNSLFMHYFLSKPEVESNILMEIVNTVFNTASNIHYIFINTDKGKIPENFGTQFTQIKSITDYKNWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEMVDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPVQTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHEENIETSLSETSTEKSISFHNALFRFPSNASIRSGLNDIPNNFEFPGESNAIIIQLFAINEAYEMRSIDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELYCFHKGSLISNFKIRQACKKDQEEIQDMIINMKLSRNILNDLEQFHLARRFDTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRSEHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNEHSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRKLAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPDNHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLISINGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSELMFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFESYCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVHIHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYSAFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHARFNSRVVGEELSKVFLRLFDPTLVPVVTPPVEEVPLIPIYYDSILKSCILPGGYHYLSVSKPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQYKKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFDDTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTREQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV 1193          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP610.000e+040.15cilia and flagella associated protein 61 [Source:H... [more]
CFAP612.279e-6841.55cilia and flagella associated protein 61 [Source:H... [more]
CFAP612.325e-6432.75cilia and flagella associated protein 61 [Source:H... [more]
CFAP612.325e-6432.75cilia and flagella associated protein 61 [Source:H... [more]
CFAP611.147e-6143.82cilia and flagella associated protein 61 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG302681.336e-2022.08gene:FBgn0050268 transcript:FBtr0273311[more]
CG302752.618e-1623.91gene:FBgn0050275 transcript:FBtr0344660[more]
CG302752.630e-1623.91gene:FBgn0050275 transcript:FBtr0344659[more]
CG302757.459e-1124.72gene:FBgn0050275 transcript:FBtr0344661[more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:zfos-223e1.23.499e-9935.30si:zfos-223e1.2 [Source:ZFIN;Acc:ZDB-GENE-110411-2... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap612.807e-4338.09cilia and flagella associated protein 61 [Source:N... [more]
cfap615.944e-12844.73cilia and flagella associated protein 61 [Source:N... [more]
ENSXETT00000049348.11.886e-8147.47cilia- and flagella-associated protein 61-like [So... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap610.000e+040.49cilia and flagella associated protein 61 [Source:M... [more]
Cfap611.714e-10937.80cilia and flagella associated protein 61 [Source:M... [more]
Cfap614.917e-6137.67cilia and flagella associated protein 61 [Source:M... [more]
Cfap611.044e-3537.50cilia and flagella associated protein 61 [Source:M... [more]
Cfap618.664e-2134.25cilia and flagella associated protein 61 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q8NHU2|CFA61_HUMAN0.000e+040.15Cilia- and flagella-associated protein 61 OS=Homo ... [more]
sp|Q8CEL2|CFA61_MOUSE8.356e-4043.72Cilia- and flagella-associated protein 61 OS=Mus m... [more]
sp|A8IF44|CFA61_CHLRE2.643e-6423.80Cilia- and flagella-associated protein 61 OS=Chlam... [more]
sp|Q23F13|CFA61_TETTS2.865e-6224.12Cilia- and flagella-associated protein 61 OS=Tetra... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|238535310.000e+042.85tr|V4B959|V4B959_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|157380020.000e+043.69tr|R7TM94|R7TM94_CAPTE DUF4821 domain-containing p... [more]
gnl|BL_ORD_ID|175154750.000e+043.46tr|A7SG85|A7SG85_NEMVE Predicted protein OS=Nemato... [more]
gnl|BL_ORD_ID|234779981.042e-4949.60tr|A0A210QNZ2|A0A210QNZ2_MIZYE Uncharacterized pro... [more]
gnl|BL_ORD_ID|1751902090.000e+040.21tr|A0A151NDD8|A0A151NDD8_ALLMI Cilia-and flagella-... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:zfos-223e1.20.000e+038.15cilia and flagella associated protein 61 [Source:N... [more]
si:zfos-223e1.20.000e+038.48cilia and flagella associated protein 61 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006807.10.000e+043.89pep scaffold:Pmarinus_7.0:GL482520:855:11431:1 gen... [more]
ENSPMAT00000000113.13.931e-3135.03pep scaffold:Pmarinus_7.0:GL477060:118666:121010:1... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372680.000e+043.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CFAP618.497e-16034.23cilia and flagella associated protein 61 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 61 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000059955.10.000e+099.66SMESG000059955.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000512 ID=SMED30000512|Name=cilia- and flagella-associated protein 61|organism=Schmidtea mediterranea sexual|type=transcript|length=3735bp
CCGATCTCTCGATTTTAAAAATTTTAATTATAATTTAAATAAAAGATTTT
AATATGTATGCAAGACGAACCGAGTCACTTGATGCAGTTGAAATAGAAAA
GTTAATTAATAGTAATTCAATTTATATATTTGGCAAACCAAATTTAATCA
ATATAATCGAAAAAGCATTATTGTCTGTAACATTGACCTCAAAGACTGGT
GAAATCGTTGGTTATGCTTCATTTTATGATTATCCAAACATAGCAGAAAT
TGATACATCAAGTGACTGGAATGAAATAGTTAAACTTAAAGAATGTCCAT
TAGCAAATCCGCTGAACTCGTTATTTATGCACTATTTTCTCTCGAAGCCT
GAAGTAGAATCAAATATTTTAATGGAAATTGTTAATACCGTTTTTAATAC
TGCATCGAACATTCATTACATTTTCATCAACACGGATAAGGGTAAAATAC
CAGAAAATTTCGGCACTCAATTTACTCAAATAAAATCCATTACCGATTAT
AAAAATTGGTTCATTTTAAAAAGAGAGGCTTATATGCCAACATTATATAT
TCGAGCGGCTAAACAAGAAGACATGGATGATCTTATGCCGATTTTTAATG
CTCAAAGCACAATTTTGAAGGATATTTATGGGGAATTTTATCTCGCAGAA
ATGGTCGATGCTCAGAATGATCAGACAAAATGTTTGGTTGCAGAAGTAGG
AGGCTTTGCAGTTGGGTTTATATCAGTCACTACTGATATTAATATCGACC
TTCTCAATTATGGGTTTTACCTTGAAGCATTTGAAGGCTTCAAAAAGCCA
GTTCAGACTGTTAATGAAGAAAACATTGAGCAACTTGCTAAGAAGCCTTC
CAATGATTCGCAAACTAGTTCCACTGAGCATTCCGTCCCAGTTGTAGTTC
ACGAAGAAAATATTGAAACAAGCTTATCGGAAACGTCAACGGAGAAATCA
ATCAGTTTCCATAATGCTTTATTTAGATTTCCTTCAAATGCATCAATCAG
AAGTGGACTGAATGACATCCCTAATAATTTTGAATTCCCGGGAGAATCCA
ATGCAATAATCATTCAGCTATTTGCGATCAATGAGGCCTATGAGATGAGG
TCAATTGACTTTCTTCAAAACGTTTTTGATTTATTTCCGAATAGAGATTA
CCTTCTTATTACTGTTCCTTTTCTCGTTCCTGAATTCACTCTTTTGGAAA
ATTTTGTGAGAATTTCTCCTCGGCCAGGAATTATTCTTCCTCATGAATTG
TATTGTTTTCACAAAGGAAGCTTAATCAGCAATTTCAAAATTCGTCAAGC
TTGTAAGAAGGATCAAGAAGAAATACAATACATGATAATTAACATGAAGC
TGAGCCGAAACATCCTAAATGATTTGGAACAATTCCATCTGGCTCGTCGA
TTCGATACTGGAGTAAGTCTCTTTGCGTATGTCGCGGAATGCATGAACAA
AATTGTCGGCGTAATGGTCATGAAACAAGAGGAGGATATCGAATATATTA
GATCCCACTACAACATTGAGGATTTCATTTATTTTACCCATCATTTAAGA
AGTGAACATGGACATATAAAACATTTTGCCATAAACCCAATATTCAGAAG
ATTATCGAAACTTTTCCTTAAAGAGTGCATGCGAAAATCTCGAAAGACAA
GTGTATATTATCCAGTTTACAAACCATGGGCTTCTCAAAAGTTGCTCAAT
GAGCACAGTTTGGTAACAAATCTTCAAGACCTTGTACCTATTCGACCTAG
AAGACAAATTTTATACGATATTCAAAAATTGGAAGGTAATGCACCAACAG
AACGAATCCTCCAAGTTCAGGAAGGGTATTGTTTAACGCATTTTAATAGA
AAGTTGGCAATGGAACCAAAAGTTACAATTAATACAAGAATTGTAGTGGT
CGGGGCCAGCACTACCGGTCTGAGTTTCCTAGAATCTCTCACTTTTAGTC
CACACTTGAAGTTCAATAATTTATTTCTCCTCAGTCCCAATGGATTACCC
GATAATCATCCCACTGATGAATTGATTGAGCAATTAATGGGGAAAGACTT
TGATTTTTCCAAAAAGAAATTAGAATTGTCTGCCCTTCGACTGCAAGTGC
ATGTAGTAAAAGGATACATGACAGCGATTGACAGGAAGAAAAAGTTAATC
AGTATAAATGGAAAATATTTACTTCCCTATGACCATATGATAATTGCAAC
TGGAATGCAATACACGATTCCGTGTCCTACTGAAGCTAAGATTAAAAACT
TTCCAACGACAAAAGAATCACAAAATAAACCAGATAGGCGTTATTCAGAA
TTGATGTTTAAAAAGCATATGGAAAAGATTGTCCCAGATAACCTCATGGT
TGTTAATGATCCTTTTGGTGCTTTTAAACTTTTGGAATTTGTTAGACATA
ATTTGATGTTGAACGAATCAAAAATTATTATATATGGCCACTCATTTGAA
TCGTATTGTTGCCTGCACACTATTCTGTCTATGGGTATAATGGGATACAG
AATCCATTTTGTCAAGCCACCAGTTGATGAAGAGGTTTTCCCGCTGAATG
ATCCAGTAGTGGAAGAAGCAGTGTATAAAACTCTCGATGAAGCTGGAGTT
CATATACACGATAACTACTGCGTAGCTCAATTCAATGATTCAGACGAGGT
CCCTAATTGGATTTCATCTGTTTCATTTACTACACATGGCCCTCCTTTGA
GACTCGAATGTGAGCTTTTTGTCAGCTATTACAAGAAGGTAGTCAATTAT
TCTGCCTTCCGAGCGATGAACGATTCATGTTTGGTATTTGATGCTCGGTT
GGTAATAGATACGTTTTTCCATACAAATGACTTATCTATTCGGGCTGCTG
GACCTGTCACAAAATTCAAACGTCGTTATTACAACGAGCAATGGAGCCAT
GCAAGATTTAACAGCAGAGTAGTTGGAGAAGAGCTTTCAAAAGTCTTTCT
TCGGTTGTTCGATCCGACATTAGTTCCAGTTGTTACTCCTCCTGTTGAAG
AAGTTCCATTGATACCTATATACTATGATTCTATTCTCAAAAGTTGTATC
CTGCCAGGAGGACATCATTATCTTAGTGTTTCCAGACCGAGTCTCGACAT
TCCGTTATCAACTTTAACCAATCAACCTAACTATGGTTCCGTGCTAACTA
CGGGGGTGCCGTATTGCCAAGAAGGATATTTTAGATTACACCTTAATCAA
TATAAGAAGGTAGAAACTATCACATGCCTCAGGAAAAAAGCGTATCCTAT
TGAAAATTATGTCCAATTGTACGGAGTTCATGAGAGGGCCCTCAATAATC
TCGAGTCCAGATTTAATGAAAATCTAATCAAAGACTTATTTGAATTCTTC
GATGATACGTGGGCTATGGCATTTTACCATGATCGCTTTAGGGATTTGAA
GGAGGAAATAAAGGAACTATTAATGACAAGATCTTCTCCATGCAATGCAT
CATTTGAGGAAACTGTAAGGAATATGATGGTGGAAGGCGTGGAGTTAACT
CGAGAGCAAAGGAAAGAATTGATGGACGAATTCAGAAATAGCAATGCTAA
ATCGACAGTAGACCAGCGGTTGATCAGTTTCATAGCGTACAATTACTACC
ACCTGCCGATGTATGCCAAGCCCGATATGGTATAGGATACTAATGCAACA
GGTCATATGCTATTAGCAAGAAATTTTATCTAAGATGTGATTATAATAAA
CGATCATTGTTTATTTTGATAAATTAAGATCGGAA
back to top

protein sequence of SMED30000512-orf-1

>SMED30000512-orf-1 ID=SMED30000512-orf-1|Name=SMED30000512-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1194bp
MYARRTESLDAVEIEKLINSNSIYIFGKPNLINIIEKALLSVTLTSKTGE
IVGYASFYDYPNIAEIDTSSDWNEIVKLKECPLANPLNSLFMHYFLSKPE
VESNILMEIVNTVFNTASNIHYIFINTDKGKIPENFGTQFTQIKSITDYK
NWFILKREAYMPTLYIRAAKQEDMDDLMPIFNAQSTILKDIYGEFYLAEM
VDAQNDQTKCLVAEVGGFAVGFISVTTDINIDLLNYGFYLEAFEGFKKPV
QTVNEENIEQLAKKPSNDSQTSSTEHSVPVVVHEENIETSLSETSTEKSI
SFHNALFRFPSNASIRSGLNDIPNNFEFPGESNAIIIQLFAINEAYEMRS
IDFLQNVFDLFPNRDYLLITVPFLVPEFTLLENFVRISPRPGIILPHELY
CFHKGSLISNFKIRQACKKDQEEIQYMIINMKLSRNILNDLEQFHLARRF
DTGVSLFAYVAECMNKIVGVMVMKQEEDIEYIRSHYNIEDFIYFTHHLRS
EHGHIKHFAINPIFRRLSKLFLKECMRKSRKTSVYYPVYKPWASQKLLNE
HSLVTNLQDLVPIRPRRQILYDIQKLEGNAPTERILQVQEGYCLTHFNRK
LAMEPKVTINTRIVVVGASTTGLSFLESLTFSPHLKFNNLFLLSPNGLPD
NHPTDELIEQLMGKDFDFSKKKLELSALRLQVHVVKGYMTAIDRKKKLIS
INGKYLLPYDHMIIATGMQYTIPCPTEAKIKNFPTTKESQNKPDRRYSEL
MFKKHMEKIVPDNLMVVNDPFGAFKLLEFVRHNLMLNESKIIIYGHSFES
YCCLHTILSMGIMGYRIHFVKPPVDEEVFPLNDPVVEEAVYKTLDEAGVH
IHDNYCVAQFNDSDEVPNWISSVSFTTHGPPLRLECELFVSYYKKVVNYS
AFRAMNDSCLVFDARLVIDTFFHTNDLSIRAAGPVTKFKRRYYNEQWSHA
RFNSRVVGEELSKVFLRLFDPTLVPVVTPPVEEVPLIPIYYDSILKSCIL
PGGHHYLSVSRPSLDIPLSTLTNQPNYGSVLTTGVPYCQEGYFRLHLNQY
KKVETITCLRKKAYPIENYVQLYGVHERALNNLESRFNENLIKDLFEFFD
DTWAMAFYHDRFRDLKEEIKELLMTRSSPCNASFEETVRNMMVEGVELTR
EQRKELMDEFRNSNAKSTVDQRLISFIAYNYYHLPMYAKPDMV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR038884CFAP61
IPR016181Acyl_CoA_acyltransferase
IPR023753FAD/NAD-binding_dom
IPR032151CFAP61_N
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1146..1166
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 400..538
e-value: 1.4E-5
score: 27.2
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 612..725
e-value: 8.5E-9
score: 37.2
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 726..740
e-value: 8.5E-9
score: 37.2
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 610..961
IPR032151Cilia- and flagella-associated protein 61, N-terminal domainPFAMPF16092DUF4821coord: 3..248
e-value: 2.3E-66
score: 224.1
coord: 333..491
e-value: 4.5E-7
score: 29.8
IPR038884Cilia- and flagella-associated protein 61PANTHERPTHR21178FAMILY NOT NAMEDcoord: 3..1192