Transposase

Overview
NameTransposase
Smed IDSMED30000504
Length (bp)7038
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposase (SMED30000504) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposase (SMED30000504) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposase (SMED30000504) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposase (SMED30000504) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000504

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000504 SmedASXL_072468SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000504 SmedASXL_072468SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposase vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 149.058 bits (375), Expect = 2.048e-46
Identity = 77/196 (39.29%), Postives = 119/196 (60.71%), Query Frame = 3
Query: 1224 FLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKR---PDRRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSP--APSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            FL RIVT DEKW LY N +   +WL+ E+      K  LHP+K ++ +W    G+IHY  L   +T+ +E Y Q++  +N  +Q+ +    +R+  +LL HDNARPH+A  T + +  LG++VLPHPPYSP   P+++H+F+ L+N L G  F+N  +      +F E+   DFY  GI +L+ R ++ ++ NG Y
Sbjct:  349 FLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILL-HDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 543          

HSP 2 Score: 60.4622 bits (145), Expect = 2.048e-46
Identity = 36/105 (34.29%), Postives = 50/105 (47.62%), Query Frame = 2
Query:  908 EHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTR----EFNCSNSTVAKYLHSMGKV 1210
            +  R   LF F     A +  R I   +G G   +RT + WF K   G+  L D   SGRP   D + L  ++  D   TTR    E N ++STV ++L  +GKV
Sbjct:  210 KQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKV 314          
BLAST of Transposase vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 149.058 bits (375), Expect = 2.238e-46
Identity = 77/196 (39.29%), Postives = 119/196 (60.71%), Query Frame = 3
Query: 1224 FLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKR---PDRRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSP--APSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            FL RIVT DEKW LY N +   +WL+ E+      K  LHP+K ++ +W    G+IHY  L   +T+ +E Y Q++  +N  +Q+ +    +R+  +LL HDNARPH+A  T + +  LG++VLPHPPYSP   P+++H+F+ L+N L G  F+N  +      +F E+   DFY  GI +L+ R ++ ++ NG Y
Sbjct:  488 FLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILL-HDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 682          

HSP 2 Score: 60.077 bits (144), Expect = 2.238e-46
Identity = 36/105 (34.29%), Postives = 50/105 (47.62%), Query Frame = 2
Query:  908 EHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTR----EFNCSNSTVAKYLHSMGKV 1210
            +  R   LF F     A +  R I   +G G   +RT + WF K   G+  L D   SGRP   D + L  ++  D   TTR    E N ++STV ++L  +GKV
Sbjct:  349 KQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKV 453          
BLAST of Transposase vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 56.9954 bits (136), Expect = 6.465e-7
Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = 1
Query: 5185 LFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            LF STY CET FST+   KTKHR+ L+ +H+   LR+A S+ +P+ +KL    Q H+S
Sbjct: 1270 LFPSTYLCETGFSTLSVIKTKHRNSLN-IHYP--LRVALSSIQPRLDKLTSKKQAHLS 1324          
BLAST of Transposase vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 56.6102 bits (135), Expect = 6.903e-7
Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = 1
Query: 5185 LFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            LF STY CET FST+   KTKHR+ L+ +H+   LR+A S+ +P+ +KL    Q H+S
Sbjct: 1119 LFPSTYLCETGFSTLSVIKTKHRNSLN-IHYP--LRVALSSIQPRLDKLTSKKQAHLS 1173          
BLAST of Transposase vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 53.5286 bits (127), Expect = 8.990e-7
Identity = 33/99 (33.33%), Postives = 46/99 (46.46%), Query Frame = 2
Query:  908 EHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTR----EFNCSNSTVAKYL 1192
            +  R   LF F     A +  R I   +G G   +RT + WF K   G+  L D   SGRP   D + L  ++  D   TTR    E N ++STV ++L
Sbjct:  113 KQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHL 211          
BLAST of Transposase vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.403e-11
Identity = 30/70 (42.86%), Postives = 43/70 (61.43%), Query Frame = 1
Query: 5149 PAMSHSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            P +  ++    S+F STY CE  FST+K  K+KHRS L+  H    LR+AT+ YEP  +K+ +  +C VS
Sbjct:  546 PNVKQAALKLLSMFGSTYVCELLFSTLKLVKSKHRSVLTDTHVKELLRVATTEYEPDLKKIVETKECQVS 615          
BLAST of Transposase vs. UniProt/SwissProt
Match: sp|Q7JQ07|MOS1T_DROMA (Mariner Mos1 transposase OS=Drosophila mauritiana OX=7226 GN=mariner\T PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 8.344e-54
Identity = 89/202 (44.06%), Postives = 134/202 (66.34%), Query Frame = 3
Query: 1206 RFLKQRFLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKRPD---RRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSP--APSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            R+ ++ FL+RIVTGDEKW  +++ K +K +++P Q AT  A+ +   +KT+LCVW D  G+I+YELL R +TVN   Y QQ+  LN  +Q+KRP+   R++ V+  HDNA  H A   ++ ++TL W+VLPH  YSP  APSD+HLF S+ +AL    F++   ++ WL ++F     +FY RGI KL ER E+ + ++G+Y
Sbjct:  142 RYKRKSFLHRIVTGDEKWIFFVSPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKY 343          

HSP 2 Score: 57.7658 bits (138), Expect = 8.344e-54
Identity = 33/113 (29.20%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  884 MECQVNKNEHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTR----EFNCSNSTVAKYLHSMGKV 1210
            M   V   E  R  L+F F+ + TA ++ R +   +GE     +    WF +  SG+FD+ D      P  +++  L  LL ED +QT +    +   S   V+  L  MGK+
Sbjct:    1 MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKI 113          
BLAST of Transposase vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 9.975e-46
Identity = 77/196 (39.29%), Postives = 119/196 (60.71%), Query Frame = 3
Query: 1224 FLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKR---PDRRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSP--APSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            FL RIVT DEKW LY N +   +WL+ E+      K  LHP+K ++ +W    G+IHY  L   +T+ +E Y Q++  +N  +Q+ +    +R+  +LL HDNARPH+A  T + +  LG++VLPHPPYSP   P+++H+F+ L+N L G  F+N  +      +F E+   DFY  GI +L+ R ++ ++ NG Y
Sbjct:  488 FLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILL-HDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY 682          

HSP 2 Score: 60.077 bits (144), Expect = 9.975e-46
Identity = 36/105 (34.29%), Postives = 50/105 (47.62%), Query Frame = 2
Query:  908 EHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTR----EFNCSNSTVAKYLHSMGKV 1210
            +  R   LF F     A +  R I   +G G   +RT + WF K   G+  L D   SGRP   D + L  ++  D   TTR    E N ++STV ++L  +GKV
Sbjct:  349 KQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKV 453          
BLAST of Transposase vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.105e-6
Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = 1
Query: 5185 LFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            LF STY CET FST+   KTKHR+ L+ +H+   LR+A S+ +P+ +KL    Q H+S
Sbjct: 1270 LFPSTYLCETGFSTLSVIKTKHRNSLN-IHYP--LRVALSSIQPRLDKLTSKKQAHLS 1324          
BLAST of Transposase vs. TrEMBL
Match: A0A085NKX2 (HTH_48 domain-containing protein OS=Trichuris suis OX=68888 GN=M514_17720 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 2.364e-76
Identity = 107/193 (55.44%), Postives = 137/193 (70.98%), Query Frame = 3
Query: 1224 FLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKRPDRRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSPA--PSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            F  +I+TGDEKWCLY+NMK RK+WL+P +  TPRAK  LH RK +  VW D EG+I +ELL +NQT+ A +YV+Q+ RL + +QQKR  +++ ++LQHDNA P  A ITK A+Q L W+VL H  YSP   PSD+HLF SL+  L G SFNND  L+ WL DFF + P  FYR GIE+L  R EEV+ + GEY
Sbjct:  156 FFNQIITGDEKWCLYVNMKQRKEWLSPGKDPTPRAKPKLHERKIMPSVWWDCEGVIDFELLPKNQTITATIYVEQLRRLASAVQQKRQKKQHAIMLQHDNAGPRTAIITKSAIQELVWEVLHHSGYSPGLDPSDYHLFHSLAVNLRGVSFNNDENLQKWLSDFFSSKPPHFYRLGIEQLASRWEEVVNSEGEY 348          

HSP 2 Score: 95.5153 bits (236), Expect = 2.364e-76
Identity = 54/108 (50.00%), Postives = 66/108 (61.11%), Query Frame = 2
Query:  884 MECQVNKNEHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRT-ARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTREF----NCSNSTVAKYL 1192
            M CQV+K EH RH LLF  N   +A  AA +I AV+ E AI+ R  AR WF++   GNFDL D   SGRP  FDEE LN L+ E+  Q+TRE      CS+ TV+  L
Sbjct:   36 MGCQVDKKEHLRHVLLFLSNGGLSALAAAGKIQAVFEEEAISDRVVARKWFSRFREGNFDLSDSVRSGRPSDFDEEKLNALVHENPRQSTRELAQKIGCSHVTVSSLL 143          
BLAST of Transposase vs. TrEMBL
Match: A0A1I7X1C4 (HTH_48 domain-containing protein OS=Heterorhabditis bacteriophora OX=37862 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 5.248e-75
Identity = 86/116 (74.14%), Postives = 100/116 (86.21%), Query Frame = 3
Query: 1215 KQRFLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKRPDRRNLVLLQHDNARPHIAYITKEAV 1562
            KQRFLYRIVTGD+KWCLYINMK RK+WL+  +QA PR KQD+HPRKT+  VW DWEGI+HYELL RNQTVNAELYVQQM RLN  IQ+KRP R++ VLL H++ARPHIA +TKEA+
Sbjct:  145 KQRFLYRIVTGDKKWCLYINMKQRKEWLSSGKQAIPRVKQDVHPRKTMFRVWWDWEGILHYELLERNQTVNAELYVQQMERLNTAIQEKRPSRQHGVLLLHNSARPHIANMTKEAI 260          

HSP 2 Score: 131.724 bits (330), Expect = 5.248e-75
Identity = 68/112 (60.71%), Postives = 81/112 (72.32%), Query Frame = 2
Query:  884 MECQVNKNEHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTREF----NCSNSTVAKYLHSMGK 1207
            M+CQ     HFRH LLFAFN+ + A KAA +ICAVYGEGAIA+RTARDW+AK  +GNFDL+D   SGR V FD E LNQL  E++ QTT E      CSN+ + K+LHSMGK
Sbjct:    1 MKCQ-----HFRHLLLFAFNQGSKAAKAACDICAVYGEGAIAERTARDWYAKFKNGNFDLKDACCSGRSVEFDGEQLNQLSHENSRQTTMELAEKMGCSNTAIEKHLHSMGK 107          
BLAST of Transposase vs. TrEMBL
Match: A0A1I7WUB6 (Uncharacterized protein OS=Heterorhabditis bacteriophora OX=37862 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.353e-70
Identity = 117/160 (73.12%), Postives = 136/160 (85.00%), Query Frame = 3
Query: 1215 KQRFLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKRPDRRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSPA--PSDFHLFRSLSNALHGASFNNDIELR 1688
            KQRFLYRIVTGD+KWCLYINMK RK+WL+  +QA PR KQDLHPRKT+ C+W DWEG+IHYELL RNQTVNAELYVQQM RLN  I++K P+R++ VLL +DNARPHIA +TKE +QT GW+VLPHPPYS A  P+DFHLFRSLSN + G SFN D+ELR
Sbjct:   67 KQRFLYRIVTGDKKWCLYINMKQRKEWLSSGKQAIPRVKQDLHPRKTMSCIWWDWEGLIHYELLERNQTVNAELYVQQMERLNTAIKEKGPNRQHGVLLLNDNARPHIANMTKEVIQTHGWEVLPHPPYSLALSPTDFHLFRSLSNDMRGVSFNTDVELR 226          
BLAST of Transposase vs. TrEMBL
Match: A0A085M9S5 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M513_05238 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.060e-69
Identity = 114/193 (59.07%), Postives = 145/193 (75.13%), Query Frame = 3
Query: 1224 FLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKRPDRRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSP--APSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            F  +I+TGDEKWCLY+NMK RK+WL+P +  TPRAK  LH RKT+L  W D EG+IH++LL +NQT+ A +YV+Q+ RL + +QQKR  +++ ++LQHDNARPH A ITK A+Q LGWDVLPHP YSP  APS +HLFRSL+  L G SFNND + + WL DFF   P  FYR+GIE+L  R EEV+ + GEY
Sbjct:   41 FFSQIITGDEKWCLYVNMKQRKEWLSPGKDPTPRAKPKLHQRKTMLSAWWDCEGVIHFDLLPKNQTITATIYVEQLRRLASAVQQKRQKKQHAIMLQHDNARPHTAIITKTAIQELGWDVLPHPGYSPDLAPSVYHLFRSLAVNLRGVSFNNDEDFQKWLSDFFSPKPPHFYRKGIEQLACRWEEVVNSEGEY 233          
BLAST of Transposase vs. TrEMBL
Match: Q8I8E6 (Ccmar2 transposase OS=Ceratitis capitata OX=7213 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.367e-69
Identity = 92/195 (47.18%), Postives = 140/195 (71.79%), Query Frame = 3
Query: 1224 FLYRIVTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKRPD--RRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSP--APSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            FL R++TGDEKW +Y N+K ++ W  P +     +K D+H +K LL VW D++GI+++ELL  N+T+N+++Y++Q+ +LNN +++KRP+   R  ++  HDNARPH +  T++ +  LGWDVLPHPPYSP  APSD+ LFRSL N+L+G +FNND +++++L  FF      FY RGI  L ER +++I+ NG+Y
Sbjct:  145 FLKRLITGDEKWVVYNNIKRKRSWSRPGEPTQTTSKADIHQKKVLLSVWWDYKGIVYFELLPPNRTINSDVYIEQLTKLNNAVEEKRPELTNRKSIVFHHDNARPHTSLATRQKLLELGWDVLPHPPYSPDLAPSDYFLFRSLQNSLNGKNFNNDDDVKSYLIQFFANKNQKFYERGIMMLPERWQKIIDQNGQY 339          

HSP 2 Score: 93.5893 bits (231), Expect = 2.367e-69
Identity = 45/117 (38.46%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  899 NKNEHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWFAKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTRE----FNCSNSTVAKYLHSMGKVPQAKIPLSH 1237
            N+ EHFRH LLF F +  TA++A +++CAVYG+ A+ +R  ++WFAK  SG+F L+D   SGRPV  D+  +  ++  D   TTRE     + S++ +  +L  +G V +    + H
Sbjct:    3 NQKEHFRHILLFYFRKGKTASQAHKKLCAVYGDEALKERQCQNWFAKFRSGDFSLKDEKRSGRPVEVDDALIKAIIDSDRHSTTREIAEKLHVSHTCIENHLKQLGYVQKLDTWVPH 119          
BLAST of Transposase vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 5.321e-10
Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 1
Query: 5149 PAMSHSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQ 5346
            P++S  +    + F STYFCE +F  MK  K+K+R+CL+  H T C+R+A S Y P Y+  A ++Q
Sbjct:  525 PSLSACALKVKAFFGSTYFCEMSFPQMKIIKSKYRTCLTDAHLTDCVRLAVSNYTPDYKAPADSVQ 590          
BLAST of Transposase vs. Ensembl Cavefish
Match: ENSAMXT00000037411.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:18144228:18145385:-1 gene:ENSAMXG00000033115.1 transcript:ENSAMXT00000037411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 5.979e-9
Identity = 31/70 (44.29%), Postives = 38/70 (54.29%), Query Frame = 1
Query: 5149 PAMSHSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            P +   +   ++LF STY CE TFS MK  KT  RS L+  H   CLR+A +  EP  E L   MQ H S
Sbjct:  315 PNIKKHAMKMSTLFGSTYICEQTFSHMKLLKTPMRSRLTDEHLHQCLRLAVTRMEPDIELLPSQMQAHSS 384          
BLAST of Transposase vs. Ensembl Cavefish
Match: ENSAMXT00000050151.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:23214084:23215952:-1 gene:ENSAMXG00000029603.1 transcript:ENSAMXT00000050151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.288e-6
Identity = 25/70 (35.71%), Postives = 41/70 (58.57%), Query Frame = 1
Query: 5149 PAMSHSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            P +   +    ++F STY CE  FSTM   KTK+RS L+  H   C+R+A ++++P+++ LA   +   S
Sbjct:  552 PDLKKVALFILTMFGSTYSCEAAFSTMNIIKTKYRSKLTNEHLHMCMRMALTSFKPRFKMLAGQAKAQFS 621          
BLAST of Transposase vs. Ensembl Cavefish
Match: ENSAMXT00000031692.1 (pep primary_assembly:Astyanax_mexicanus-2.0:7:21501471:21504188:-1 gene:ENSAMXG00000043766.1 transcript:ENSAMXT00000031692.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 2.482e-6
Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 1
Query: 5149 PAMSHSSNIFN--SLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQ 5346
            P   H S      S+F STY CE  FS MK+  +  RSCL+  +  +CL++  + Y+PQ  KL+K  Q
Sbjct:  329 PVQQHGSIALALLSVFGSTYLCEQVFSHMKSVLSPIRSCLTTDNSESCLQLKVTNYKPQIRKLSKERQ 396          
BLAST of Transposase vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 52.7582 bits (125), Expect = 4.697e-6
Identity = 27/67 (40.30%), Postives = 38/67 (56.72%), Query Frame = 1
Query: 5161 HSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATS-TYEPQYEKLAKNMQCHVS 5358
            H++ +  S+F STY CE  FS M   K KHRSCL+  +  A LRIA++   +P  + L    +C  S
Sbjct:  531 HAARVL-SMFGSTYLCEQMFSIMNLNKNKHRSCLTDDNLHAVLRIASAQDLKPDIDTLVMGKRCQTS 596          
BLAST of Transposase vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 3.748e-10
Identity = 29/57 (50.88%), Postives = 33/57 (57.89%), Query Frame = 1
Query: 5188 FNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            F STY CE+ FS M   K KHR+CL+  H    LRIA S Y P Y  L  +MQC  S
Sbjct:  558 FGSTYLCESAFSNMNFIKNKHRTCLTDAHLQDSLRIAVSNYSPDYNALVSSMQCQTS 614          
BLAST of Transposase vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.416e-8
Identity = 28/59 (47.46%), Postives = 34/59 (57.63%), Query Frame = 1
Query: 5182 SLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNMQCHVS 5358
            SLF STY CE+ FS M   K KHR+ L+  H    L +A S+Y P Y  L  +MQC  S
Sbjct:  556 SLFGSTYLCESAFSDMNFIKNKHRTRLTDAHLRDSLTVAVSSYTPDYNTLVNSMQCQSS 614          
BLAST of Transposase vs. Ensembl Medaka
Match: ENSORLT00000027093.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111947639])

HSP 1 Score: 55.4546 bits (132), Expect = 6.183e-7
Identity = 27/54 (50.00%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 5161 HSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQY 5322
            H+  I   LF STY CE  FS MK  K+KHRS ++  H +A LRIATS  +P +
Sbjct:  517 HAQKIL-VLFGSTYHCEQAFSVMKFNKSKHRSSVTDDHLSAVLRIATSDIQPDF 569          
BLAST of Transposase vs. Ensembl Medaka
Match: ENSORLT00000038650.1 (pep primary_assembly:ASM223467v1:1:16225402:16226668:1 gene:ENSORLG00000028538.1 transcript:ENSORLT00000038650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 6.959e-7
Identity = 28/71 (39.44%), Postives = 38/71 (53.52%), Query Frame = 1
Query: 5149 PAMSHSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNM-QCHVS 5358
            P M  ++ +  SLF STY CE TFS M   K K R  L+  H+   L ++ S  +P  + L K+  Q HVS
Sbjct:  144 PQMRKNAQVMLSLFGSTYMCEQTFSLMNLNKIKLRGTLTDSHWQDILTLSVSKLQPNIQSLMKSKDQLHVS 214          
BLAST of Transposase vs. Ensembl Medaka
Match: ENSORLT00000029843.1 (pep primary_assembly:ASM223467v1:2:5236691:5237599:1 gene:ENSORLG00000028650.1 transcript:ENSORLT00000029843.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 8.066e-7
Identity = 28/71 (39.44%), Postives = 37/71 (52.11%), Query Frame = 1
Query: 5149 PAMSHSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQYEKLAKNM-QCHVS 5358
            P M  ++ +  SLF STY CE TFS M   K K R  L+  H    L ++ S  +P  + L K+  Q HVS
Sbjct:  132 PQMRKNAQVMLSLFGSTYICEQTFSLMNLNKIKLRGTLTDSHLQDILTLSVSKLQPNIQSLIKSKDQLHVS 202          
BLAST of Transposase vs. Planmine SMEST
Match: SMESG000049199.1 (SMESG000049199.1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.866e-18
Identity = 53/141 (37.59%), Postives = 79/141 (56.03%), Query Frame = 3
Query: 1401 LL*RNQTVNAELYVQQMHRLNNVIQQKRPDRR-------NLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPPYSP--APSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIEKLVER*EEVIENNGEY 1796
            +L +  T+ A++Y +Q+ RL   IQ KR  RR        +  LQ+ NARPH A  + + +  +G+ VL HPPYSP  A SDF+LF  L +++ G  FN D E++  L   F + P  F+  GI KL +R    + ++G Y
Sbjct:    3 ILPQGTTITADVYYEQLSRLVTAIQHKR--RRLLGGGFHKIHYLQY-NARPHTAAKSVQKLIDIGFTVLLHPPYSPDLATSDFYLFSPLKSSIRGRDFNGDNEIQVVLDAGFNSKPRSFFADGIRKLPDRWRRCVLHSGAY 140          
BLAST of Transposase vs. Planmine SMEST
Match: SMESG000003282.1 (SMESG000003282.1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.513e-12
Identity = 28/52 (53.85%), Postives = 31/52 (59.62%), Query Frame = 1
Query: 6490 DELKWLDGACNCPEFFKTFMCKHVFGMVIRLNYCKPHPAAKNFKIGEKRRDR 6645
            D+  W DG CNCP FFK  +CKHV  + IRL YCK    AKN  IG  R D 
Sbjct:  280 DKANWADGQCNCPAFFKKLICKHVVCISIRLKYCKVPALAKNTSIGNIRLDE 331          

HSP 2 Score: 33.4982 bits (75), Expect = 1.513e-12
Identity = 19/40 (47.50%), Postives = 26/40 (65.00%), Query Frame = 2
Query: 6365 YNIPAGDETKITQVEIDIVKKMKWYSFDKY-KKAVNVWLV 6481
            Y + A D T ITQ +ID V+KM W  FD++ K+A  VW +
Sbjct:  237 YYVSASDAT-ITQEDIDKVEKMHWTIFDQFTKRAFTVWRI 275          
BLAST of Transposase vs. Planmine SMEST
Match: SMESG000003282.1 (SMESG000003282.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.749e-12
Identity = 28/52 (53.85%), Postives = 31/52 (59.62%), Query Frame = 1
Query: 6490 DELKWLDGACNCPEFFKTFMCKHVFGMVIRLNYCKPHPAAKNFKIGEKRRDR 6645
            D+  W DG CNCP FFK  +CKHV  + IRL YCK    AKN  IG  R D 
Sbjct:  300 DKANWADGQCNCPAFFKKLICKHVVCISIRLKYCKVPALAKNTSIGNIRLDE 351          

HSP 2 Score: 33.4982 bits (75), Expect = 1.749e-12
Identity = 19/42 (45.24%), Postives = 26/42 (61.90%), Query Frame = 2
Query: 6359 VQYNIPAGDETKITQVEIDIVKKMKWYSFDKY-KKAVNVWLV 6481
              Y + A D T ITQ +ID V+KM W  FD++ K+A  VW +
Sbjct:  255 TNYYVSASDAT-ITQEDIDKVEKMHWTIFDQFTKRAFTVWRI 295          
BLAST of Transposase vs. Planmine SMEST
Match: SMESG000070487.1 (SMESG000070487.1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.480e-12
Identity = 36/101 (35.64%), Postives = 58/101 (57.43%), Query Frame = 3
Query: 1239 VTGDEKWCLYINMK*RKKWLNPEQQATPRAKQDLHPRKTLLCVWLDWEGIIHYELL*RNQTVNAELYVQQMHRLNNVIQQKRPD--RRNLVLLQHDNARPH 1535
            VT D+KW  ++N    K+W+   ++  P   QD   +K +L  W +++G++HY  +  +  VN ELY +Q+ R  N+++ K P    RN VL+Q DNA  H
Sbjct:  633 VTCDDKWISFVNNNRLKQWVKHGEEPEPVIHQDRFGKKVMLSAWWNYQGVLHYGFIPGDHAVNVELYCEQLDRAYNILKVKYPALVNRNRVLMQFDNAPCH 733          
BLAST of Transposase vs. Planmine SMEST
Match: SMESG000009055.1 (SMESG000009055.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.090e-10
Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 1
Query: 5149 PAMSHSSNIFNSLFNSTYFCETTFSTMKAFKTKHRSCLSGVHFTACLRIATSTYEPQ 5319
            P +       ++ F STY CE+ FS+M   KTKHRSCL+  H  +CLRIA S+Y+P+
Sbjct:  784 PILRIVVGYMSAFFGSTYLCESAFSSMNVIKTKHRSCLTDGHLASCLRIAISSYDPK 840          
The following BLAST results are available for this feature:
BLAST of Transposase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SETMAR2.048e-4639.29SET domain and mariner transposase fusion gene [So... [more]
SETMAR2.238e-4639.29SET domain and mariner transposase fusion gene [So... [more]
ZBED96.465e-748.28zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED96.903e-748.28zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
SETMAR8.990e-733.33SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of Transposase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AL928808.17.403e-1142.86pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
back to top
BLAST of Transposase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q7JQ07|MOS1T_DROMA8.344e-5444.06Mariner Mos1 transposase OS=Drosophila mauritiana ... [more]
sp|Q53H47|SETMR_HUMAN9.975e-4639.29Histone-lysine N-methyltransferase SETMAR OS=Homo ... [more]
sp|Q6R2W3|SCND3_HUMAN3.105e-648.28SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
back to top
BLAST of Transposase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A085NKX22.364e-7655.44HTH_48 domain-containing protein OS=Trichuris suis... [more]
A0A1I7X1C45.248e-7574.14HTH_48 domain-containing protein OS=Heterorhabditi... [more]
A0A1I7WUB62.353e-7073.13Uncharacterized protein OS=Heterorhabditis bacteri... [more]
A0A085M9S52.060e-6959.07Uncharacterized protein OS=Trichuris suis OX=68888... [more]
Q8I8E62.367e-6947.18Ccmar2 transposase OS=Ceratitis capitata OX=7213 P... [more]
back to top
BLAST of Transposase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039226.15.321e-1042.42pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037411.15.979e-944.29pep primary_assembly:Astyanax_mexicanus-2.0:13:181... [more]
ENSAMXT00000050151.11.288e-635.71pep primary_assembly:Astyanax_mexicanus-2.0:17:232... [more]
ENSAMXT00000031692.12.482e-639.71pep primary_assembly:Astyanax_mexicanus-2.0:7:2150... [more]
ENSAMXT00000035253.14.697e-640.30general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of Transposase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033470.13.748e-1050.88pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000046355.12.416e-847.46pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
ENSORLT00000027093.16.183e-750.00general transcription factor II-I repeat domain-co... [more]
ENSORLT00000038650.16.959e-739.44pep primary_assembly:ASM223467v1:1:16225402:162266... [more]
ENSORLT00000029843.18.066e-739.44pep primary_assembly:ASM223467v1:2:5236691:5237599... [more]
back to top
BLAST of Transposase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049199.11.866e-1837.59SMESG000049199.1[more]
SMESG000003282.11.513e-1253.85SMESG000003282.1[more]
SMESG000003282.11.749e-1253.85SMESG000003282.1[more]
SMESG000070487.12.480e-1235.64SMESG000070487.1[more]
SMESG000009055.17.090e-1047.37SMESG000009055.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000504 ID=SMED30000504|Name=Transposase|organism=Schmidtea mediterranea sexual|type=transcript|length=7038bp
TTTTGTCCCCATGACATTTTGTCCGTGACATTTTGTCCTAGCACCGGCTA
AAATTTGTATAAATGATAATACTATTCCGGTAAAATGTCTTCGCTGCTAT
TTTTAGAATATTCTTAGCCTCTTTTTTCTAATTTTAACAAGATCGTTTTC
GAATTTTATATTGCATAAAATAAATTCATTTTCTTCAAAATTTATCAAAT
AAATCTAATAGTTTTTCATAATTCAATTTTATTTCAAGATCTTTCACTAG
CTTGGTGGACCACAAGGATTATTTTGCCTTATCAATTAATATTCAAGAAG
ATCGATCCTATTTAGAATTTATTTGAGTTTTGGTGTTGCTTACAGTAGGA
AATAGTTAACTTGACCTATAGGTATAAAATCAACAGTGTTAAATTTCATT
CAATTTGTATTGTTATTTATGGTTATGGCTCTAACACATGATATGATTTT
ATTTACATCCTCGAAATAACTCTATTCATTCCACAATTATTAGTTAAAGG
AGCGAAACAAGTGCCATGAAAATAGTTTATTGTGAGTTATTTTACCTCTA
TTCCTGCCATTTCTTTCTCAAATATATCTGATAATTGAATTTATTTTTCT
CAAGCATATACTGGAATCAATTGCTGGTAATATTTCTTCTTTAGCTATAC
GCATTGCAATATCAAGGCTGTTAACCTCATTTAATACATTTATATATTCC
ATATTTTGGGTATTATATACAATATTATTTTTAGATTACTTATTATTATT
CTTAAATTTATATTAGGTTGTTCGATAAGTTCCCGCCGTTTTGTTAAATT
CAAAATTGCGCGTTGAAAATAAAATGTTTTGGTATTTGGTTTTTTCAAAA
TACTTAAATTTTGTTTATTTTTAGAGCATTTAAATGGAGTGTCAAGTAAA
CAAAAACGAGCATTTCCGGCACTATCTTCTGTTTGCGTTTAATCGAAGGG
CTACAGCCACAAAAGCTGCCCGAGAGATTTGTGCTGTATATGGAGAAGGT
GCCATAGCTAAAAGGACCGCTCGTGATTGGTTTGCAAAGCTCAATAGTGG
CAATTTTGACCTCAGGGACGTACCTGGTTCCGGACGACCTGTTATGTTCG
ATGAAGAGTGTTTGAATCAACTTCTGCTTGAAGATGCGAGCCAAACAACC
AGGGAATTCAACTGCAGTAATTCAACTGTAGCAAAATATCTCCACTCAAT
GGGAAAGGTTCCTCAAGCAAAGATTCCTTTATCGCATCGTCACTGGCGAT
GAAAAATGGTGTCTCTATATCAACATGAAATAGCGCAAAAAATGGTTAAA
CCCAGAACAACAAGCGACTCCGCGAGCAAAACAAGATCTTCATCCTAGGA
AGACATTGTTGTGTGTCTGGTTGGACTGGGAAGGCATTATTCACTATGAA
TTGCTTTAACGGAACCAAACAGTGAACGCAGAGCTTTATGTTCAACAGAT
GCACCGCCTCAACAACGTAATTCAACAAAAACGTCCCGATCGACGAAATC
TAGTTCTTCTCCAACATGACAACGCCCGACCTCATATTGCCTATATAACC
AAGGAAGCTGTCCAAACGCTTGGCTGGGACGTGCTGCCACATCCTCCATA
TTCTCCGGCGCCTTCAGATTTCCACCTCTTCCGATCGCTTTCAAATGCTT
TACACGGCGCTTCATTCAATAATGATATCGAATTACGGGCTTGGTTGGGC
GACTTTTTCGAGACGTGTCCGGGTGACTTCTACCGAAGAGGCATCGAAAA
ACTTGTTGAACGCTGAGAGGAAGTCATAGAAAACAACGGAGAGTACATTA
TTGATTAAATTGTTATTTATAGTTGAAGAATTAAATTTTTAAAGAGTAAA
AAAAACGACGGGAACTTATCGAACAACCCAATATTTATTAATGCTTAAAA
AGAAATCTTACTGTAATAGTTAATTTAAAATTCACATTCATTTTCATCCA
TATAATTCTTTCTAAGAATATTATATACTTTTATTTTCATGCTTTAAAGC
ACTCCTATAACACTAAAGCTTCGACATTTAAGTACGACTCCTGGTCTTCA
CAATTCTCATCGAAATGTCCTTCATAAAATCCTGTAATTTATCGATCGGA
TCCCTGCATGTACATTTCATAATACTGATACTTGAATTGTTCTTGTTTAT
GATAATGTACACATTGCACACTTAAGTATTCATGTCGGCGTAGTTCGATT
TCTCTGCATTCCCAAGTTTTTCTGTCTTGATTTGTATTCTTCATGATTTG
AATCTCTCTTTGCTCATTGTTGTAACTTACCGTTCCGAGGAATTAGTAAA
CTGTTTTTCCATGTGTTTATACTAGTATTATGTTATACTAACTTATGCCA
AAATATTCTGTCACGCTGTGAAAGTGGATTTAATGAATCCAATAAATTTT
CAGAATGGCATTACACATCTACTTTCTAACTCATTTAATATAGATAGAAT
TACATTTATTTTAATTTTACCACTATAACATAAGATGTGTAATTTCATCA
CAACTCCGCATTTGTGTAATCGCGCATTATTTCACTTGTTTTGAACCAAA
CAATTCATTTTAATTTATTTCACCGATCCATTGGCTATTTTATTTCACTA
TCATTTCCATTTTATTATTTTCTGTCATTTTTCTATTGGGTTTGGTGATT
TAATTATTAATTGGATTTTGGTGCTTTGTATTTAAATTCGAGCAATAATC
CTTTCGAAATTTTTCAATATGGTTATTTTAACTTTTATGTTCTTTGAGCT
GAAATTTCGAATGCTTTTTTTCTCCTTTAACTATGTGAGTGCTTGCTATT
TCTTGTGTTATAATATTTTAATTATGTTTTATTGATCATCAGCGTGTTTT
ACTTAATAGTTCATCGTATATTTTAATCAAACTTGAAGCTGTTGCATGCT
TATGTTTTTTAGACAAGTTGAAACAATTTCCAATTTTTTAAAATTCTAAC
AGTAATTTTGAAATTAGTTGTTGGTTTGGAATACCATATTTAAATTCATG
TTCAAAGCGTCACAGATTTGAATATGTAAACAAAATATCCAAAACATCAA
TTGATAAAAAATTATAAGACTCCAACAATTATTTATTTTAACAGTAATAA
ATTTCATTTTATACAAATATTAAATTAAATTATAGTAATTTGTTTTAATT
TTTAATGTTTAATTTATTTTTGTGATTTGTATATAAAAATTATTATAATT
ATGTCTACAATAAAAGTAATGACCCATTTTTAATCATGTATTTTTCACCA
AATTGAGACAAATAATATTGTTATAACGATGGTTAAATCCAATTTTTAAT
TTTATTTCTCTATAGTCTGATTACATAAACTTTATTCTCAACAAACACTA
AAATTCAAAAATATAATAAAACTATAAAACTCACCACAGTTGTGAGAAAT
GCAGTCAATTTATGAACACACATACTTGTAAGACAGCTGAGTTTATCGAC
CTTACTCGTAAGTAATTTTGTACTAAGTCATTGTTATCTAACATTGGTGA
GAATTTAATTTAAATCGCCGTGACTCAGTTTGTGTGTTTCAGGTTCTCTT
GATTTGCTTTTATGTTTCACGAATAAAATTTAAAATAAAATATTCATAAG
TAAAATTTTTACAGAACTAGTTTTAACCCAGTTGTCAGCTTGTTTTAAAG
CCGCGGTGACCAGGAAATAGAAGATTATTTTCTAATATACATTTTCTTTG
ATAGTTTCAATTCAGAATCATATAGTTGTTTAGTTCAGGAAAGTATCATA
TCACGACACCATATAGGCCTATTTAATCACAACTTGGATATTATGGTGTC
TAGTATATGACATTAACATGTAATATATGAAATTGTAATTAATGATTTAC
TTGCAATGAATATCAAATTATTACATTAGTTTATGTATATTTTATGTGTT
TATGTTGCTCATAACTTAATTATTTTAGATATTCCTAGGTCAGGGTAATT
TATTCATTTTGTGGCATAAGCTCGGTCTTCTGATAGTAATAATTGATAAT
AATATATTTGATGTGGTCATTTTCGAGGGTTTTTGACACTTGACTCTAAA
CTTTTATTTTTTTTTAATCTGTGATTTATACCGATTTATGGTATTACCAT
ACCTTCAGAATCTGTATTAGCTTCAATTTTTATGTCAAAATTTGAGAAAT
TTTATTTTTTCTGTGTTTACTGGAAATAGACACATTCGATGATCTGTTAT
AATATCTCCAGCATTGCCAAAGAATTTCTCTGATATAACACTGGCGGAGT
ACTTGTGTGTTGTGCATACCACAATAATAAACGATACACATTGCTTTTAC
ATTATTAAAACTGATTCTATTTTCGAAGGAGAACACCTTTTGACATATAA
GCCCTGTTAACACTCGAAATGAAGCAGATGACCTACATTTAATATACAAT
TTTTATTAATCTCACAAAAGAGATTAACAGAAGTGAGCTTGTCATGAGAA
AACAAACGGGACATGTAGACACATAATTGATGTGTGTGTAAATCCAGCGA
CAGCTTATAAAACCTGGTTAGTCTATAATAAACCATTTGAAAATACCATA
ATGAATGGTTTTGACAACAGGAAAAGAAATTATACGGGTTCGATAAATGC
AAGTTCTTAAGTCAATGAATTGGAAACGTAGTTATTGACAATATGTGCGC
GTCTTTGGTGTGACTGTGCTACCTTAATCTTTATATAGAACTTGGAAAGC
AATGATTATTTTTCTCCAGGGGTGGTCAAAGCGTATACTGCGGTCGCCTG
TCGATATGTACACATCTCTGATGCTCGTCCCACACAGCTTGTGAGACAAG
CTGTACGACAGAAACTACATGCTACAATCTCGAAGTTAGCCGATTATCGA
CTATAGTCTCTCTAAAACCCAACCGGTAAACAATAGCTGATTGTAATTTC
ACTCATGTAGCGATACTGGCGTGAAGCAGAAGTGTTTTAGAAGTCACGTT
TCGATATAATCATCTATCTTCGATTCTACATGAAGTGTCATTCATTACCT
CATCGAAGATTATTTAATACATTTTAATTATGACGTGTTTGTATCGATCA
TAACTAAAGTTACCGGTATTGACAGTCACCATCATTTCATGTAAGTTTCT
GGTTTTTTATTTTACTAATAATTTTATTTATTTATTTTTGTTTTTTTACC
CGCAATGAGTCACTCGAGCAACATATTTAATAGCCTTTTCAATTCTACCT
ACTTCTGCGAAACAACATTTTCTACCATGAAAGCATTCAAAACAAAACAT
CGCTCCTGTTTGTCAGGTGTCCATTTCACAGCATGTTTACGAATAGCTAC
AAGTACATATGAACCACAATATGAAAAACTTGCCAAGAATATGCAGTGTC
ATGTCTCCATCGCGTCCTCTGATACAAAAACAATAATAGTTAATATGTAT
TTACAATAAAATTGTTCGAATTAATAATCAAAATAAAATAAAATTGTTTT
ATTTATAACCTAATGGCGATTTATTAAATGTTCAGTATTTTATTGCAAAT
GTACAGTAAAATTTGTCCAATATTATATGCAAATTTTTAGTATAAAAATC
AAATTGTCTGTGGAAAATTTAATGTTCAGTATTTATATTTGTTCAGTGTT
AAAATTAAAGTTTCAGTAATTAATTTAGTTTTCTGTTTCAAAAATGCATT
TACTCAGTAAAAAATAGTATTATTTTTTCGATGTATATTTTGTAAATAGA
AAAATATTTCTTTATATTGACCGATTATGACACCATCAATCCCTCTGTTT
GCACATTTGTCTATCTTTATAAATAGCTCATTTTTTAAATATGCTAAAAT
TTTGTTTACCAATACTATTATTATGAATTTGAATTAAGTGGCAACGCTGA
TAGGAATTGTTGAAGTACCGACTTATGTTTCTGACGACGTGATGATTACA
AGTGAAACTGTAGGTAATGGAAACAAGAAAAAATCAAAAGAGACAACGCA
ATCGGGTAAAAGAAATGATATTTAACAACACCGAAGAAGCTGAAGAAGCA
GTGATCAAAGAAAATCAAAGAAATCATTATACTAAAACAACAGAAATAGG
AAAAAGTTTTTTCGATGTAATAAATTCTAAGCTCATGGTCAACAATGTGA
TGCTACATATTTGTTATTTGAATCTGCATCAGATGAAGTTGCACCAATAA
TGCTTTAGAAGCTACCAACAATGTTATAAAAAAGAAAATGCACTTCGTGA
ACGTTTATTAAGATTTAAAGTATTAGCATTTGAAATTTTTGAGAAATGTT
CAAAATACAAATAAATACAATAAGAAGAAAACAATAACATTTAAATTATG
GACAACTGGATATCAATGGGTTAAATCAAACAAATCAATACTTTCGACTG
ATAACTTAGTTCAATATAATATACCTGCTGGAGATGAAACTAAAATTACA
CAAGTCGAAATAGATATAGTGAAGAAAATGAAATGGTATTCTTTTGATAA
ATATAAAAAAGCAGTAAATGTTTGGCTTGTTACCAGTTAGATGAATTAAA
ATGGTTAGATGGTGCTTGCAATTGTCCAGAATTTTTCAAAACGTTTATGT
GTAAACATGTCTTTGGTATGGTAATTAGATTAAATTACTGCAAACCGCAC
CCTGCTGCTAAAAATTTTAAAATTGGTGAAAAAAGACGTGATAGACCAGC
AAAATTTAAAAAGCGTTCAATAATTTTTTGTTAATTGTAATTAAATTTTT
TTACCTAAATAAGTTATTAAAAAAACTGAAAAATAAATTATGTACTGAGC
GCAAATGAATTAAATACTGAATATTTTTTAATAACTTACTGAACTTCTTG
AATTATTTATTGAGCAAAAACTAATTTTTTTACTGAACCAACTATAAAAT
TAATCATTTACTCCTTCACTGAATTTTGTCGTTAATATTATGTAAATGAC
TTCTAAAATGTCTGATAATAAAAATGCACCAGGTTATTTAGTTAAAATTT
TTATGTAATTGAATCAGAATAATTTTCAAACACAATAAATTGTTATACTA
TTTAGTCAATATTTATAAAATGAATTTGCAAATGAATA
back to top

protein sequence of SMED30000504-orf-1

>SMED30000504-orf-1 ID=SMED30000504-orf-1|Name=SMED30000504-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MECQVNKNEHFRHYLLFAFNRRATATKAAREICAVYGEGAIAKRTARDWF
AKLNSGNFDLRDVPGSGRPVMFDEECLNQLLLEDASQTTREFNCSNSTVA
KYLHSMGKVPQAKIPLSHRHWR*
back to top

protein sequence of SMED30000504-orf-2

>SMED30000504-orf-2 ID=SMED30000504-orf-2|Name=SMED30000504-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MHRLNNVIQQKRPDRRNLVLLQHDNARPHIAYITKEAVQTLGWDVLPHPP
YSPAPSDFHLFRSLSNALHGASFNNDIELRAWLGDFFETCPGDFYRRGIE
KLVER*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041426Mos1_HTH
IPR001888Transposase_1
IPR007527Znf_SWIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0006310DNA recombination
GO:0015074DNA integration
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041426Mos1 transposase, HTH domainPFAMPF17906HTH_48coord: 9..57
e-value: 4.7E-18
score: 65.0
NoneNo IPR availableGENE3DG3DSA:1.10.10.1450coord: 5..54
e-value: 5.9E-14
score: 53.9
NoneNo IPR availablePANTHERPTHR46060FAMILY NOT NAMEDcoord: 9..111