Cornifelin-like A

Overview
NameCornifelin-like A
Smed IDSMED30000491
Length (bp)621
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cornifelin-like A (SMED30000491) t-SNE clustered cells

Violin plots show distribution of expression levels for Cornifelin-like A (SMED30000491) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cornifelin-like A (SMED30000491) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cornifelin-like A (SMED30000491) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000491

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30000491SMESG000023836.1 SmedASXL_067838SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000491SMESG000023836.1 dd_Smed_v4_1291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000491SMESG000023836.1 dd_Smed_v4_1291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000491SMESG000023836.1 dd_Smed_v4_1291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000491SMESG000023836.1 dd_Smed_v4_1291_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30000491SMESG000023836.1 dd_Smed_v6_1291_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000491SMESG000023836.1 dd_Smed_v6_1291_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30000491SMESG000023836.1 dd_Smed_v4_1291_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cornifelin-like A vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 49.2914 bits (116), Expect = 2.472e-7
Identity = 34/108 (31.48%), Postives = 47/108 (43.52%), Query Frame = 3
Query:  213 SNKMSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPC-------IICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQ 515
            ++K  +W      CF D+G CL   F P              C+ C V   +   C        I  +R  IRE+ +I G  CTDCLC  F G CA+ QM  E++  +
Sbjct:   30 TSKFGQWNSDTFDCFRDVGICLCGAFFP-------------MCVACKVAQDYGECCCLPLMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELESRR 124          
BLAST of Cornifelin-like A vs. Ensembl Xenopus
Match: ENSXETT00000008293.1 (novel protein similar to cornifelin [Source:NCBI gene;Acc:733751])

HSP 1 Score: 48.9062 bits (115), Expect = 2.592e-7
Identity = 34/108 (31.48%), Postives = 47/108 (43.52%), Query Frame = 3
Query:  213 SNKMSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPC-------IICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQ 515
            ++K  +W      CF D+G CL   F P              C+ C V   +   C        I  +R  IRE+ +I G  CTDCLC  F G CA+ QM  E++  +
Sbjct:   22 TSKFGQWNSDTFDCFRDVGICLCGAFFP-------------MCVACKVAQDYGECCCLPLMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELESRR 116          
BLAST of Cornifelin-like A vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 48.9062 bits (115), Expect = 2.868e-7
Identity = 34/108 (31.48%), Postives = 47/108 (43.52%), Query Frame = 3
Query:  213 SNKMSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPC-------IICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQ 515
            ++K  +W      CF D+G CL   F P              C+ C V   +   C        I  +R  IRE+ +I G  CTDCLC  F G CA+ QM  E++  +
Sbjct:   32 TSKFGQWNSDTFDCFRDVGICLCGAFFP-------------MCVACKVAQDYGECCCLPLMGGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELESRR 126          
BLAST of Cornifelin-like A vs. Ensembl Xenopus
Match: abtb1 (ankyrin repeat and BTB (POZ) domain containing 1 [Source:Xenbase;Acc:XB-GENE-976579])

HSP 1 Score: 46.595 bits (109), Expect = 1.552e-6
Identity = 33/101 (32.67%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  213 SNKMSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCI---ICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVK 506
            ++  S+W   +  C  D+G CL   FVPC L    ++     C L         PC+   +  VR  IRE+ +I G  C D +C  F G C + QM  E+K
Sbjct:   17 TSNSSQWNSDVFDCCEDMGICLCGTFVPCILACKVSQDFGECCCL---------PCLFGSVLAVRTGIRERYHIEGSICNDWVCLSFCGQCTLCQMARELK 108          
BLAST of Cornifelin-like A vs. UniProt/SwissProt
Match: sp|Q9LQU4|PCR2_ARATH (Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=PCR2 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.925e-13
Identity = 41/111 (36.94%), Postives = 56/111 (50.45%), Query Frame = 3
Query:  228 EWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFP--------PCII-CYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISL 533
            EW  G C CF D   C ++++ PC   G  AE VD     CG     +          CI  C+ RGK+R + NI G  CTDCL  F    C+++Q + E+KH +G  +SL
Sbjct:   15 EWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGALYALIAVVTGCACIYSCFYRGKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYRELKH-RGYDMSL 124          
BLAST of Cornifelin-like A vs. UniProt/SwissProt
Match: sp|D9HP20|CNR4_MAIZE (Cell number regulator 4 OS=Zea mays OX=4577 GN=CNR4 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.426e-11
Identity = 44/144 (30.56%), Postives = 68/144 (47.22%), Query Frame = 3
Query:  228 EWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGV----------CSIFFPPC---IICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE*EFSKLFTINVAL*LNFQNKFINLKK 620
            EW  G+CGCF D  +C LS+  PC   G  AE +D     CG+            +   PC     C  R K+R   ++    C DC    + G CA+SQM+ E+K+ +G   ++ R+  FS   T +    L  ++K+ ++ K
Sbjct:   10 EWTTGLCGCFSDCKSCCLSFLCPCIPFGQVAEVLDKGMTSCGLAGLLYCLLLHAGVAVVPCHCIYTCTYRRKLRAAYDLPPEPCADCCVHMWCGPCAISQMYRELKN-RGADPAMGRQPAFSLSLTSHCRFFL--KSKYYHIIK 150          
BLAST of Cornifelin-like A vs. UniProt/SwissProt
Match: sp|P0CW97|PCR3_ARATH (Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana OX=3702 GN=PCR3 PE=3 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 5.352e-11
Identity = 37/103 (35.92%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  228 EWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCII---------CYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKH 509
            EW  G C CF D   C +++  PC   G  A+ VD     CG     +              C  RGKIR + NI G  CTDCL  F    CA++Q + E+KH
Sbjct:   15 EWSTGFCDCFSDCQNCCITWLCPCITFGQVADIVDRGNTSCGTAGALYVLLAAITGCGCLYSCIYRGKIRAQYNIRGDGCTDCLKHFCCELCALTQEYRELKH 117          
BLAST of Cornifelin-like A vs. UniProt/SwissProt
Match: sp|Q9LQU2|PCR1_ARATH (Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana OX=3702 GN=PCR1 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 6.665e-9
Identity = 37/103 (35.92%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  228 EWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVD---NSCILCGVCSIFFP------PCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKH 509
            EW  G C CF D   C ++   PC   G  AE VD    SC   G   +             C+  GK+R + NI G  CTDCL  F    CA++Q + E+KH
Sbjct:   14 EWSTGFCDCFSDCRNCCITLCCPCITFGQVAEIVDRGSKSCCAAGALYMLIDLITSCGRMYACFYSGKMRAQYNIKGDGCTDCLKHFCCNLCALTQQYRELKH 116          
BLAST of Cornifelin-like A vs. UniProt/SwissProt
Match: sp|Q9LS43|PCR7_ARATH (Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis thaliana OX=3702 GN=PCR7 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.213e-8
Identity = 35/103 (33.98%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  225 SEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFP--------PCII-CYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVK 506
             +W  G+  C  D  T  L+ F PC   G  A+  D     CG C +F+         PC+  C  R KIR K  +     +DC+  FF  CCA+ Q H E+K
Sbjct:    3 KQWTSGLFSCMEDSETACLTCFCPCVTFGRIADISDEGRTGCGRCGVFYGLICCVVGLPCLFSCTYRTKIRSKFGLPESPTSDCVTHFFCECCALCQEHRELK 105          
BLAST of Cornifelin-like A vs. TrEMBL
Match: A0A267G1B3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011077g1 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 5.751e-27
Identity = 55/107 (51.40%), Postives = 72/107 (67.29%), Query Frame = 3
Query:  222 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            MS ++ G+CGCF D G  L++YF PCY  G +AEAV +SC LCG   +F P  + C +RGK+REKQ+I GGCC+D L  FF   CA+ Q   EVKH+  N  ++ERE
Sbjct:    1 MSSFRHGLCGCFDDCGVALITYFCPCYAFGKNAEAVGDSCCLCGCAYLFCPIILGCIMRGKLREKQDIPGGCCSDLLTHFFCHMCALCQEGQEVKHITLNTQAMERE 107          
BLAST of Cornifelin-like A vs. TrEMBL
Match: A0A267E7X8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033169g1 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 6.990e-25
Identity = 53/107 (49.53%), Postives = 70/107 (65.42%), Query Frame = 3
Query:  225 SEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIF-FPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
             E+Q G+CGCF D G C+++YFVPCY  G +AEAV  SC+LCG+   F F  C+  ++RGKIREKQ I G CC D L  +F   CA+ Q   EVK +  +  ++ERE
Sbjct:    3 GEFQNGLCGCFNDCGLCVITYFVPCYTFGKNAEAVGQSCVLCGLGMFFGFAICLGPFIRGKIREKQGIDGSCCGDVLTWWFCSFCALMQEAQEVKGLSPSGAAIERE 109          
BLAST of Cornifelin-like A vs. TrEMBL
Match: A0A1I8JBM9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001673g1 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.225e-23
Identity = 49/106 (46.23%), Postives = 66/106 (62.26%), Query Frame = 3
Query:  225 SEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            ++++ G+CGCF D G C+++Y VPCY  G +AEAV  SC+LCG+  +F  PC+   VRGKIREKQ I G   +D L       CA+ Q   EVK M     ++ERE
Sbjct:    3 NQFKHGLCGCFDDFGLCIVTYLVPCYTFGKNAEAVQESCLLCGIGYLFVSPCLGAIVRGKIREKQGIPGRFVSDLLAHLCCPLCALMQDAQEVKAMAPAGSAVERE 108          
BLAST of Cornifelin-like A vs. TrEMBL
Match: A0A267F6N5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018526g1 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.624e-23
Identity = 50/107 (46.73%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  222 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            M++++ G+CGCF D G C+++YFVPCY  G +AEAV +SC+LCG+  +F  PC+   VRGKIREKQ I G    D         CA+ Q   EVK M      +ERE
Sbjct:    1 MADFKHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCVLCGLAFLFVSPCVGAIVRGKIREKQGINGSFIGDFFVHLCCPLCALVQDAQEVKEMSPGGQVVERE 107          
BLAST of Cornifelin-like A vs. TrEMBL
Match: A0A1I8H2V8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.251e-22
Identity = 49/106 (46.23%), Postives = 66/106 (62.26%), Query Frame = 3
Query:  225 SEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            ++++ G+CGCF D G C+++Y VPCY  G +AEAV  SC+LCG+  +F  PC+   VRGKIREKQ I G   +D L       CA+ Q   EVK M     ++ERE
Sbjct:   65 NQFKHGLCGCFDDFGLCIVTYLVPCYTFGKNAEAVQESCLLCGIGYLFVSPCLGAIVRGKIREKQGIPGRFVSDLLAHLCCPLCALMQDAQEVKAMAPAGSAVERE 170          
BLAST of Cornifelin-like A vs. Ensembl Nematostella
Match: EDO50068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFB0])

HSP 1 Score: 78.9518 bits (193), Expect = 2.444e-19
Identity = 43/103 (41.75%), Postives = 60/103 (58.25%), Query Frame = 3
Query:  225 SEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPC----IICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGN 521
            ++W  G+ GCF D GTCL++Y  PCY  G +AEAV +SC+LCG+   FF P     ++  VRGKIRE+  I G    DC  +     C++ Q   +VK   G+
Sbjct:    3 NDWNNGLFGCFNDCGTCLITYIAPCYTFGKNAEAVGDSCLLCGLA--FFVPVVDLIVMSSVRGKIREQHGISGSFIGDCAATICCPFCSLVQSAQQVKGAPGS 103          
BLAST of Cornifelin-like A vs. Ensembl Nematostella
Match: EDO44794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR8])

HSP 1 Score: 75.485 bits (184), Expect = 5.655e-18
Identity = 44/94 (46.81%), Postives = 52/94 (55.32%), Query Frame = 3
Query:  231 WQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIIC--YVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVK 506
            W  GICGCF DI TC L+YF PC + G +AEAV  +C L G  S      I C   +R KIREK  I G    DC+  +F   CA SQ   E+K
Sbjct:    3 WSSGICGCFEDINTCALTYFCPCVVAGKNAEAVGENCFLHGFLSTLGCVGIFCGAKIREKIREKHGIEGSFGNDCIMHWFCPLCAYSQEARELK 96          
BLAST of Cornifelin-like A vs. Ensembl Nematostella
Match: EDO36116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK5])

HSP 1 Score: 69.3218 bits (168), Expect = 1.126e-15
Identity = 42/109 (38.53%), Postives = 61/109 (55.96%), Query Frame = 3
Query:  222 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICY----VRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHE--VKHMQGNAIS 530
            M ++  G+ GCF DI  CL +Y VPCY  G  AEAV   C++CG+  +   PC   +    +RGK+RE++ I G    D L ++  G C++ Q   E  VK   GN+I+
Sbjct:    1 MGQFSNGLFGCFSDIPLCLTTYCVPCYTFGKTAEAVGEDCLMCGI--VLMVPCANIWFATQIRGKVREQKGIEGSFVNDLLMTWCCGFCSIIQEALEMGVKAPIGNSIA 107          
BLAST of Cornifelin-like A vs. Ensembl Nematostella
Match: EDO42612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W1])

HSP 1 Score: 51.9878 bits (123), Expect = 6.774e-9
Identity = 33/96 (34.38%), Postives = 49/96 (51.04%), Query Frame = 3
Query:  225 SEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHM 512
             +W  G+CGCF DIG+CLL YF PC+L+   ++ +   C     C        +  +R K+R +QNI G    D      L  C + Q+  E+KH+
Sbjct:   52 RDWHSGMCGCFDDIGSCLLGYFCPCFLLIDVSQRMGEGCCFPCCCPG-----ALVGLRVKLRVEQNIQGSLINDYCAVQCLPLCVLCQLSRELKHL 142          
BLAST of Cornifelin-like A vs. Ensembl Medaka
Match: ponzr3 (cornifelin homolog A [Source:NCBI gene;Acc:101160195])

HSP 1 Score: 50.0618 bits (118), Expect = 7.355e-8
Identity = 35/108 (32.41%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  213 SNKMSEWQQGICGCFGDIGTCLLSYF-VPCYLIGLDAEAVDNSCI--LCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAI 527
            ++  +EW  GIC CF D+ +C  +++  PC+      +A +  C+  L G   I   P I   +R  IR++  I G  C DC+ SFF G C+  Q+  E+K  +   I
Sbjct:   16 TSTSNEWSSGICDCFDDLRSCCFAFWCFPCFACITSKKAGECLCLPLLDGFGCI---PPITTAMRVSIRKQYGIEGTICRDCVFSFFCGPCSWCQISREMKIRKAPMI 120          
BLAST of Cornifelin-like A vs. Planmine SMEST
Match: SMESG000023836.1 (SMESG000023836.1)

HSP 1 Score: 211.846 bits (538), Expect = 3.777e-71
Identity = 104/107 (97.20%), Postives = 105/107 (98.13%), Query Frame = 3
Query:  222 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGV SIFFPPCIICYVRGKIREKQNI GGCCTDCLCSFFLGCCAV+QMHHEVKHMQGNAISLERE
Sbjct:    1 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVISIFFPPCIICYVRGKIREKQNIDGGCCTDCLCSFFLGCCAVAQMHHEVKHMQGNAISLERE 107          
BLAST of Cornifelin-like A vs. Planmine SMEST
Match: SMESG000023831.1 (SMESG000023831.1)

HSP 1 Score: 167.548 bits (423), Expect = 1.026e-53
Identity = 73/107 (68.22%), Postives = 90/107 (84.11%), Query Frame = 3
Query:  222 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            MS+WQQGICGCFGD+GTC+L+YF PCYL+GLDAE VD +C+LC +  +FFPPCI C++RGK+R K+NI GG C DC+ S FL CC V+QMHHEVKHM G A++LERE
Sbjct:    1 MSDWQQGICGCFGDLGTCVLAYFAPCYLVGLDAETVDKNCVLCCIAFLFFPPCITCHIRGKVRSKRNIPGGSCNDCVVSLFLPCCTVAQMHHEVKHMSGTAMALERE 107          
BLAST of Cornifelin-like A vs. Planmine SMEST
Match: SMESG000023846.1 (SMESG000023846.1)

HSP 1 Score: 117.472 bits (293), Expect = 4.910e-34
Identity = 58/107 (54.21%), Postives = 74/107 (69.16%), Query Frame = 3
Query:  222 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            M+EWQ G+CGCF D GTCLLSYFVPCYL+G DAEAV +SC LCG+  +    C+   VR K+REK+ I G  C D + S +  CC+V+Q H EV  M   A+S+ER+
Sbjct:    1 MAEWQHGLCGCFSDCGTCLLSYFVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 107          
BLAST of Cornifelin-like A vs. Planmine SMEST
Match: SMESG000023842.1 (SMESG000023842.1)

HSP 1 Score: 115.546 bits (288), Expect = 3.000e-33
Identity = 64/107 (59.81%), Postives = 80/107 (74.77%), Query Frame = 3
Query:  222 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            M EW+ G+CGC  D GTCLL+YFVPCYLIG DAEAV +SC LCG  S+F  PCII YVR K+R+++NI G    D LC+F  GCC V+QMH EV  M G+++++ERE
Sbjct:    1 MGEWEHGLCGCCDDCGTCLLTYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 107          
BLAST of Cornifelin-like A vs. Planmine SMEST
Match: SMESG000060415.1 (SMESG000060415.1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.642e-22
Identity = 45/106 (42.45%), Postives = 60/106 (56.60%), Query Frame = 3
Query:  231 WQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFFPPCI--ICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGNAISLERE 542
            WQ G+C CF D G CL+S+F PCY +G+DA+AV  SC LCG  +I  P  I  +  +R  IR++Q I G    D     F  CC  +QMH E       + ++ERE
Sbjct:   11 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATI-TPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 115          
The following BLAST results are available for this feature:
BLAST of Cornifelin-like A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ifi352.472e-731.48interferon induced protein 35 [Source:Xenbase;Acc:... [more]
ENSXETT00000008293.12.592e-731.48novel protein similar to cornifelin [Source:NCBI g... [more]
ifi352.868e-731.48interferon induced protein 35 [Source:Xenbase;Acc:... [more]
abtb11.552e-632.67ankyrin repeat and BTB (POZ) domain containing 1 [... [more]
back to top
BLAST of Cornifelin-like A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9LQU4|PCR2_ARATH6.925e-1336.94Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis ... [more]
sp|D9HP20|CNR4_MAIZE2.426e-1130.56Cell number regulator 4 OS=Zea mays OX=4577 GN=CNR... [more]
sp|P0CW97|PCR3_ARATH5.352e-1135.92Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis ... [more]
sp|Q9LQU2|PCR1_ARATH6.665e-935.92Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis ... [more]
sp|Q9LS43|PCR7_ARATH1.213e-833.98Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis ... [more]
back to top
BLAST of Cornifelin-like A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G1B35.751e-2751.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E7X86.990e-2549.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JBM94.225e-2346.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F6N54.624e-2346.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2V81.251e-2246.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cornifelin-like A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cornifelin-like A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO500682.444e-1941.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447945.655e-1846.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361161.126e-1538.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426126.774e-934.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cornifelin-like A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ponzr37.355e-832.41cornifelin homolog A [Source:NCBI gene;Acc:1011601... [more]
back to top
BLAST of Cornifelin-like A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023836.13.777e-7197.20SMESG000023836.1[more]
SMESG000023831.11.026e-5368.22SMESG000023831.1[more]
SMESG000023846.14.910e-3454.21SMESG000023846.1[more]
SMESG000023842.13.000e-3359.81SMESG000023842.1[more]
SMESG000060415.16.642e-2242.45SMESG000060415.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000491 ID=SMED30000491|Name=Cornifelin-like A|organism=Schmidtea mediterranea sexual|type=transcript|length=621bp
ATTATTTTCAAAGATCGTGGCTTTGAAATGTTATGTTTTGTGATTACTTT
GTTTGAATTTAATGAACACATCGGCAAGTTTAGCACCTTATCTGAACCAA
TAATATCGTTTTGATGCAAAGTGTGCTAAAATTGTTTGATAATTCGTTTA
CACACATCAGAAAACTACGGTCAAAAATCTATAAAAAGGATTGTAAATGT
TGAATGTTTTAAAGCAACAAAATGTCGGAGTGGCAACAAGGAATTTGTGG
TTGTTTTGGAGATATTGGAACTTGTTTATTGTCTTACTTTGTGCCCTGCT
ATTTAATCGGTCTTGACGCAGAAGCAGTGGATAACAGCTGCATTTTATGT
GGTGTTTGTTCTATATTCTTTCCGCCTTGCATCATTTGTTATGTCAGAGG
GAAAATTAGAGAGAAACAAAATATTGTTGGAGGTTGCTGTACTGATTGTC
TGTGTTCATTTTTCCTTGGGTGCTGCGCAGTTTCTCAAATGCATCACGAA
GTCAAACATATGCAAGGAAATGCGATTTCGCTCGAAAGAGAATAAGAATT
TTCGAAATTATTTACAATAAACGTTGCATTATAACTTAATTTTCAAAATA
AATTTATAAACTTGAAAAAAA
back to top

protein sequence of SMED30000491-orf-1

>SMED30000491-orf-1 ID=SMED30000491-orf-1|Name=SMED30000491-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVCSIFF
PPCIICYVRGKIREKQNIVGGCCTDCLCSFFLGCCAVSQMHHEVKHMQGN
AISLERE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000420parapharyngeal region
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
Vocabulary: biological process
TermDefinition
GO:0008284positive regulation of cell proliferation
GO:0009409response to cold
GO:0040015negative regulation of multicellular organism growth
GO:0042742defense response to bacterium
GO:0043066negative regulation of apoptotic process
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0050873brown fat cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 4..93
e-value: 2.8E-19
score: 69.9
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 2..96
e-value: 1.1E-20
score: 72.3
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 1..96
NoneNo IPR availablePANTHERPTHR15907:SF90coord: 1..96
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 39..58