Double C2-like domain-containing protein beta

Overview
NameDouble C2-like domain-containing protein beta
Smed IDSMED30000488
Length (bp)2155
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Double C2-like domain-containing protein beta (SMED30000488) t-SNE clustered cells

Violin plots show distribution of expression levels for Double C2-like domain-containing protein beta (SMED30000488) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Double C2-like domain-containing protein beta (SMED30000488) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Double C2-like domain-containing protein beta (SMED30000488) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000488

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000488SMESG000009083.1 SMESG000009094.1 dd_Smed_v4_12977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000488SMESG000009083.1 SMESG000009094.1 dd_Smed_v4_12977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000488SMESG000009083.1 SMESG000009094.1 dd_Smed_v4_12977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000488SMESG000009083.1 SMESG000009094.1 dd_Smed_v4_12977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000488SMESG000009083.1 SMESG000009094.1 dd_Smed_v4_12977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000488SMESG000009083.1 Contig54698newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000488SMESG000009083.1 Contig54698uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000488SMESG000009083.1 Contig45783newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000488SMESG000009083.1 Contig45783uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30000488SMESG000009083.1 SMESG000009094.1 dd_Smed_v6_12977_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30000488SMESG000009083.1 SMED30000488smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Human
Match: DOC2B (double C2 domain beta [Source:HGNC Symbol;Acc:HGNC:2986])

HSP 1 Score: 234.572 bits (597), Expect = 1.834e-69
Identity = 132/280 (47.14%), Postives = 174/280 (62.14%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  +    FS  L ++ P+ K  D  ++ ERG+ILISL ++ +   + V IVRC  LA MD NG+SDP+ K YL+PD  + +K KT  KK TLNP FNEEF  E+  G   +K+LE++VWDYD G +NDFIG V     AKG+R K W     N +K+ + W  L +++
Sbjct:  127 LGTLDFSLLYDQENNALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKTEDKSLE-ERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSEL 405          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Human
Match: DOC2B (double C2 domain beta [Source:HGNC Symbol;Acc:HGNC:2986])

HSP 1 Score: 234.572 bits (597), Expect = 2.353e-69
Identity = 132/280 (47.14%), Postives = 174/280 (62.14%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  +    FS  L ++ P+ K  D  ++ ERG+ILISL ++ +   + V IVRC  LA MD NG+SDP+ K YL+PD  + +K KT  KK TLNP FNEEF  E+  G   +K+LE++VWDYD G +NDFIG V     AKG+R K W     N +K+ + W  L +++
Sbjct:  127 LGTLDFSLLYDQENNALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKTEDKSLE-ERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSEL 405          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Human
Match: RPH3A (rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056])

HSP 1 Score: 230.72 bits (587), Expect = 1.106e-65
Identity = 134/293 (45.73%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   DM  KTLR++V DED  G  ++IGE R  L  L  ++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  344 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERVGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 636          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Human
Match: RPH3A (rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056])

HSP 1 Score: 231.491 bits (589), Expect = 1.771e-65
Identity = 134/293 (45.73%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   DM  KTLR++V DED  G  ++IGE R  L  L  ++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  393 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERVGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 685          

HSP 2 Score: 82.8037 bits (203), Expect = 1.146e-15
Identity = 53/189 (28.04%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  319 DRWICPNDRQLAL--RAKLGTGWSVFT--HKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            +RW+ P+DR L    + +L  GWSV           +  ++ EE + I+ V+ R +  +++E+ERIG +V  L+N+++N +      C +CG    +  ++     C+ C K  C  C  +                              NN L S + +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:   11 NRWMYPSDRPLQSNDKEQLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACV--VCEDCKKNVCTKCGVET-----------------------------NNRLHS-VWLCKICIEQREVWKRSGAWFFKGFPKQVLP 167          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Human
Match: RPH3A (rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056])

HSP 1 Score: 231.491 bits (589), Expect = 1.771e-65
Identity = 134/293 (45.73%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   DM  KTLR++V DED  G  ++IGE R  L  L  ++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  393 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERVGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 685          

HSP 2 Score: 82.8037 bits (203), Expect = 1.146e-15
Identity = 53/189 (28.04%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  319 DRWICPNDRQLAL--RAKLGTGWSVFT--HKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            +RW+ P+DR L    + +L  GWSV           +  ++ EE + I+ V+ R +  +++E+ERIG +V  L+N+++N +      C +CG    +  ++     C+ C K  C  C  +                              NN L S + +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:   11 NRWMYPSDRPLQSNDKEQLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACV--VCEDCKKNVCTKCGVET-----------------------------NNRLHS-VWLCKICIEQREVWKRSGAWFFKGFPKQVLP 167          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 208.379 bits (529), Expect = 1.821e-56
Identity = 114/279 (40.86%), Postives = 164/279 (58.78%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            +LG +   + + SA  +L + +   K+LK+MD NG SDPYVK HLLPG T  TKL +KT  +TLNP WNE++ Y+GI   D + K LR+ VLD D IG D++GE R+ L  LN +E   F+  L    P+ +   +  + +RGKI + L +N +  ++ + I RC EL  MD  GFSDP+CK+ L P   +  + KT TKK TLNP +NE+    +      +KTL+I V+D+D G  +D+IG +     AK +RG+ W    +NP    + W  L  D
Sbjct:  683 SLGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSDFLGETRIALKKLNDNEMKKFNLYLESALPVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKDLPKKTLQIGVYDHDLGKHDDYIGGILLSTSAKDERGRQWIKCIENPGTLVEAWHRLELD 961          

HSP 2 Score: 97.0561 bits (240), Expect = 1.951e-20
Identity = 63/220 (28.64%), Postives = 97/220 (44.09%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHES-----NISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREI-WKRSGAWKIQQLPEFCLP----------TTNNVCPHPDSCSKVILNT 930
            ++W+CP+DR L LRA+L +GWSV T  +     S     +I+  E +HI  VL + +     E++RIG MV  L+ ++R  +      C +C   F L ++      C  C K  C            ++NC       +              G    + +CK C E RE+ WK+SGAW  +++PEF  P          TTN   P+  S +  +  T
Sbjct:   20 NKWVCPSDRHLHLRAQLKSGWSVRTATARSPTNSKAQTGSITAAEQEHIQKVLAKAEESKSKEQQRIGKMVDRLEKMRRRATGNGVTHCLLCHTEFGLLASKSYAAMCVDCRKYVC------------QRNCGVETTDVNQ-----------TTGKVETVFLCKICSEAREVLWKKSGAWFYKEMPEFQRPDDRLPYYVPVTTNGTLPNASSAATPLSGT 216          

HSP 3 Score: 56.9954 bits (136), Expect = 4.228e-8
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF--DWIG 1602
            ++ G +N  + ++     L I I    +L  MD  G SDPY K  L P  +   + +T T  RTLNP WNE+L +  +   D+  KTL++ V D D +G   D+IG
Sbjct:  822 EDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFV-VPFKDLPKKTLQIGVYDHD-LGKHDDYIG 925          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 207.994 bits (528), Expect = 1.994e-56
Identity = 114/279 (40.86%), Postives = 164/279 (58.78%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            +LG +   + + SA  +L + +   K+LK+MD NG SDPYVK HLLPG T  TKL +KT  +TLNP WNE++ Y+GI   D + K LR+ VLD D IG D++GE R+ L  LN +E   F+  L    P+ +   +  + +RGKI + L +N +  ++ + I RC EL  MD  GFSDP+CK+ L P   +  + KT TKK TLNP +NE+    +      +KTL+I V+D+D G  +D+IG +     AK +RG+ W    +NP    + W  L  D
Sbjct:  674 SLGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSDFLGETRIALKKLNDNEMKKFNLYLESALPVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKDLPKKTLQIGVYDHDLGKHDDYIGGILLSTSAKDERGRQWIKCIENPGTLVEAWHRLELD 952          

HSP 2 Score: 96.6709 bits (239), Expect = 2.206e-20
Identity = 63/220 (28.64%), Postives = 97/220 (44.09%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHES-----NISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREI-WKRSGAWKIQQLPEFCLP----------TTNNVCPHPDSCSKVILNT 930
            ++W+CP+DR L LRA+L +GWSV T  +     S     +I+  E +HI  VL + +     E++RIG MV  L+ ++R  +      C +C   F L ++      C  C K  C            ++NC       +              G    + +CK C E RE+ WK+SGAW  +++PEF  P          TTN   P+  S +  +  T
Sbjct:   11 NKWVCPSDRHLHLRAQLKSGWSVRTATARSPTNSKAQTGSITAAEQEHIQKVLAKAEESKSKEQQRIGKMVDRLEKMRRRATGNGVTHCLLCHTEFGLLASKSYAAMCVDCRKYVC------------QRNCGVETTDVNQ-----------TTGKVETVFLCKICSEAREVLWKKSGAWFYKEMPEFQRPDDRLPYYVPVTTNGTLPNASSAATPLSGT 207          

HSP 3 Score: 56.9954 bits (136), Expect = 4.437e-8
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF--DWIG 1602
            ++ G +N  + ++     L I I    +L  MD  G SDPY K  L P  +   + +T T  RTLNP WNE+L +  +   D+  KTL++ V D D +G   D+IG
Sbjct:  813 EDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFV-VPFKDLPKKTLQIGVYDHD-LGKHDDYIG 916          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 207.994 bits (528), Expect = 1.994e-56
Identity = 114/279 (40.86%), Postives = 164/279 (58.78%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            +LG +   + + SA  +L + +   K+LK+MD NG SDPYVK HLLPG T  TKL +KT  +TLNP WNE++ Y+GI   D + K LR+ VLD D IG D++GE R+ L  LN +E   F+  L    P+ +   +  + +RGKI + L +N +  ++ + I RC EL  MD  GFSDP+CK+ L P   +  + KT TKK TLNP +NE+    +      +KTL+I V+D+D G  +D+IG +     AK +RG+ W    +NP    + W  L  D
Sbjct:  674 SLGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSDFLGETRIALKKLNDNEMKKFNLYLESALPVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKDLPKKTLQIGVYDHDLGKHDDYIGGILLSTSAKDERGRQWIKCIENPGTLVEAWHRLELD 952          

HSP 2 Score: 96.6709 bits (239), Expect = 2.206e-20
Identity = 63/220 (28.64%), Postives = 97/220 (44.09%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHES-----NISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREI-WKRSGAWKIQQLPEFCLP----------TTNNVCPHPDSCSKVILNT 930
            ++W+CP+DR L LRA+L +GWSV T  +     S     +I+  E +HI  VL + +     E++RIG MV  L+ ++R  +      C +C   F L ++      C  C K  C            ++NC       +              G    + +CK C E RE+ WK+SGAW  +++PEF  P          TTN   P+  S +  +  T
Sbjct:   11 NKWVCPSDRHLHLRAQLKSGWSVRTATARSPTNSKAQTGSITAAEQEHIQKVLAKAEESKSKEQQRIGKMVDRLEKMRRRATGNGVTHCLLCHTEFGLLASKSYAAMCVDCRKYVC------------QRNCGVETTDVNQ-----------TTGKVETVFLCKICSEAREVLWKKSGAWFYKEMPEFQRPDDRLPYYVPVTTNGTLPNASSAATPLSGT 207          

HSP 3 Score: 56.9954 bits (136), Expect = 4.437e-8
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF--DWIG 1602
            ++ G +N  + ++     L I I    +L  MD  G SDPY K  L P  +   + +T T  RTLNP WNE+L +  +   D+  KTL++ V D D +G   D+IG
Sbjct:  813 EDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFV-VPFKDLPKKTLQIGVYDHD-LGKHDDYIG 916          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 208.379 bits (529), Expect = 2.656e-56
Identity = 114/279 (40.86%), Postives = 164/279 (58.78%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            +LG +   + + SA  +L + +   K+LK+MD NG SDPYVK HLLPG T  TKL +KT  +TLNP WNE++ Y+GI   D + K LR+ VLD D IG D++GE R+ L  LN +E   F+  L    P+ +   +  + +RGKI + L +N +  ++ + I RC EL  MD  GFSDP+CK+ L P   +  + KT TKK TLNP +NE+    +      +KTL+I V+D+D G  +D+IG +     AK +RG+ W    +NP    + W  L  D
Sbjct:  749 SLGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSDFLGETRIALKKLNDNEMKKFNLYLESALPVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKDLPKKTLQIGVYDHDLGKHDDYIGGILLSTSAKDERGRQWIKCIENPGTLVEAWHRLELD 1027          

HSP 2 Score: 97.0561 bits (240), Expect = 2.092e-20
Identity = 63/220 (28.64%), Postives = 97/220 (44.09%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHES-----NISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREI-WKRSGAWKIQQLPEFCLP----------TTNNVCPHPDSCSKVILNT 930
            ++W+CP+DR L LRA+L +GWSV T  +     S     +I+  E +HI  VL + +     E++RIG MV  L+ ++R  +      C +C   F L ++      C  C K  C            ++NC       +              G    + +CK C E RE+ WK+SGAW  +++PEF  P          TTN   P+  S +  +  T
Sbjct:   86 NKWVCPSDRHLHLRAQLKSGWSVRTATARSPTNSKAQTGSITAAEQEHIQKVLAKAEESKSKEQQRIGKMVDRLEKMRRRATGNGVTHCLLCHTEFGLLASKSYAAMCVDCRKYVC------------QRNCGVETTDVNQ-----------TTGKVETVFLCKICSEAREVLWKKSGAWFYKEMPEFQRPDDRLPYYVPVTTNGTLPNASSAATPLSGT 282          

HSP 3 Score: 56.9954 bits (136), Expect = 4.459e-8
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF--DWIG 1602
            ++ G +N  + ++     L I I    +L  MD  G SDPY K  L P  +   + +T T  RTLNP WNE+L +  +   D+  KTL++ V D D +G   D+IG
Sbjct:  888 EDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFV-VPFKDLPKKTLQIGVYDHD-LGKHDDYIG 991          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 208.379 bits (529), Expect = 3.124e-56
Identity = 114/279 (40.86%), Postives = 164/279 (58.78%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            +LG +   + + SA  +L + +   K+LK+MD NG SDPYVK HLLPG T  TKL +KT  +TLNP WNE++ Y+GI   D + K LR+ VLD D IG D++GE R+ L  LN +E   F+  L    P+ +   +  + +RGKI + L +N +  ++ + I RC EL  MD  GFSDP+CK+ L P   +  + KT TKK TLNP +NE+    +      +KTL+I V+D+D G  +D+IG +     AK +RG+ W    +NP    + W  L  D
Sbjct:  827 SLGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSDFLGETRIALKKLNDNEMKKFNLYLESALPVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKDLPKKTLQIGVYDHDLGKHDDYIGGILLSTSAKDERGRQWIKCIENPGTLVEAWHRLELD 1105          

HSP 2 Score: 96.6709 bits (239), Expect = 2.853e-20
Identity = 63/220 (28.64%), Postives = 97/220 (44.09%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHES-----NISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREI-WKRSGAWKIQQLPEFCLP----------TTNNVCPHPDSCSKVILNT 930
            ++W+CP+DR L LRA+L +GWSV T  +     S     +I+  E +HI  VL + +     E++RIG MV  L+ ++R  +      C +C   F L ++      C  C K  C            ++NC       +              G    + +CK C E RE+ WK+SGAW  +++PEF  P          TTN   P+  S +  +  T
Sbjct:  164 NKWVCPSDRHLHLRAQLKSGWSVRTATARSPTNSKAQTGSITAAEQEHIQKVLAKAEESKSKEQQRIGKMVDRLEKMRRRATGNGVTHCLLCHTEFGLLASKSYAAMCVDCRKYVC------------QRNCGVETTDVNQ-----------TTGKVETVFLCKICSEAREVLWKKSGAWFYKEMPEFQRPDDRLPYYVPVTTNGTLPNASSAATPLSGT 360          

HSP 3 Score: 56.9954 bits (136), Expect = 4.866e-8
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF--DWIG 1602
            ++ G +N  + ++     L I I    +L  MD  G SDPY K  L P  +   + +T T  RTLNP WNE+L +  +   D+  KTL++ V D D +G   D+IG
Sbjct:  966 EDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFV-VPFKDLPKKTLQIGVYDHD-LGKHDDYIG 1069          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Fly
Match: Rph (gene:FBgn0030230 transcript:FBtr0301558)

HSP 1 Score: 155.606 bits (392), Expect = 4.319e-41
Identity = 95/281 (33.81%), Postives = 148/281 (52.67%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLR---TKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            LG L   I +  A   L  T+   +DL +MD  GL+DPY K +++  + H    R   TKT ++T NP +NE L + G+   ++ +  + +A+ D+D  G D++G  ++ L  ++S  +Y  S  L      +   +   +   GK+L+SL +N K   + V + +C  L  MD NG SDPF KI LKPD  +  K KT  K  TLNP +NEEF  E       ++ L ++VWD D G +NDF+G ++   ++KG+R + W      P+   + W  L  D
Sbjct:  117 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYGHDFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWHCLAPD 397          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Fly
Match: Rph (gene:FBgn0030230 transcript:FBtr0332296)

HSP 1 Score: 155.606 bits (392), Expect = 4.319e-41
Identity = 95/281 (33.81%), Postives = 148/281 (52.67%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLR---TKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            LG L   I +  A   L  T+   +DL +MD  GL+DPY K +++  + H    R   TKT ++T NP +NE L + G+   ++ +  + +A+ D+D  G D++G  ++ L  ++S  +Y  S  L      +   +   +   GK+L+SL +N K   + V + +C  L  MD NG SDPF KI LKPD  +  K KT  K  TLNP +NEEF  E       ++ L ++VWD D G +NDF+G ++   ++KG+R + W      P+   + W  L  D
Sbjct:  117 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAHTKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYGHDFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWHCLAPD 397          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Fly
Match: Rph (gene:FBgn0030230 transcript:FBtr0071502)

HSP 1 Score: 157.147 bits (396), Expect = 4.548e-40
Identity = 97/282 (34.40%), Postives = 150/282 (53.19%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKL----RTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCAD 2130
            LG L   I +  A   L  T+   +DL +MD  GL+DPY K +++  + H TK     RTKT ++T NP +NE L + G+   ++ +  + +A+ D+D  G D++G  ++ L  ++S  +Y  S  L      +   +   +   GK+L+SL +N K   + V + +C  L  MD NG SDPF KI LKPD  +  K KT  K  TLNP +NEEF  E       ++ L ++VWD D G +NDF+G ++   ++KG+R + W      P+   + W  L  D
Sbjct:  354 LGWLEIAISYREAFHSLDCTMVRARDLPAMDAAGLADPYCKLNIITPEAH-TKYTRWQRTKTVHKTRNPEFNETLQFVGVEPEELGNSLIYVALFDDDKYGHDFLGAAKVCLSTVHSTSQYRISVPLGVEDQYSNAAEMAQNWPNGKMLLSLCYNTKRRALVVNVKQCINLMAMDNNGSSDPFVKIQLKPDAHKNKKHKTSVKWRTLNPIYNEEFYFEASPHDLNKEMLILTVWDKDLGKSNDFLGSLQLGAQSKGERLQQWLDCIRLPDHFHEKWHCLAPD 634          

HSP 2 Score: 98.9821 bits (245), Expect = 3.451e-21
Identity = 55/195 (28.21%), Postives = 99/195 (50.77%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPD 903
            ++++CP+DRQLALRAKL  GWS  + K+       + PEE + I  V++R +  +  E++R+G +V  ++ IK++  +     C +CG +F +      +  C+ C ++ C  C   ++                        I +  +     I +C+ C ETRE+WK+SGAW  + LP++ +P + +  P P+
Sbjct:   11 NKFVCPSDRQLALRAKLKAGWS--SSKT----SEPLRPEEQEAIISVIRRNEEIEVAERQRVGRLVERVEKIKQHAVERGPNCCRLCGDTFGILRPQ--RILCEDCRQSVCTKCSVDIN------------------------IRYHTSERSREIWLCRICSETREMWKKSGAWFFKGLPKYDMPRSASATPIPN 173          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089139)

HSP 1 Score: 123.635 bits (309), Expect = 5.923e-31
Identity = 91/280 (32.50%), Postives = 144/280 (51.43%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFR--AKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            +N+G +++ + +D   + L++ +  GK+L + D++G SDPYV+  LLP K H  +L TK   RTLNP WNE   + G     + S+ L L V D D     D IGE  L L  ++   + +F   L   +P AKD       + G++L SL ++  NS + +T+++   L   D NG SDP+ K++L+    R+ KRKT     TLNP FNE F   +     +E +L++ V D+D    N+ IG +    +  +     K W+ +   P +    W  L
Sbjct:   13 ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKH--RLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSFWKAL---KPPAKD-------KCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRL 280          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0343990)

HSP 1 Score: 122.865 bits (307), Expect = 1.036e-29
Identity = 91/280 (32.50%), Postives = 144/280 (51.43%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFR--AKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            +N+G +++ + +D   + L++ +  GK+L + D++G SDPYV+  LLP K H  +L TK   RTLNP WNE   + G     + S+ L L V D D     D IGE  L L  ++   + +F   L   +P AKD       + G++L SL ++  NS + +T+++   L   D NG SDP+ K++L+    R+ KRKT     TLNP FNE F   +     +E +L++ V D+D    N+ IG +    +  +     K W+ +   P +    W  L
Sbjct:  146 ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKH--RLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSFWKAL---KPPAKD-------KCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRL 413          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Zebrafish
Match: doc2d (double C2-like domains, delta [Source:ZFIN;Acc:ZDB-GENE-081104-451])

HSP 1 Score: 236.113 bits (601), Expect = 5.164e-70
Identity = 136/283 (48.06%), Postives = 171/283 (60.42%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVD-------HERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + +  D   + L  TI   K LK+MD NGL+DPYVK HLLPG +   KLRTKT   TLNP+WNE L+YHGI   DM +KTLRL V D D +G  ++IGE R+ L  L   E   ++  L +     + N   +D        ERG+IL+SLL+N + +T+ V I+RC  LA MD NG+SDPF KI L+PD  + +K KT  KK TLNP FNEEF  ++      +KTLEISVWDYD G +NDFIG V+    AKGDR K W        KK + W  L
Sbjct:  138 LGTLEFNLLFDQENNCLHCTIHKAKGLKAMDSNGLADPYVKLHLLPGASKANKLRTKTLKNTLNPVWNETLIYHGITAADMTTKTLRLCVCDMDRLGRNEFIGEVRVALKKLKEGESKKYNMGLERIAQTREGNSQAMDPAAPVAEEERGRILVSLLYNTEKNTLVVGIIRCAHLAAMDSNGYSDPFVKIILQPDMGKKSKYKTTVKKKTLNPEFNEEFSYDVPHDQLAKKTLEISVWDYDLGMSNDFIGGVELGINAKGDRLKHWFECLKYKGKKVEYWHTL 420          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Zebrafish
Match: doc2b (double C2-like domains, beta [Source:ZFIN;Acc:ZDB-GENE-090615-1])

HSP 1 Score: 241.121 bits (614), Expect = 9.725e-70
Identity = 135/280 (48.21%), Postives = 178/280 (63.57%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGLSDPYVK HLLPG +   KLRTKT   TLNP+W+E L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  NFS+ L ++ PI K +D  ++ ERG+I+ISL ++ + S + V I+RC  LA MD NGFSDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  E+      +KTLE++VWDYD G +NDFIG V     A G+R K W     N +KK + W  L  ++
Sbjct:  355 LGTLDFSLLYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPVWSETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQTKNFSNCLEKQLPIDKTDDKSLE-ERGRIMISLKYSSQKSGLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTAVKKKTLNPEFNEEFFYEIKYADLSKKTLEVTVWDYDIGKSNDFIGGVSLGINASGERLKHWFDCLKNKDKKIERWHTLTNEL 633          

HSP 2 Score: 101.293 bits (251), Expect = 9.683e-22
Identity = 61/191 (31.94%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESN-ISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNV 888
            ++W+CPNDRQL LRAKL TGWS+ T +S    ++  +   EL  I  V+ R +  + IE+ RIG +V  L N++ +       +C +CG  F L  +S     C  C    C  C                             I     G K    +CK C E RE+WKRSGAW  + LP+   P  +++
Sbjct:   11 EQWVCPNDRQLMLRAKLHTGWSIHTFQSERQRKAQALEKRELDLIMSVIHRAEQLELIEQHRIGRLVERLDNMRSSAMGNGLSQCLLCGEVFGLLGSS--SVLCLDCCMKVCTKCG----------------------------IETTAGGQKRTQWLCKICSEQREVWKRSGAWFYKALPKHIRPIKDSI 171          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Zebrafish
Match: rph3ab (rabphilin 3A homolog (mouse), b [Source:ZFIN;Acc:ZDB-GENE-090706-3])

HSP 1 Score: 233.417 bits (594), Expect = 2.165e-67
Identity = 138/290 (47.59%), Postives = 171/290 (58.97%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNL-----LQRQPIA---------KDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L   I   K LK MD NGL+DPYVK HLLPG +  TKLRTKT   T NP WNE LVYHG+   DM  KTLRL+V DED  G  ++IGE R+ L  L  +++ NF+  L      +R   A         +D D     ERG+ILISL+++ +   + V +VRC  LA MD NG+SDPF KI LKPD  +  K KTQ KK TLNP FNEEF  E+      +KTL+ISVWDYD G  ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  279 LGSLEFTLLYDQGNSSLHCNIIKAKGLKPMDSNGLADPYVKLHLLPGASKSTKLRTKTLRNTRNPTWNETLVYHGLTDEDMQRKTLRLSVCDEDKFGHNEFIGETRVALKKLKINQKKNFNICLERVVQTKRSSTAGGARGITLYEDEDGSELEERGRILISLMYSTQLGRLIVGVVRCVHLAAMDANGYSDPFVKICLKPDMGKKAKNKTQIKKKTLNPEFNEEFSYEIKHAELAKKTLDISVWDYDIGKCNDYIGGCQLGITAKGERLKHWYECLKNKDKKIERWHTL 568          

HSP 2 Score: 63.1586 bits (152), Expect = 7.289e-10
Identity = 42/153 (27.45%), Postives = 63/153 (41.18%), Query Frame = 1
Query:  418 SNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPT 876
            + ++ EE + I+ V+ R +  + +E+ERIG +V  L N+K+         C +CG    L         C+ C K  C  C  Q                               N     + +CK C E RE+WKRSGAW  + LP+  LP+
Sbjct:   38 AELTDEEKEIINNVIARAEKMEAMEQERIGRLVNRLDNMKKTVCGDGVSRCLLCGEQ--LGGAGDRAVVCEDCKKNMCTKCGVQ------------------------------TNTRPRSVWLCKICSEQREVWKRSGAWFFKGLPKQFLPS 158          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Zebrafish
Match: rph3ab (rabphilin 3A homolog (mouse), b [Source:ZFIN;Acc:ZDB-GENE-090706-3])

HSP 1 Score: 233.032 bits (593), Expect = 2.333e-67
Identity = 138/290 (47.59%), Postives = 171/290 (58.97%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNL-----LQRQPIA---------KDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L   I   K LK MD NGL+DPYVK HLLPG +  TKLRTKT   T NP WNE LVYHG+   DM  KTLRL+V DED  G  ++IGE R+ L  L  +++ NF+  L      +R   A         +D D     ERG+ILISL+++ +   + V +VRC  LA MD NG+SDPF KI LKPD  +  K KTQ KK TLNP FNEEF  E+      +KTL+ISVWDYD G  ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  266 LGSLEFTLLYDQGNSSLHCNIIKAKGLKPMDSNGLADPYVKLHLLPGASKSTKLRTKTLRNTRNPTWNETLVYHGLTDEDMQRKTLRLSVCDEDKFGHNEFIGETRVALKKLKINQKKNFNICLERVVQTKRSSTAGGARGITLYEDEDGSELEERGRILISLMYSTQLGRLIVGVVRCVHLAAMDANGYSDPFVKICLKPDMGKKAKNKTQIKKKTLNPEFNEEFSYEIKHAELAKKTLDISVWDYDIGKCNDYIGGCQLGITAKGERLKHWYECLKNKDKKIERWHTL 555          

HSP 2 Score: 63.1586 bits (152), Expect = 7.673e-10
Identity = 42/153 (27.45%), Postives = 63/153 (41.18%), Query Frame = 1
Query:  418 SNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPT 876
            + ++ EE + I+ V+ R +  + +E+ERIG +V  L N+K+         C +CG    L         C+ C K  C  C  Q                               N     + +CK C E RE+WKRSGAW  + LP+  LP+
Sbjct:   25 AELTDEEKEIINNVIARAEKMEAMEQERIGRLVNRLDNMKKTVCGDGVSRCLLCGEQ--LGGAGDRAVVCEDCKKNMCTKCGVQ------------------------------TNTRPRSVWLCKICSEQREVWKRSGAWFFKGLPKQFLPS 145          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Zebrafish
Match: doc2b (double C2-like domains, beta [Source:ZFIN;Acc:ZDB-GENE-090615-1])

HSP 1 Score: 234.187 bits (596), Expect = 4.638e-67
Identity = 135/288 (46.88%), Postives = 178/288 (61.81%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGK--------DLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K         LK MD NGLSDPYVK HLLPG +   KLRTKT   TLNP+W+E L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  NFS+ L ++ PI K +D  ++ ERG+I+ISL ++ + S + V I+RC  LA MD NGFSDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  E+      +KTLE++VWDYD G +NDFIG V     A G+R K W     N +KK + W  L  ++
Sbjct:  355 LGTLDFSLLYDQENNALHCTINKAKLPVPRYKKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPVWSETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQTKNFSNCLEKQLPIDKTDDKSLE-ERGRIMISLKYSSQKSGLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTAVKKKTLNPEFNEEFFYEIKYADLSKKTLEVTVWDYDIGKSNDFIGGVSLGINASGERLKHWFDCLKNKDKKIERWHTLTNEL 641          

HSP 2 Score: 101.679 bits (252), Expect = 8.092e-22
Identity = 61/191 (31.94%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESN-ISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNV 888
            ++W+CPNDRQL LRAKL TGWS+ T +S    ++  +   EL  I  V+ R +  + IE+ RIG +V  L N++ +       +C +CG  F L  +S     C  C    C  C                             I     G K    +CK C E RE+WKRSGAW  + LP+   P  +++
Sbjct:   11 EQWVCPNDRQLMLRAKLHTGWSIHTFQSERQRKAQALEKRELDLIMSVIHRAEQLELIEQHRIGRLVERLDNMRSSAMGNGLSQCLLCGEVFGLLGSS--SVLCLDCCMKVCTKCG----------------------------IETTAGGQKRTQWLCKICSEQREVWKRSGAWFYKALPKHIRPIKDSI 171          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 246.514 bits (628), Expect = 2.249e-72
Identity = 173/477 (36.27%), Postives = 244/477 (51.15%), Query Frame = 1
Query:  760 NNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSKVILNTQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERFSFNPFEDELKETINKMESSNNISSNPTA---TLQWNNFNEKFKNDADFGTKLYRQNPPEGSLFWXXXXXXXXXXXXXXD---NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAK---------------DNDDLVD-HERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            +N     I +CK C E RE+WKRSGAW  +  P+  LP      P P + SK     + + +   S +  +R P+  + + +      +    QV+    +    P    L  +  +   S ++  N  A   T Q    +   +  A + + +     P      +Q+   +E      D    LG L + +F+D   + L   I   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   ++  KTLR++V DED  G  ++IGE R  L  L  +++ +F+  L +  P+ +               +ND   D  ERGKIL+SL++N +   + V IVRC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  E+      +K L++SVWDYD G +ND+IG  +    AKG+R K W     N +KK + W +L
Sbjct:   79 SNSRPHSIWLCKICSEQREVWKRSGAWFFKGFPKHVLPQ-----PIPVNKSKP---QKPSAVSEDSGQEQKRYPRTQS-RGDYSFTGKLQHILQVKGFVTK---RPCGTTLPASQPESTYSASVPRNEKADSFTPQGVRQDRPLRQAASYTSSVPTVAAPSARQPQTQDEEEEEANSYDSDEATTLGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQKKSFNVCLERVIPMKRAGTTGSVRGMALYEDENDRGGDVEERGKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEFFYEIKHSDLAKKQLDVSVWDYDIGKSNDYIGGCQLGINAKGERLKHWYECLKNKDKKIERWHVL 543          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Xenopus
Match: ivns1abp (influenza virus NS1A binding protein [Source:Xenbase;Acc:XB-GENE-949332])

HSP 1 Score: 239.195 bits (609), Expect = 2.111e-71
Identity = 137/280 (48.93%), Postives = 176/280 (62.86%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGLSDPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  NFS  L ++ PI K  D  ++ ERG+ILISL ++ + S + V I+RC  LA MD NG+SDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  E+      +KTLE++VWDYD G +NDFIG V     AKG+R K W     N +KK + W  L  ++
Sbjct:  109 LGTLDFSLLYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQTKNFSICLEKQLPIDKTEDKSLE-ERGRILISLKYSSQKSGLLVGIIRCAHLAAMDANGYSDPYVKTYLKPDEDKKSKHKTAVKKKTLNPEFNEEFCYEIKHSDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKKIERWHTLTNEL 387          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 235.728 bits (600), Expect = 2.228e-70
Identity = 133/276 (48.19%), Postives = 172/276 (62.32%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + +F+D   + L   I   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   ++  KTLR++V DED  G  ++IGE R  L  L  +++ +F  N+   + I  D    V+ ERGKIL+SL++N +   + V IVRC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  E+      +K L++SVWDYD G +ND+IG  +    AKG+R K W     N +KK + W +L
Sbjct:   89 LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQKKSF--NVCLERVIPNDRGGDVE-ERGKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEFFYEIKHSDLAKKQLDVSVWDYDIGKSNDYIGGCQLGINAKGERLKHWYECLKNKDKKIERWHVL 361          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Xenopus
Match: ivns1abp (influenza virus NS1A binding protein [Source:Xenbase;Acc:XB-GENE-949332])

HSP 1 Score: 232.261 bits (591), Expect = 1.188e-68
Identity = 137/288 (47.57%), Postives = 177/288 (61.46%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITI--------CNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI         + K LK MD NGLSDPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  NFS  L ++ PI K  D  ++ ERG+ILISL ++ + S + V I+RC  LA MD NG+SDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  E+      +KTLE++VWDYD G +NDFIG V     AKG+R K W     N +KK + W  L  ++
Sbjct:  109 LGTLDFSLLYDQENNALHCTINKAKLPKVIHKKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQTKNFSICLEKQLPIDKTEDKSLE-ERGRILISLKYSSQKSGLLVGIIRCAHLAAMDANGYSDPYVKTYLKPDEDKKSKHKTAVKKKTLNPEFNEEFCYEIKHSDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKKIERWHTLTNEL 395          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 232.646 bits (592), Expect = 7.823e-67
Identity = 134/292 (45.89%), Postives = 175/292 (59.93%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAK---------------DNDDLVD-HERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + +F+D   + L   I   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   ++  KTLR++V DED  G  ++IGE R  L  L  +++ +F+  L +  P+ +               +ND   D  ERGKIL+SL++N +   + V IVRC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  E+      +K L++SVWDYD G +ND+IG  +    AKG+R K W     N +KK + W +L
Sbjct:  291 LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQKKSFNVCLERVIPMKRAGTTGSVRGMALYEDENDRGGDVEERGKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEFFYEIKHSDLAKKQLDVSVWDYDIGKSNDYIGGCQLGINAKGERLKHWYECLKNKDKKIERWHVL 582          

HSP 2 Score: 78.1814 bits (191), Expect = 2.173e-14
Identity = 52/177 (29.38%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  349 LALRAKLGTGWSVF--THKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            +ALR+KL  GWSV     +    HE  ++ EE + I+ V+ R    +++E+ERIG +V +L+++++  +      C +CG    L  T      C+ C K  C  C  Q                              +N     I +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:    1 MALRSKLDAGWSVHPNNQERQRKHEE-LTDEEKEIINRVIARAAKMEEMEQERIGRLVDNLEDMRKTVTGDGVNRCILCGEQLGLPGTKCV--VCEDCKKNVCTKCGVQ------------------------------SNSRPHSIWLCKICSEQREVWKRSGAWFFKGFPKHVLP 144          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Mouse
Match: Doc2b (double C2, beta [Source:MGI Symbol;Acc:MGI:1100497])

HSP 1 Score: 233.802 bits (595), Expect = 3.137e-69
Identity = 134/280 (47.86%), Postives = 173/280 (61.79%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  +    FS  L ++ P+ K  D  ++ ERG+ILISL ++ +   + V IVRC  LA MD NG+SDP+ K YLKPD  + +K KT  KK TLNP FNEEF  E+  G   +KTLE++VWDYD G +NDFIG V     AKG+R K W     N +K+ + W  L  ++
Sbjct:  127 LGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKAEDKSLE-ERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKRIERWHTLTNEL 405          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Mouse
Match: Rph3a (rabphilin 3A [Source:MGI Symbol;Acc:MGI:102788])

HSP 1 Score: 230.335 bits (586), Expect = 2.400e-65
Identity = 132/293 (45.05%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NP+WNE L YHGI   DM  KTLR++V DED  G  ++IGE R  L  L +++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  380 LGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 672          

HSP 2 Score: 78.9518 bits (193), Expect = 1.179e-14
Identity = 49/191 (25.65%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  313 IMDRWICPNDRQLAL--RAKLGTGWSVF--THKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            +++RW+ P D  L    + +L  GWSV           +  ++ EE + I+ V+ R +  + +E+ERIG +V  L+ +++N +      C +CG    +  ++     C+ C K  C  C  + S                             N     + +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:    5 VVNRWMYPGDGPLQSNDKEQLQAGWSVHPGAQTDRQRKQEELTDEEKEIINRVIARAEKMEAMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGMLGSACV--VCEDCKKNVCTKCGVETS-----------------------------NNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLP 164          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Mouse
Match: Rph3a (rabphilin 3A [Source:MGI Symbol;Acc:MGI:102788])

HSP 1 Score: 230.335 bits (586), Expect = 2.400e-65
Identity = 132/293 (45.05%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NP+WNE L YHGI   DM  KTLR++V DED  G  ++IGE R  L  L +++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  380 LGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 672          

HSP 2 Score: 78.9518 bits (193), Expect = 1.179e-14
Identity = 49/191 (25.65%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  313 IMDRWICPNDRQLAL--RAKLGTGWSVF--THKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            +++RW+ P D  L    + +L  GWSV           +  ++ EE + I+ V+ R +  + +E+ERIG +V  L+ +++N +      C +CG    +  ++     C+ C K  C  C  + S                             N     + +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:    5 VVNRWMYPGDGPLQSNDKEQLQAGWSVHPGAQTDRQRKQEELTDEEKEIINRVIARAEKMEAMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGMLGSACV--VCEDCKKNVCTKCGVETS-----------------------------NNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLP 164          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Mouse
Match: Rph3a (rabphilin 3A [Source:MGI Symbol;Acc:MGI:102788])

HSP 1 Score: 230.335 bits (586), Expect = 2.400e-65
Identity = 132/293 (45.05%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NP+WNE L YHGI   DM  KTLR++V DED  G  ++IGE R  L  L +++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  380 LGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 672          

HSP 2 Score: 78.9518 bits (193), Expect = 1.179e-14
Identity = 49/191 (25.65%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  313 IMDRWICPNDRQLAL--RAKLGTGWSVF--THKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            +++RW+ P D  L    + +L  GWSV           +  ++ EE + I+ V+ R +  + +E+ERIG +V  L+ +++N +      C +CG    +  ++     C+ C K  C  C  + S                             N     + +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:    5 VVNRWMYPGDGPLQSNDKEQLQAGWSVHPGAQTDRQRKQEELTDEEKEIINRVIARAEKMEAMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGMLGSACV--VCEDCKKNVCTKCGVETS-----------------------------NNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLP 164          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Mouse
Match: Doc2a (double C2, alpha [Source:MGI Symbol;Acc:MGI:109446])

HSP 1 Score: 212.231 bits (539), Expect = 2.741e-61
Identity = 124/302 (41.06%), Postives = 171/302 (56.62%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPI----------------------AKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L + + +D A   L   I   K LK MD NGL+DPYVK HLLPG     KL+TKT   TLNP+WNE+L Y GI   D+  K LR++V DED +   ++IGE R+ L  L   ++ +F+  L ++ P+                      A+    L++ ERG+IL+SL ++ +   + V IVRC  LA MD NG+SDP+ K YL+PD  + +K KT  KK TLNP FNEEF  E++      KTLE++VWDYD G +NDFIG V     A+G+  K W      P+   + W  L +++
Sbjct:   95 LGTLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEELTYSGITDDDITHKVLRISVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFNICLERQVPLPSPSSMSAALRGISCYLKELEQAEQGPGLLE-ERGRILLSLSYSSRRHGLLVGIVRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSNDFIGGVSLGPGARGEAQKHWNDCLHQPDTALERWHTLTSEL 395          
BLAST of Double C2-like domain-containing protein beta vs. UniProt/SwissProt
Match: sp|Q14184|DOC2B_HUMAN (Double C2-like domain-containing protein beta OS=Homo sapiens OX=9606 GN=DOC2B PE=1 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 1.130e-68
Identity = 132/280 (47.14%), Postives = 174/280 (62.14%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  +    FS  L ++ P+ K  D  ++ ERG+ILISL ++ +   + V IVRC  LA MD NG+SDP+ K YL+PD  + +K KT  KK TLNP FNEEF  E+  G   +K+LE++VWDYD G +NDFIG V     AKG+R K W     N +K+ + W  L +++
Sbjct:  127 LGTLDFSLLYDQENNALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKTEDKSLE-ERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSEL 405          
BLAST of Double C2-like domain-containing protein beta vs. UniProt/SwissProt
Match: sp|P70610|DOC2B_RAT (Double C2-like domain-containing protein beta OS=Rattus norvegicus OX=10116 GN=Doc2b PE=1 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 1.608e-68
Identity = 134/276 (48.55%), Postives = 171/276 (61.96%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L++ + +D   + L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  +    FS  L ++ P+ K  D  ++ ERG+ILISL ++ +   + V IVRC  LA MD NG+SDP+ K YLKPD  + +K KT  KK TLNP FNEEF  E+  G   +KTLE++VWDYD G +NDFIG V     AKG+R K W     N +K+ + W  L
Sbjct:  127 LGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKAEDKSLE-ERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKRIERWHTL 401          
BLAST of Double C2-like domain-containing protein beta vs. UniProt/SwissProt
Match: sp|P70169|DOC2B_MOUSE (Double C2-like domain-containing protein beta OS=Mus musculus OX=10090 GN=Doc2b PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 2.195e-68
Identity = 134/280 (47.86%), Postives = 173/280 (61.79%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   TLNP WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  +    FS  L ++ P+ K  D  ++ ERG+ILISL ++ +   + V IVRC  LA MD NG+SDP+ K YLKPD  + +K KT  KK TLNP FNEEF  E+  G   +KTLE++VWDYD G +NDFIG V     AKG+R K W     N +K+ + W  L  ++
Sbjct:  127 LGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKAEDKSLE-ERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKRIERWHTLTNEL 405          
BLAST of Double C2-like domain-containing protein beta vs. UniProt/SwissProt
Match: sp|Q9Y2J0|RP3A_HUMAN (Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 8.506e-65
Identity = 134/293 (45.73%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   DM  KTLR++V DED  G  ++IGE R  L  L  ++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  393 LGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERVGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 685          

HSP 2 Score: 82.8037 bits (203), Expect = 5.503e-15
Identity = 53/189 (28.04%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  319 DRWICPNDRQLAL--RAKLGTGWSVFT--HKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            +RW+ P+DR L    + +L  GWSV           +  ++ EE + I+ V+ R +  +++E+ERIG +V  L+N+++N +      C +CG    +  ++     C+ C K  C  C  +                              NN L S + +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:   11 NRWMYPSDRPLQSNDKEQLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACV--VCEDCKKNVCTKCGVET-----------------------------NNRLHS-VWLCKICIEQREVWKRSGAWFFKGFPKQVLP 167          
BLAST of Double C2-like domain-containing protein beta vs. UniProt/SwissProt
Match: sp|Q06846|RP3A_BOVIN (Rabphilin-3A OS=Bos taurus OX=9913 GN=RPH3A PE=1 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 8.675e-65
Identity = 134/293 (45.73%), Postives = 174/293 (59.39%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN------------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + + +D   S L  TI   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NPIWNE LVYHGI   DM  KTLR++V DED  G  ++IGE R  L  L  ++  NF+  L +  P+ +              ++ V+      ERGKIL+SL+++ +   + V I+RC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:  403 LGALEFSLLYDQDNSSLHCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQL 695          

HSP 2 Score: 87.4261 bits (215), Expect = 1.717e-16
Identity = 53/188 (28.19%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  322 RWICPNDRQLAL--RAKLGTGWSVFT--HKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP 873
            RW+CP+DR L    + +L TGWSV           +  ++ EE + I+ V+ R +  +++E+ERIG +V  L+N+++N +      C +CG    +  ++     C+ C K  C  C  + S                             N     + +CK C E RE+WKRSGAW  +  P+  LP
Sbjct:   12 RWMCPSDRPLQSNDKEQLQTGWSVHPSGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACV--VCEDCKKNVCTKCGVETS-----------------------------NNRPHPVWLCKICIEQREVWKRSGAWFFKGFPKQVLP 168          
BLAST of Double C2-like domain-containing protein beta vs. TrEMBL
Match: A0A1S3J982 (double C2-like domain-containing protein beta isoform X3 OS=Lingula unguis OX=7574 GN=LOC106171243 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 6.212e-113
Identity = 244/641 (38.07%), Postives = 334/641 (52.11%), Query Frame = 1
Query:  316 MDRWICPNDRQLALRAKLGTGWSVFTHK-SHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLP---TTNNVCP----HPDSCSKVILNTQVTNIDSASWETYRRPPKWST----MKENREIDINIDEN----QQVEPAFERFS----FNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGT-KLYRQNPPEGSLFWXXXXXXXXXXXXXXDN-----------LGILNYKIFHDS---ALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            +D W+ PNDRQLALRA+LGTGWSV THK   F     +S EE + I  V++R +  + +E+ERIG +V  L+N+K+N       +C +CG +F +   S +   C+ CGK  C  C      DT                          N     + +CK C E RE+WKRSGAW  + LP + +P   T  +  P    HP    +    +     ++  W   R     ST      E+ + +INI +     QQ   +    S    F P+         + +S +  SS     L  +      K   D G      Q   +GSL        + +     D+           LG L + + +DS   AL   +I   N K LK+MD NGLSDPYVK HLLPG +  TKLR++T ++TLNP WNE L YHG+   D+  KTLRL+VLDED  G+D+IGE R+ L  L   +  NF+  L ++ P+ KD DDLV HERGKIL+SL +     ++ V IVRC +LAPMD NGFSDP+ K+YLKPDK + +K+KT  KK TLNP +NEEF+ E+ +    +KTLE++VWD D G  +D+IG V+    AKG R K W      P+KK + W IL AD+
Sbjct:   10 IDHWVVPNDRQLALRARLGTGWSVHTHKLQTFHKNQQLSVEEQEQILNVIRRAERLELMEQERIGRLVERLENMKKNAIGSGDSQCVLCGDTFGMLGASPT--YCEDCGKAVCTKC----GVDTF-------------------------NSHHQPLWLCKICSEKRELWKRSGAWFFKGLPRYIMPKKKTELDKVPGRGGHPGQGQRSRTGSPAPQYNT--WTRGRVQYGESTDEQESSESSDDEINISKRKVRRQQDSESESEMSTTSDFRPWASRGSMGTVESDSVSIASSGRPNPLMASRPLSDSKTSLDSGQLPSSGQGTGQGSLPSEGPRVQESQDSTVSDSERSATSGVGFSLGTLEFSLMYDSMGNALHCTLIRARNLKALKAMDSNGLSDPYVKLHLLPGASKSTKLRSRTIHKTLNPEWNETLTYHGVIEEDLQRKTLRLSVLDEDAFGYDFIGETRVPLKCLKPHQLKNFNVYLDRQMPLEKD-DDLVAHERGKILVSLTYKASKQSLLVGIVRCVQLAPMDSNGFSDPYVKVYLKPDKEKKSKQKTTVKKKTLNPEYNEEFLYEIPKHELAQKTLELTVWDKDIGRHSDYIGGVQLGITAKGTRLKHWFETLKYPDKKHEYWHILSADV 616          
BLAST of Double C2-like domain-containing protein beta vs. TrEMBL
Match: T1JK29 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 2.802e-91
Identity = 208/632 (32.91%), Postives = 314/632 (49.68%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHK-SHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSKVILNTQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERFSFNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGTKLYRQNPPEGSL------------FWXXXXXXXXXXXXXXDNL-------------GILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHER-GKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            D+W+CPNDRQL+LRAKL +GWSV T + + +     ++ +E + I  V+KR ++ D +E+ERIG +V  L+N+K++       +C +CG  F +   S     C  C K  C  C      DT+                         +  K  + +CK C ETREIWK+SGAW  + LP+  LP   N     +  S  I N Q   I    + T+ +  K      + +++ + D+  Q    F R S        +      + +  +S++ T   + +N  + F          +R +  + S+              +        +++  D++             G + + + +DS  S L  TI   + L+ MD NGLSDPYVK HLLPG +   KLRT+T ++TLNP +NE L YHGI + ++  KTLRL+VLDED  G D+IGE R+ L  L   +   F+  L ++ P+ +D D L      GKILISL +  +   + V I+RC  L  MD NG SDPF K+ +KPD     K KT  +   LNP FNEEFV ++       KT+EI+VWD D G TND+IG ++    +KG+R + +     NP+K+ D W  L +++
Sbjct:   11 DKWVCPNDRQLSLRAKLKSGWSVKTGQLNSYQKPEQMNDDEQERIKNVIKRAETIDVVEQERIGRLVEKLENMKKHVMGNGANQCILCGDEFGILGAS--SLACHDCRKGVCSKC----GVDTL-------------------------SAQKDPLWLCKICSETREIWKKSGAWFFKGLPKHILPEKKNTS---NKYSGKISNKQPKPIRGRDFNTWYKSGKGPQDVSDLDVETSSDDEIQKGMLFTRDSLRG-----RSARTSGDRTPRLSASSTRGDEEDNMEQAFNTYGTTHAMHHRDSGSDRSIRSDKSATHEHKSLITTGLNQTVLRESPIDDVFEEKYSPDDIAMFGNVEFSLIYDSINSTLHCTIYRARGLRPMDSNGLSDPYVKLHLLPGASKSNKLRTRTVHKTLNPEFNETLTYHGITQNEILKKTLRLSVLDEDAFGHDFIGETRISLKKLKPHQTKYFNVYLDKQLPLDRDEDILAAESNCGKILISLKYCLQKKALLVGIIRCANLPSMDPNGLSDPFIKVQMKPD-HLRRKYKTTVQWKNLNPEFNEEFVFDVFLQELPNKTVEITVWDKDYGRTNDYIGGLQIGIASKGERLRHFLHTIKNPDKRHDRWHHLSSEV 602          
BLAST of Double C2-like domain-containing protein beta vs. TrEMBL
Match: A0A5N5LKW7 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00078480 PE=4 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 4.000e-85
Identity = 206/607 (33.94%), Postives = 284/607 (46.79%), Query Frame = 1
Query:  406 FDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSKVILN-------TQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERFSFNPFEDELKETIN-----KMESSNNIS----SNPTATLQWNNFNEKFKNDADFGTKLYRQNPPEGSLFWXXXXXXXXXXXXXXDNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAK------------------DNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            F     ++ EE + I+ VL R +  + +E+ERIG +V  L  IKR      H +C +CG  F L   S     CD C K  C  C                                 +N     + +CK C E +E+ K+SGAW  + LP+  LP      P P S  K           T+ ++    +  +Y      + MK            Q+V P   + S    +   +   N     K+ES    S    S P++ +Q      + +        +    PP  +   +     ++   +    LG+L + + ++   + L   I   K LK MD NGL+DPYVK HLLPG +   KLRTKT   TLNP+WNE LVYHGI   DM  KTLRL+V DED  G  ++IGE R+ L  L  +++ NFS  L +  P+ +                  + DD    ERG+IL+SL +N + S + V IVRC  LAPMD NG+SDP+ KI LKPD  +  K KTQ KK TLNP FNEEF  E+      +KTL+ISVWDYD G +NDFIG  +    AKG+  K W     N +KK + W +L
Sbjct:    3 FTGAEELTDEEKEIINSVLARAELIEAMEQERIGRLVNRLDTIKRTACGDGHSQCLLCGQQFGLMGVSMV--MCDECKKHICTKC------------------------------GIRSNSRSCPVWLCKICSEHKEMLKQSGAWFFKGLPQQILPA-----PLPISKPKQFSTAGDLHAPTEPSSQQGTTAHSYVNTQNGAEMK---------PPEQEVLPVSAQISQTQTQSGAERQSNLTAWKKVESVKRASPVQPSYPSSLMQKGVLQMESRT-------IPTMQPPNSTHTPATGEEVEDYDSDDATTLGMLEFSLLYEEENNTLHCNIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTLNPVWNETLVYHGITNEDMQRKTLRLSVSDEDKFGHNEFIGETRVVLKKLKVNQKKNFSVCLERVIPVKRTAAGGAIRGMALYEEEINEGDDA--EERGRILVSLTYNSQQSQLIVGIVRCAHLAPMDANGYSDPYVKISLKPDMGKKAKNKTQIKKKTLNPEFNEEFSYEIKHSELAKKTLDISVWDYDMGKSNDFIGGCQLGITAKGECLKHWYECLKNKDKKIERWHVL 554          
BLAST of Double C2-like domain-containing protein beta vs. TrEMBL
Match: A0A0P7U193 (Rabphilin-3A-like OS=Scleropages formosus OX=113540 GN=Z043_117564 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.946e-84
Identity = 213/630 (33.81%), Postives = 295/630 (46.83%), Query Frame = 1
Query:  388 FTHKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVC----------------PHPDSCSKVILNTQ--------VTNIDSASWETYRR--------PPKWSTM----------------KENREIDINIDENQQVEPAF-ERFSFNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGTKLYRQ--NPPEGSLFWXXXXXXXXXXXXXXDNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
              H SH D   +++ EE + I+ V+ R +  + +E+ERIG +V  L+N+K++        C +CG    L +   S   C+ C K  C  C                              S  N      + +CK C E RE+WKRSGAW  + +P+  LPT   +                 P P++ +     TQ        ++  +  + +T           PPK + M                +EN E   ++   ++  P    R    P + E++               P ATL      E  +  A +     RQ  +PPE       E  +     ++   LG L + + ++   + L   I   K LK MD NGL+DPYVK HLLPG +  TKLRTKT   T NP+WNE LVYHG+   DM  KTLRL+V DED  G  ++IGE R+ L  L  ++  NF+  L +  P  KD  DL   ERG+ILISL++N + S + V +VRC  LA MD NG+SDPF KI LKPD  +  K KTQ KK TLNP FNEEF  ++      +KTL+ISVWDYD G  ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:    4 MRHASH-DPGPDLTDEEKEIINSVIARAEKMEAMERERIGRLVNQLENMKKSVCGDGVSRCLLCGEQ--LGTPGVSSVVCEDCKKHMCTRC------------------------------SMQNTSRPRAVRLCKICSEQREVWKRSGAWFFKGMPKQFLPTPMPISKNHKSSTQQAKSSAEQPVPETSAAGQPRTQGRGSVEGYISGAERHAADTPHSAQRGYPPVPPKPTEMHMGPAGVGGQCSPHPSEENSEAQDSLVVARRAVPVQNSRPPQAPAKHEMESAYPTALPQLREERGPPATL------EDRRQPAAYNRTPARQQPHPPE-----DDEEEANSYDSDETTALGSLEFSLLYEQENNSLHCCIMRAKGLKPMDSNGLADPYVKLHLLPGASKSTKLRTKTLRNTRNPVWNETLVYHGLTDEDMQRKTLRLSVCDEDKFGHNEFIGETRVALKKLKMNQRKNFNVCLERVVPTGKDIGDL--EERGRILISLMYNSQLSRLIVGVVRCVHLAAMDANGYSDPFVKICLKPDMGKKAKNKTQIKKKTLNPEFNEEFSYDIKHSELAKKTLDISVWDYDIGKCNDYIGGCQLGITAKGERLKHWYECLKNKDKKIEKWHTL 587          
BLAST of Double C2-like domain-containing protein beta vs. TrEMBL
Match: A0A226PZU9 (Uncharacterized protein OS=Colinus virginianus OX=9014 GN=H355_016011 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.835e-82
Identity = 207/647 (31.99%), Postives = 298/647 (46.06%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESN-ISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSKVILNTQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERFSFNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGTKLYRQNPPEGSLFWXXXXXXXXXXXXXXDNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLR----------------------------LAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN-----------DDLVDH-----ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            DRW+CP DR ++LRA+L  GW+    +     +   ++ EE + I+ V+ R +  +++E+ERIG ++  L++++R+        C +CG       ++     C+ C K  C  C  + +                             N     I +CK C E RE+WKRSGAW  + LP+  LP      P P S SKV       +            PK  +    R  ++ +    + +PA  R    P   E  E+ +    S  +S +P         N    N             P           +  +    +  LG L + + +D   S L  T+   K LK MD NGL+DPYVK HLLPG +   KLRTKT   T NP+WNE LVYHGI   DM  KTLR                            ++V DED  G  ++IGE R+ L  L ++++ NF+  L +  P+ +             ++ VD      ERGKIL+SL+++ +   + V IVRC  LA MD NG+SDPF K++LKPD  +  K KTQ KK TLNP FNEEF  ++      +K+L+ISVWDYD G +ND+IG  +    AKG+R K W     N +KK + W  L
Sbjct:   59 DRWMCPGDRTMSLRARLPAGWAARGGQPERQRKGEELTDEEKEIINRVIARAEKMEEMEQERIGRLMTRLEDMRRSVLGDGVNRCILCGEQLGPRGSACV--VCEDCKKNVCTKCGVETT-----------------------------NSRPHPIWLCKICSEQREVWKRSGAWFFKGLPKQMLPQ-----PMPVSKSKVPPAPSEPSPAEPPTPD----PKLPSRTPGRGSEVTVTARVR-KPAEGRT--GPCGSEDTESRDPTTESG-VSRSPGV----KRANSMQTNSTPPPRPPAATAVPAAPAVARPGPGAASRMLETQATLGALEFSLLYDQENSALHCTLIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLVYHGITDEDMTRKTLRQVEELGNRVVLGRTLLGEGMGRAPGNGEISVCDEDKFGHNEFIGETRVSLKKLKANQKKNFNICLERVIPMKRTGTTGSSRGMALYEEEVDRGGDVEERGKILVSLMYSTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGITAKGERLKHWYECLKNKDKKIERWHTL 657          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Cavefish
Match: doc2d (double C2-like domain-containing protein beta [Source:NCBI gene;Acc:103027347])

HSP 1 Score: 232.261 bits (591), Expect = 8.582e-69
Identity = 135/283 (47.70%), Postives = 171/283 (60.42%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDH-------ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + +  D   + L  TI   K LK+MD NGL+DPYVK HLLPG +   KLRTKT   TLNP+WNE L+YHGI   DM +KTLRL V D D +G  ++IGE R+ L  L   E   ++  L +     + N+  VD        ERG+IL+SL +  + +++ V I+RC  LA MD NG+SDPF KI L+PD  + +K KT  KK TLNP FNEEF+ E+      +KTLEISVWDYD G +NDFIG V+    AKGDR K W        KK + W  L
Sbjct:  120 LGTLEFSLLFDQENNCLHCTINKAKGLKAMDSNGLADPYVKLHLLPGASKANKLRTKTLKNTLNPVWNETLMYHGITAADMTTKTLRLCVCDMDRLGRNEFIGEVRVALKKLTEGETKRYNMGLERITQTREGNNQTVDQTSQPAEEERGRILVSLCYMVEKTSLVVGIIRCAHLAAMDSNGYSDPFVKIVLQPDMGKKSKYKTTVKKKTLNPEFNEEFMYEVPLDQLAKKTLEISVWDYDLGMSNDFIGGVELGINAKGDRLKHWFECLKYKGKKVEYWHTL 402          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Cavefish
Match: doc2b (double C2 domain beta [Source:NCBI gene;Acc:103021390])

HSP 1 Score: 230.72 bits (587), Expect = 2.994e-68
Identity = 133/280 (47.50%), Postives = 176/280 (62.86%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K LK MD NGLSDPYVK HLLPG +   KLRTKT   TLNP+W+E L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  NF + L ++ PI K +D  ++ ERG+I+ISL ++ +   + V I+RC  LA MD NGFSDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  E+      +KTLE++VWDYD G +NDFIG V     A G+R K W     N +KK + W  L  ++
Sbjct:  127 LGTLDFSLLYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPVWSETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQTKNFYNCLEKQLPIDKTDDKSLE-ERGRIMISLKYSSQKCGLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTTVKKKTLNPEFNEEFFYEIKYADLSKKTLEVTVWDYDIGKSNDFIGGVSLGINANGERLKHWFDCLKNKDKKIERWHTLTNEL 405          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Cavefish
Match: doc2b (double C2 domain beta [Source:NCBI gene;Acc:103021390])

HSP 1 Score: 223.787 bits (569), Expect = 1.665e-65
Identity = 133/288 (46.18%), Postives = 176/288 (61.11%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGK--------DLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L++ + +D   + L  TI   K         LK MD NGLSDPYVK HLLPG +   KLRTKT   TLNP+W+E L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  NF + L ++ PI K +D  ++ ERG+I+ISL ++ +   + V I+RC  LA MD NGFSDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  E+      +KTLE++VWDYD G +NDFIG V     A G+R K W     N +KK + W  L  ++
Sbjct:  127 LGTLDFSLLYDQENNALHCTINKAKLPVPRYRKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPVWSETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQTKNFYNCLEKQLPIDKTDDKSLE-ERGRIMISLKYSSQKCGLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTTVKKKTLNPEFNEEFFYEIKYADLSKKTLEVTVWDYDIGKSNDFIGGVSLGINANGERLKHWFDCLKNKDKKIERWHTLTNEL 413          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Cavefish
Match: doc2a (double C2-like domain-containing protein alpha [Source:NCBI gene;Acc:103036801])

HSP 1 Score: 209.534 bits (532), Expect = 3.554e-60
Identity = 127/308 (41.23%), Postives = 168/308 (54.55%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAK------------------DNDDLVD-HERGKILISLLF---------NDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L +++ ++ A S L  TI   K LK MD NGLSDPYVK HLLPG +   KL+TKT   +LNP+WNE L Y GI   DM  KTLRL+V DED +   ++IGE R+ L  +  D+   F   L    P+                    +N+ L    ERG++L+SL F           +   + V ++RC  LA MD NGFSDP+ K YLKPD  + +K KT   K TLNP FNEEF  E+       KTLE++VWDYD G +NDFIG V     ++GD  + W     N  +K + W +L  ++
Sbjct:  109 LGTLEFELRYERATSSLHCTIIRAKGLKPMDFNGLSDPYVKLHLLPGASKANKLKTKTVRNSLNPVWNETLTYIGITEEDMHRKTLRLSVCDEDKLTHNEFIGESRVALRRVKPDQTKRFYTCLEHPPPLPSPTAMGAALRGISCYLREWENEQLHSLEERGRLLLSLQFLPPPEEGDGEGRRGGLWVGVLRCAHLAAMDVNGFSDPYVKTYLKPDVKKKSKHKTAVIKKTLNPEFNEEFFYEISLSELVSKTLEVTVWDYDLGRSNDFIGGVCLSCHSQGDALRHWMDCLRNKGQKVERWHVLTNEL 416          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Cavefish
Match: ENSAMXT00000036659.1 (double C2-like domain-containing protein alpha [Source:NCBI gene;Acc:103047660])

HSP 1 Score: 201.445 bits (511), Expect = 7.261e-58
Identity = 120/281 (42.70%), Postives = 158/281 (56.23%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            +LG L + + ++SA S L  T+   K LK MD NGL+DPYVK HLLPG     KL+TK    TLNP+WNE L Y GI   DM  KTLR++V DED +   ++IGE R+ L  +  D+  +F+  L    P++  +  LV        + + F      + V + RC  LA MD NGFSDP+ K YLKPD  + +K KT   K TLNP FNEEF  E+       KTLE++VWDYD G +NDFIG V     ++GD  + W     N   K + W  L  D+
Sbjct:   88 SLGTLEFDVLYESATSSLHCTVLKAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKIVKNTLNPVWNETLTYCGITEEDMYRKTLRVSVCDEDKLTHNEFIGESRVALRRVKPDQPKHFNVCLEHPPPVSAPSCVLVRK------MDMYFLPPGG-LCVGVRRCAHLAAMDVNGFSDPYVKTYLKPDVKKKSKHKTAVIKKTLNPEFNEEFFYEITFNELATKTLEVTVWDYDLGKSNDFIGGVSLGCHSQGDALQHWIDCLKNKGTKVERWHTLTNDL 361          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004430.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004430.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 7.969e-14
Identity = 47/119 (39.50%), Postives = 67/119 (56.30%), Query Frame = 1
Query: 1720 GKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKP---------DXXXXXXXXXXXXXXXLNPYFNEEFV---IELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHF 2040
            G+I + + F+  +  + + +++   LAP D NGFSDPF K+YL P         +     KR+T+    TLNP +N+  V   I LD+   K KTLE SVWDYDR  +NDF+G V+   
Sbjct:  158 GEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDE--LKRKTLEFSVWDYDRFSSNDFLGEVRIEL 274          

HSP 2 Score: 72.7886 bits (177), Expect = 1.411e-13
Identity = 42/121 (34.71%), Postives = 65/121 (53.72%), Query Frame = 1
Query: 1300 GILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGK---------THKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLN 1632
            G +  ++  D     L+I +   + L   D NG SDP+VK +LLPG+         + + K RTK  ++TLNP WN+ +VY  I   ++  KTL  +V D D     D++GE R+ L D++
Sbjct:  158 GEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDFLGEVRIELSDVS 278          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004426.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.172e-13
Identity = 47/119 (39.50%), Postives = 67/119 (56.30%), Query Frame = 1
Query: 1720 GKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKP---------DXXXXXXXXXXXXXXXLNPYFNEEFV---IELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHF 2040
            G+I + + F+  +  + + +++   LAP D NGFSDPF K+YL P         +     KR+T+    TLNP +N+  V   I LD+   K KTLE SVWDYDR  +NDF+G V+   
Sbjct:  161 GEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDE--LKRKTLEFSVWDYDRFSSNDFLGEVRIEL 277          

HSP 2 Score: 72.4034 bits (176), Expect = 1.714e-13
Identity = 42/121 (34.71%), Postives = 65/121 (53.72%), Query Frame = 1
Query: 1300 GILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGK---------THKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLN 1632
            G +  ++  D     L+I +   + L   D NG SDP+VK +LLPG+         + + K RTK  ++TLNP WN+ +VY  I   ++  KTL  +V D D     D++GE R+ L D++
Sbjct:  161 GEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDFLGEVRIELSDVS 281          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 68.5514 bits (166), Expect = 2.308e-13
Identity = 41/107 (38.32%), Postives = 61/107 (57.01%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRL 1614
            LG L + I +D   +QL + +    +L ++D+ G SDPYVK  L+P K  K K  TK   +TLNP++NE  V+  +   ++  KTL +AV D D     D IGE ++
Sbjct:   80 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDK--KKKYETKVHRKTLNPVFNESFVFK-VPYSELGGKTLVMAVYDFDRFSKHDIIGEVKV 183          

HSP 2 Score: 67.781 bits (164), Expect = 3.373e-13
Identity = 39/104 (37.50%), Postives = 64/104 (61.54%), Query Frame = 1
Query: 1720 GKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVK 2031
            GK+  S+ ++ +N+ + V +++  EL  +D  G SDP+ K++L PD  +  K +T+  + TLNP FNE FV ++       KTL ++V+D+DR   +D IG VK
Sbjct:   81 GKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPD--KKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVK 182          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Sea Lamprey
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 68.5514 bits (166), Expect = 2.394e-13
Identity = 41/115 (35.65%), Postives = 62/115 (53.91%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRLFLPDLN 1632
            + LG L + + ++   SQ  + I    DL +MDI G+SDPYV+ +LLP K  K K  T    +TLNPI+ EK  +  +   ++  + L + V D D     D IGE R+ L  ++
Sbjct:   77 NTLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHK--KKKFETSVHRKTLNPIFEEKFTF-TVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVD 188          

HSP 2 Score: 63.929 bits (154), Expect = 7.165e-12
Identity = 38/101 (37.62%), Postives = 57/101 (56.44%), Query Frame = 1
Query: 1720 GKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIG 2022
            G++  SL +N K S   V I++ T+LA MD  G SDP+ ++YL P   +  K +T   + TLNP F E+F   +      E+ L + V+D+DR   +D IG
Sbjct:   80 GRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLP--HKKKKFETSVHRKTLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIG 178          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 68.9366 bits (167), Expect = 2.436e-13
Identity = 39/104 (37.50%), Postives = 64/104 (61.54%), Query Frame = 1
Query: 1720 GKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVK 2031
            GK+  S+ ++ +N+ + V +++  EL  +D  G SDP+ K++L PD  +  K +T+  + TLNP FNE FV ++       KTL ++V+D+DR   +D IG VK
Sbjct:   98 GKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPD--KKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVK 199          

HSP 2 Score: 68.9366 bits (167), Expect = 2.602e-13
Identity = 41/107 (38.32%), Postives = 61/107 (57.01%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRL 1614
            LG L + I +D   +QL + +    +L ++D+ G SDPYVK  L+P K  K K  TK   +TLNP++NE  V+  +   ++  KTL +AV D D     D IGE ++
Sbjct:   97 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDK--KKKYETKVHRKTLNPVFNESFVFK-VPYSELGGKTLVMAVYDFDRFSKHDIIGEVKV 200          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 214.157 bits (544), Expect = 5.679e-64
Identity = 123/277 (44.40%), Postives = 171/277 (61.73%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
             LG+L + + +    S+L + + + K LK MD  G SDPYVK HLLPG +   KLR+ T Y+TLNP++NE L Y+GI   ++ SKTLRL V DEDTIG  D+IGE  + L  LNS+    F  +L+   P A D+        G+I ++L +N +   + VT++RC+ LA MD NG+SDP+ K YLKPD  + +KR+T  +K TLNP FNEEFV ++      +K+LE++VWDYD G +NDFIG V  +  A+G   K W  +   PN+    W  L
Sbjct:   18 GLGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLNSNPTQTFKRSLI---PKALDSPH---SPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNINAEGSALKHWYDMLKGPNQLHTQWHTL 288          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 128.642 bits (322), Expect = 2.844e-33
Identity = 90/276 (32.61%), Postives = 142/276 (51.45%), Query Frame = 1
Query: 1291 DNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLN-SDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGW 2112
            + LG + + + + S+ S L + +   + L + D +G SDP+VK  LLP K HK  L T+   + LNP+WNE   + G     +  KTL + VLD D     D IGE  + L +++       F+ +LL   P  KD   L     G +L+SL++   N+ I V +++  +L  MD  G SDP+ K+Y+     R+ K+KT  K+ T +P +NE F+ ++     ++ T   +V DYDR   N+ IG V   +R  G   + W  + +NP K    W
Sbjct:    1 EQLGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHK--LETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVTLTFTKDLL---PCKKDRVPL-----GDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILGYRTTGSSLRHWTEMMNNPRKPVAQW 266          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 119.783 bits (299), Expect = 1.904e-29
Identity = 89/276 (32.25%), Postives = 137/276 (49.64%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            +G +N+ + +    + L + I   +D+ + D +G SDPYVK  LLP K  K K  TK   +TLNP++NE+ V+  I   ++ ++ L + + D D     D IGE R  LP ++ D   N +   +   P           + G I  SL +   +  +Q+TIV    L  MD  G+SDP+ KI L  +  +I K+KT  KK TLNPY+NE F   +     ++ +L ISV DYDR   ++ IG       + G   + W  +  +P +    W  L
Sbjct:   84 IGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDK--KKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEAR--LPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVLDYDRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQWHTL 355          

HSP 2 Score: 51.6026 bits (122), Expect = 6.214e-7
Identity = 35/98 (35.71%), Postives = 54/98 (55.10%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG 1587
            +LG + + + +  +  +L ITI   K LKSMD+ G SDPYVK  L+       K +T    RTLNP +NE   +  +    ++  +L ++VLD D +G
Sbjct:  220 DLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFT-VAFEKIEQTSLIISVLDYDRVG 316          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Nematostella
Match: EDO41935 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S354])

HSP 1 Score: 95.1301 bits (235), Expect = 9.072e-23
Identity = 58/183 (31.69%), Postives = 85/183 (46.45%), Query Frame = 1
Query:  319 DRWICPNDRQLALRAKLGTGWSVFTHK-SHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEF 864
            +RW CPNDRQL LRAKL  GWS  +   +    ++ IS  E + I  V++R D     E+ R+G +V  L+N++ N        C +C   F L  T    ++CD C K  CE C      DT                         +N +   I +C  C E RE+WK++GAW  + +P++
Sbjct:   10 NRWTCPNDRQLVLRAKLNAGWSFHSGGPAKKPAKTTISEAEQEIIKNVIQRADRIQLQEEGRVGRLVEKLENLRNNAIGNGRDTCLLCASKFGLLKTI--DKECDICEKNVCEKC----GVDT-------------------------HNSVGQPIWLCVLCSEQRELWKKTGAWFFKSIPKY 161          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Nematostella
Match: EDO29765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2P9])

HSP 1 Score: 82.8037 bits (203), Expect = 2.625e-17
Identity = 73/249 (29.32%), Postives = 115/249 (46.18%), Query Frame = 1
Query: 1300 GILNYKIFHDSALSQLVITICNGKDLKSMDING-LSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDED-TIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIA------KDNDDL-VDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVI-ELDQGWYKEKTLEISVWDYDRGPTNDF 2016
            G +   + +D    +L + +   +D+  +D     SDPY    LLP K  K+K +T T  + LNP WN    Y  +   ++  ++L L V D D     D++G  RL +   N    +   +  +    +A      K+  ++ V  E+ K             + V I+    L   D +G SDPFCKI L PDK   T+ KT   K TLNP ++   +  EL Q   +++ LEIS+WD+D    ++F
Sbjct:   21 GEVQVGLRYDYKHEKLEVQVHRARDIAPVDTKKKRSDPY----LLPDKGRKSKRKTPTIRKNLNPQWNFPFTYDDVTLEELMDRSLELTVWDWDRGASNDFLGGVRLGMETRNYSSRHRVRYWFVGMCTMAPGVGRGKNKGEVYVTAEKVKRKSKRQSIASKGELHVHIMEAKNLPGKDADGMSDPFCKITLLPDKKGKTRHKTAIIKRTLNPSWDYNLIYEELSQEELRQRVLEISIWDHDIASRDEF 265          

HSP 2 Score: 58.9214 bits (141), Expect = 1.896e-9
Identity = 41/114 (35.96%), Postives = 69/114 (60.53%), Query Frame = 1
Query: 1720 GKILISLLFNDKNSTIQVTIVRCTELAPMDCNG-FSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFV---IELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAK 2049
            G++ + L ++ K+  ++V + R  ++AP+D     SDP    YL PDK R +KRKT T +  LNP +N  F    + L++    +++LE++VWD+DRG +NDF+G V+     +
Sbjct:   21 GEVQVGLRYDYKHEKLEVQVHRARDIAPVDTKKKRSDP----YLLPDKGRKSKRKTPTIRKNLNPQWNFPFTYDDVTLEE--LMDRSLELTVWDWDRGASNDFLGGVRLGMETR 128          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Medaka
Match: doc2d (double C2-like domain-containing protein beta [Source:NCBI gene;Acc:101154838])

HSP 1 Score: 234.958 bits (598), Expect = 1.042e-69
Identity = 136/283 (48.06%), Postives = 170/283 (60.07%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDH-------ERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            LG L + +  D   + L  TI   K LK+MD NGL+DPYVK HLLPG +   KLRTKT   TLNP+WNE L+YHGI   DM +KTLRL V D D +G  ++IGE R+ L  L   E   ++  L +     + N+ LVD        ERG+IL+SL +N + S + V I+RC  LA MD NG+SDPF KI L+PD  + +K KT  KK TLNP FNEEF  ++      +KTLEISVWDYD G +NDFIG V+    A G R K W     N  KK + W  L
Sbjct:  132 LGTLEFTLLFDQENNCLHCTIHKAKGLKAMDSNGLADPYVKLHLLPGASKANKLRTKTLKNTLNPVWNETLIYHGITGADMTTKTLRLCVCDMDRLGRNEFIGEVRVALKKLKEGENKRYNMGLERIAQNKETNNQLVDQGALVGEEERGRILVSLCYNTEKSCLLVGIIRCAHLAAMDSNGYSDPFVKIILQPDMGKKSKYKTSVKKKTLNPEFNEEFSYDVSLDQLAKKTLEISVWDYDLGMSNDFIGGVELGINASGQRLKHWFECLKNKGKKVEYWHTL 414          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Medaka
Match: doc2b (double C2 domain beta [Source:NCBI gene;Acc:101156272])

HSP 1 Score: 233.417 bits (594), Expect = 1.973e-69
Identity = 132/280 (47.14%), Postives = 176/280 (62.86%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L + + +D   + L  TI   K LK MD NGLSDPYVK HLLPG +   KLRTKT   TL+P+WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  +F++ L ++ P+ K  D  ++ ERG+I+ISL +N + S + V I+RC  LA MD NGFSDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  ++      +KTLE++VWDYD G +NDFIG V     A G+R K W     N +KK + W  L  ++
Sbjct:  110 LGTLEFSLQYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLHPVWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQVKSFNNCLEKQLPVNKTEDKSLE-ERGRIMISLKYNTQKSCLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTAVKKKTLNPEFNEEFCYDIKYADLTKKTLEVTVWDYDIGKSNDFIGGVSLGINANGERLKHWFDCLKNKDKKIERWHTLTNEL 388          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Medaka
Match: doc2b (double C2 domain beta [Source:NCBI gene;Acc:101156272])

HSP 1 Score: 224.557 bits (571), Expect = 2.779e-66
Identity = 131/297 (44.11%), Postives = 176/297 (59.26%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDN-----------------DDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L + + +D   + L  TI   K LK MD NGLSDPYVK HLLPG +   KLRTKT   TL+P+WNE L Y+GI   DM  KTLR++V DED     ++IGE R+ L  L  ++  +F++ L ++ P++  +                 +D    ERG+I+ISL +N + S + V I+RC  LA MD NGFSDP+ K YLKPD+ + +K KT  KK TLNP FNEEF  ++      +KTLE++VWDYD G +NDFIG V     A G+R K W     N +KK + W  L  ++
Sbjct:   78 LGTLEFSLQYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLHPVWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQVKSFNNCLEKQLPVSPTSIDAAYRSECFVSEVNKTEDKSLEERGRIMISLKYNTQKSCLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTAVKKKTLNPEFNEEFCYDIKYADLTKKTLEVTVWDYDIGKSNDFIGGVSLGINANGERLKHWFDCLKNKDKKIERWHTLTNEL 374          

HSP 2 Score: 57.7658 bits (138), Expect = 1.784e-8
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 1708 DHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIE--LDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFR 2043
            D   G +  SL ++ +N+ +  TI +   L PMD NG SDP+ K++L P   +  K +T+T + TL+P +NE        D+   + KTL ISV D D+   N+FIG  +   +
Sbjct:   75 DTTLGTLEFSLQYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLHPVWNETLTYYGITDEDMVR-KTLRISVCDEDKFRHNEFIGETRIPLK 187          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Medaka
Match: doc2a (double C2-like domain-containing protein alpha [Source:NCBI gene;Acc:101167710])

HSP 1 Score: 214.542 bits (545), Expect = 1.811e-62
Identity = 124/299 (41.47%), Postives = 170/299 (56.86%), Query Frame = 1
Query: 1297 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAK------------------DNDDLVD-HERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            LG L +++ ++   S+L  T+   K LK MD NGL+DPYVK HLLPG +   KL+TKT   +LNP+WNE L+Y GI   DM  KTLRL V DED +   + IGE R+ L  L  +   +F   L    P+                    +N+ L    ERG++L+SL    +N  + V + RC  LA MD NGFSDP+ KIYLKPD  + +K KT  +K TLNP ++EEF  E+      +KTLE++VWDYD G +NDFIG V    R+KGD  + W     N  ++ + W +L  ++
Sbjct:   85 LGTLEFELRYEQISSELHCTVLKAKGLKPMDFNGLADPYVKLHLLPGASKANKLKTKTIRNSLNPVWNETLIYVGITEEDMHRKTLRLTVCDEDKLTHNELIGESRVPLKRLKPNVTKHFHTCLEHPPPLPSPSAVGEALRGISCYLREWENEQLHSLEERGRLLLSLGDGRRNGGLCVAVKRCAHLAAMDVNGFSDPYVKIYLKPDIKKKSKHKTAVRKKTLNPEYDEEFFYEISLTELAKKTLEVTVWDYDLGRSNDFIGGVSLSCRSKGDALRHWMDCLKNKGRRVERWHVLTNEL 383          
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Medaka
Match: ENSORLT00000031837.1 (double C2-like domain-containing protein alpha [Source:NCBI gene;Acc:101175439])

HSP 1 Score: 206.068 bits (523), Expect = 2.689e-59
Identity = 124/304 (40.79%), Postives = 163/304 (53.62%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGF-DWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIA-------------------KDNDDLVDHERGKILISLLFNDKNSTIQ----VTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADM 2133
            +LG L + + ++ A S L  T+   K LK MD NGL+DPYVK HLLPG     KL+TK    TLNP+WNE L Y GI   DM  KTLR++V DED +   ++IGE R+ L  +  D+  +F+  L    P+                    +        ERG++L+ L F   N + +    V + RC  LA MD NGFSDP+ K YLKPD  + +K KT   K TLNP FNEEF  E+       KTLE++VWDYD G +NDFIG V     ++GD  + W     N  KK + W  L  D+
Sbjct:   77 SLGTLEFDLLYERATSSLHCTVLRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKIVRNTLNPVWNETLTYCGITEEDMYRKTLRVSVCDEDKLTHNEFIGESRVALRRVKPDQTKHFNICLEHPPPLPSPTAMNTALRGISCYLKEWETEQQRSLEERGRLLLCLQFLPPNKSARGGLCVGVKRCAHLAAMDVNGFSDPYVKTYLKPDVQKKSKHKTAVIKKTLNPEFNEEFFYEISFSELATKTLEVTVWDYDLGRSNDFIGGVSLGCHSQGDALQHWIDCLKNKGKKVERWHTLTNDL 380          
BLAST of Double C2-like domain-containing protein beta vs. Planmine SMEST
Match: SMESG000009083.1 (SMESG000009083.1)

HSP 1 Score: 1165.98 bits (3015), Expect = 0.000e+0
Identity = 610/610 (100.00%), Postives = 610/610 (100.00%), Query Frame = 1
Query:  316 MDRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCXXXXXXXXXXXXXXFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSKVILNTQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERFSFNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGTKLYRQNPPEGSLFWXXXXXXXXXXXXXXDNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADMSDVD 2145
            MDRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCSESEISESLIKKLSFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSKVILNTQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERFSFNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGTKLYRQNPPEGSLFWSQESFSKEKKKNKEDNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDKIRITKRKTQTKKMTLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADMSDVD
Sbjct:    1 MDRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESNISPEELQHISMVLKRKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFSKRQCDTCGKTTCENCISQLSKDTIEKNCSESEISESLIKKLSFIISFPNNGLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSKVILNTQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERFSFNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGTKLYRQNPPEGSLFWSQESFSKEKKKNKEDNLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDKIRITKRKTQTKKMTLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFILCADMSDVD 610          
BLAST of Double C2-like domain-containing protein beta vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 120.939 bits (302), Expect = 3.790e-29
Identity = 94/280 (33.57%), Postives = 141/280 (50.36%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRLFLPDLN---SDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            NLG L Y + +D    +L + +    DL +MD++G SDPYVK  LLP K  K K  TK   + LNP++NE  V+  I   ++ SKTL   V D D     D IG+ ++ L  ++     EE+        ++    D+D+  ++  G I  SL +   +  + + I+    L  MD  G SDP+ K+ L  +  R+ K+KT  KK TLNPY+NE F  E+     ++  L ++V DYDR  T++ IG V     A G   + W  +  NP +    W  L
Sbjct:  133 NLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDK--KKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEW--------KELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 401          
BLAST of Double C2-like domain-containing protein beta vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 120.553 bits (301), Expect = 4.302e-29
Identity = 94/280 (33.57%), Postives = 141/280 (50.36%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRLFLPDLN---SDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            NLG L Y + +D    +L + +    DL +MD++G SDPYVK  LLP K  K K  TK   + LNP++NE  V+  I   ++ SKTL   V D D     D IG+ ++ L  ++     EE+        ++    D+D+  ++  G I  SL +   +  + + I+    L  MD  G SDP+ K+ L  +  R+ K+KT  KK TLNPY+NE F  E+     ++  L ++V DYDR  T++ IG V     A G   + W  +  NP +    W  L
Sbjct:  129 NLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDK--KKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEW--------KELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 397          
BLAST of Double C2-like domain-containing protein beta vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 120.939 bits (302), Expect = 4.911e-29
Identity = 94/280 (33.57%), Postives = 141/280 (50.36%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRLFLPDLN---SDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            NLG L Y + +D    +L + +    DL +MD++G SDPYVK  LLP K  K K  TK   + LNP++NE  V+  I   ++ SKTL   V D D     D IG+ ++ L  ++     EE+        ++    D+D+  ++  G I  SL +   +  + + I+    L  MD  G SDP+ K+ L  +  R+ K+KT  KK TLNPY+NE F  E+     ++  L ++V DYDR  T++ IG V     A G   + W  +  NP +    W  L
Sbjct:  145 NLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDK--KKKFETKVHRKILNPVFNETFVFK-IPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEW--------KELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 413          
BLAST of Double C2-like domain-containing protein beta vs. Planmine SMEST
Match: SMESG000025329.1 (SMESG000025329.1)

HSP 1 Score: 116.701 bits (291), Expect = 7.523e-28
Identity = 91/280 (32.50%), Postives = 142/280 (50.71%), Query Frame = 1
Query: 1294 NLGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLDEDTIG-FDWIGEYRLFLPDLNSD---EEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWFIL 2121
            +LG L Y + +D    +L + +    DL +MD++G SDPYVK +LLP K  K K  TK   + LNP++NE  V+  +   ++ SKTL   V D D     D IG+ ++ L  ++     EE+        ++  + +ND   ++  G I  SL +   +  + + I+    L  MD  G SDP+ K+ L  +  R+ K+KT  KK TLNPY+NE F  E+     ++  L ++V DYDR  T++ IG +     A G   + W  +  NP +    W  L
Sbjct:  120 HLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDK--KKKFETKVHRKILNPVFNETFVFK-VPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEW--------KELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTL 388          

HSP 2 Score: 66.2402 bits (160), Expect = 3.035e-11
Identity = 41/113 (36.28%), Postives = 64/113 (56.64%), Query Frame = 1
Query: 1708 DHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDXXXXXXXXXXXXXXXLNPYFNEEFVIELDQGWYKEKTLEISVWDYDRGPTNDFIGVVKFHFRA 2046
            D   GK+  SL ++ +   + V +++ T+L  MD +G SDP+ K+YL PD  +  K +T+  +  LNP FNE FV ++       KTL  +V+D+DR   +D IG +K    A
Sbjct:  118 DVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPD--KKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGA 228          
The following BLAST results are available for this feature:
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOC2B1.834e-6947.14double C2 domain beta [Source:HGNC Symbol;Acc:HGNC... [more]
DOC2B2.353e-6947.14double C2 domain beta [Source:HGNC Symbol;Acc:HGNC... [more]
RPH3A1.106e-6545.73rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056][more]
RPH3A1.771e-6545.73rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056][more]
RPH3A1.771e-6545.73rabphilin 3A [Source:HGNC Symbol;Acc:HGNC:17056][more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbf-11.821e-5640.86Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-11.994e-5640.86Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-11.994e-5640.86Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-12.656e-5640.86Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-13.124e-5640.86Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rph4.319e-4133.81gene:FBgn0030230 transcript:FBtr0301558[more]
Rph4.319e-4133.81gene:FBgn0030230 transcript:FBtr0332296[more]
Rph4.548e-4034.40gene:FBgn0030230 transcript:FBtr0071502[more]
Syt75.923e-3132.50gene:FBgn0039900 transcript:FBtr0089139[more]
Syt71.036e-2932.50gene:FBgn0039900 transcript:FBtr0343990[more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
doc2d5.164e-7048.06double C2-like domains, delta [Source:ZFIN;Acc:ZDB... [more]
doc2b9.725e-7048.21double C2-like domains, beta [Source:ZFIN;Acc:ZDB-... [more]
rph3ab2.165e-6747.59rabphilin 3A homolog (mouse), b [Source:ZFIN;Acc:Z... [more]
rph3ab2.333e-6747.59rabphilin 3A homolog (mouse), b [Source:ZFIN;Acc:Z... [more]
doc2b4.638e-6746.88double C2-like domains, beta [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPH3A2.249e-7236.27rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
ivns1abp2.111e-7148.93influenza virus NS1A binding protein [Source:Xenba... [more]
RPH3A2.228e-7048.19rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
ivns1abp1.188e-6847.57influenza virus NS1A binding protein [Source:Xenba... [more]
RPH3A7.823e-6745.89rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Doc2b3.137e-6947.86double C2, beta [Source:MGI Symbol;Acc:MGI:1100497... [more]
Rph3a2.400e-6545.05rabphilin 3A [Source:MGI Symbol;Acc:MGI:102788][more]
Rph3a2.400e-6545.05rabphilin 3A [Source:MGI Symbol;Acc:MGI:102788][more]
Rph3a2.400e-6545.05rabphilin 3A [Source:MGI Symbol;Acc:MGI:102788][more]
Doc2a2.741e-6141.06double C2, alpha [Source:MGI Symbol;Acc:MGI:109446... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14184|DOC2B_HUMAN1.130e-6847.14Double C2-like domain-containing protein beta OS=H... [more]
sp|P70610|DOC2B_RAT1.608e-6848.55Double C2-like domain-containing protein beta OS=R... [more]
sp|P70169|DOC2B_MOUSE2.195e-6847.86Double C2-like domain-containing protein beta OS=M... [more]
sp|Q9Y2J0|RP3A_HUMAN8.506e-6545.73Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1... [more]
sp|Q06846|RP3A_BOVIN8.675e-6545.73Rabphilin-3A OS=Bos taurus OX=9913 GN=RPH3A PE=1 S... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J9826.212e-11338.07double C2-like domain-containing protein beta isof... [more]
T1JK292.802e-9132.91Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A5N5LKW74.000e-8533.94Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A0P7U1931.946e-8433.81Rabphilin-3A-like OS=Scleropages formosus OX=11354... [more]
A0A226PZU92.835e-8231.99Uncharacterized protein OS=Colinus virginianus OX=... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
doc2d8.582e-6947.70double C2-like domain-containing protein beta [Sou... [more]
doc2b2.994e-6847.50double C2 domain beta [Source:NCBI gene;Acc:103021... [more]
doc2b1.665e-6546.18double C2 domain beta [Source:NCBI gene;Acc:103021... [more]
doc2a3.554e-6041.23double C2-like domain-containing protein alpha [So... [more]
ENSAMXT00000036659.17.261e-5842.70double C2-like domain-containing protein alpha [So... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004430.17.969e-1439.50pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
ENSPMAT00000004426.11.172e-1339.50pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
syt2a2.308e-1338.32synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
SYT52.394e-1335.65synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
syt2a2.436e-1337.50synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO419335.679e-6444.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437042.844e-3332.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317461.904e-2932.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419359.072e-2331.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297652.625e-1729.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
doc2d1.042e-6948.06double C2-like domain-containing protein beta [Sou... [more]
doc2b1.973e-6947.14double C2 domain beta [Source:NCBI gene;Acc:101156... [more]
doc2b2.779e-6644.11double C2 domain beta [Source:NCBI gene;Acc:101156... [more]
doc2a1.811e-6241.47double C2-like domain-containing protein alpha [So... [more]
ENSORLT00000031837.12.689e-5940.79double C2-like domain-containing protein alpha [So... [more]
back to top
BLAST of Double C2-like domain-containing protein beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009083.10.000e+0100.00SMESG000009083.1[more]
SMESG000055143.13.790e-2933.57SMESG000055143.1[more]
SMESG000055143.14.302e-2933.57SMESG000055143.1[more]
SMESG000055143.14.911e-2933.57SMESG000055143.1[more]
SMESG000025329.17.523e-2832.50SMESG000025329.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000488 ID=SMED30000488|Name=Double C2-like domain-containing protein beta|organism=Schmidtea mediterranea sexual|type=transcript|length=2155bp
TTCTGCAAATTTCCTATTCGATAATGCAAACTGAGAGTAGAAATATCTTT
ATCCAGCATCCAGATTTGGTCATTTCAATTGTCGGAATTCATATAGCTGG
ATTTGATTTCAGTTTTCGAAATTTGGTCAGAATTAACAAAATCTTATATC
TTATTAATTTATTTGATTTATAATCAAACTAAAGATCTGACTTTCTCTTC
GTTTCAATACTCTATTTTACTCGTGGATAATTTCAATATGTCAACAATTA
AGAAAAGTAAATCTTCCGTTTCCGGCATCAATATTTTAGTTCCTATTCCC
AATCTTCAGTGAATAATGGACCGATGGATTTGTCCTAATGATCGTCAGTT
AGCTCTCCGAGCCAAATTAGGAACTGGTTGGAGTGTTTTTACACATAAAT
CTCACTTTGACCACGAGTCAAATATTTCTCCAGAAGAATTACAGCATATT
TCGATGGTTTTAAAAAGGAAAGATTCATGTGACAAAATCGAAAAGGAAAG
AATAGGTCACATGGTTCTACATTTACAAAACATCAAACGGAACAAATCTC
AATACAGCCACAGAGAATGTCACATTTGTGGACACAGTTTTCTATTGTTC
TCTACTTCATTCTCTAAGCGACAGTGTGACACTTGCGGCAAAACGACATG
TGAAAATTGTATTTCTCAGTTGTCTAAAGACACTATTGAAAAGAATTGTT
CTGAATCAGAAATTTCCGAATCTTTGATTAAAAAATTATCATTCATCATC
AGTTTTCCAAACAATGGCTTGAAAAGTCGCATTACCATTTGCAAATATTG
CTTTGAAACGAGAGAAATTTGGAAAAGATCCGGAGCTTGGAAAATCCAAC
AGTTGCCTGAATTTTGTTTGCCTACCACTAATAATGTTTGTCCTCATCCG
GATTCATGTTCAAAGGTAATTCTGAACACCCAGGTTACAAATATTGATTC
TGCAAGCTGGGAGACCTACCGGCGGCCCCCAAAATGGTCAACAATGAAAG
AAAATAGAGAAATAGATATAAATATTGATGAAAATCAACAAGTTGAACCG
GCATTCGAAAGATTTTCCTTTAATCCATTTGAGGATGAGTTAAAGGAGAC
AATAAATAAAATGGAGAGCTCTAATAATATTTCATCAAATCCAACTGCCA
CCTTACAATGGAATAATTTTAATGAGAAATTCAAAAATGACGCCGACTTT
GGTACAAAACTCTATCGGCAAAATCCACCTGAGGGGTCGCTTTTTTGGAG
TCAAGAAAGCTTTTCAAAAGAAAAAAAGAAAAACAAGGAAGATAACCTCG
GAATTTTAAACTACAAAATCTTTCATGACTCAGCTCTTTCTCAGTTGGTC
ATAACGATATGCAATGGAAAGGATTTAAAGTCCATGGATATAAATGGCTT
ATCCGATCCATATGTAAAATGTCACTTACTTCCCGGTAAAACGCACAAAA
CTAAATTGCGAACAAAAACGTGCTATCGCACATTAAATCCGATATGGAAT
GAAAAATTGGTATACCATGGCATCAACCGCATAGATATGGATAGCAAAAC
CTTGAGGTTAGCTGTACTTGATGAAGATACCATTGGATTTGACTGGATTG
GAGAATATCGACTTTTTCTTCCAGATCTCAATTCAGACGAAGAATACAAT
TTTAGTCATAATTTGCTACAAAGGCAGCCAATTGCAAAAGACAACGACGA
TCTAGTTGACCATGAAAGAGGAAAAATATTAATTTCATTACTTTTTAATG
ATAAAAATTCAACTATCCAAGTGACTATTGTCAGATGCACAGAATTAGCC
CCAATGGATTGCAACGGTTTTTCTGATCCTTTTTGTAAAATATATTTGAA
ACCAGACAAGATCAGAATTACAAAAAGAAAAACTCAAACAAAAAAAATGA
CACTCAATCCTTATTTTAATGAGGAATTTGTGATTGAGTTAGATCAGGGG
TGGTATAAAGAAAAAACTTTGGAAATTTCTGTATGGGACTATGATCGCGG
ACCAACAAATGATTTCATAGGGGTTGTGAAATTTCATTTTCGAGCGAAAG
GTGACAGGGGTAAACTATGGAAAGCGGTTTACGATAATCCTAATAAAAAG
TTTGACGGTTGGTTCATTCTTTGTGCAGATATGAGTGACGTAGATTGATA
GTTGG
back to top

protein sequence of SMED30000488-orf-1

>SMED30000488-orf-1 ID=SMED30000488-orf-1|Name=SMED30000488-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=611bp
MDRWICPNDRQLALRAKLGTGWSVFTHKSHFDHESNISPEELQHISMVLK
RKDSCDKIEKERIGHMVLHLQNIKRNKSQYSHRECHICGHSFLLFSTSFS
KRQCDTCGKTTCENCISQLSKDTIEKNCSESEISESLIKKLSFIISFPNN
GLKSRITICKYCFETREIWKRSGAWKIQQLPEFCLPTTNNVCPHPDSCSK
VILNTQVTNIDSASWETYRRPPKWSTMKENREIDINIDENQQVEPAFERF
SFNPFEDELKETINKMESSNNISSNPTATLQWNNFNEKFKNDADFGTKLY
RQNPPEGSLFWSQESFSKEKKKNKEDNLGILNYKIFHDSALSQLVITICN
GKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVY
HGINRIDMDSKTLRLAVLDEDTIGFDWIGEYRLFLPDLNSDEEYNFSHNL
LQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCN
GFSDPFCKIYLKPDKIRITKRKTQTKKMTLNPYFNEEFVIELDQGWYKEK
TLEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWKAVYDNPNKKFDGWF
ILCADMSDVD*
back to top
Aliases
The feature 'Double C2-like domain-containing protein beta' has the following synonyms
Synonym
Smed_09132
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005515protein binding
GO:0017137Rab GTPase binding
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR041282FYVE_2
IPR030541RBF-1
IPR000008C2_dom
IPR011011Znf_FYVE_PHD
IPR013083Znf_RING/FYVE/PHD
IPR017455Znf_FYVE-rel
IPR010911Rab_BD
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
GO:0016020membrane
GO:0098793presynapse
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0006886intracellular protein transport
GO:0031340positive regulation of vesicle fusion
GO:0032024positive regulation of insulin secretion
GO:0045956positive regulation of calcium ion-dependent exocytosis
GO:0048791calcium ion-regulated exocytosis of neurotransmitter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 552..560
score: 50.52
coord: 499..511
score: 47.41
coord: 528..541
score: 47.92
IPR000008C2 domainSMARTSM00239C2_3ccoord: 483..587
e-value: 8.2E-16
score: 68.5
coord: 343..447
e-value: 1.7E-13
score: 60.8
IPR000008C2 domainPFAMPF00168C2coord: 343..449
e-value: 6.4E-18
score: 64.9
coord: 483..583
e-value: 9.8E-21
score: 74.0
IPR000008C2 domainPROSITEPS50004C2coord: 342..432
score: 16.939
IPR000008C2 domainPROSITEPS50004C2coord: 482..572
score: 17.605
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 314..457
e-value: 1.4E-30
score: 108.0
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 458..604
e-value: 1.4E-39
score: 137.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 29..192
e-value: 1.2E-19
score: 72.0
IPR041282FYVE-type zinc fingerPFAMPF02318FYVE_2coord: 35..176
e-value: 8.5E-12
score: 45.3
IPR030541Rabphilin-1PANTHERPTHR45729:SF6RABPHILIN, ISOFORM Acoord: 3..602
NoneNo IPR availablePANTHERPTHR45729FAMILY NOT NAMEDcoord: 3..602
NoneNo IPR availableCDDcd00065FYVE_like_SFcoord: 84..118
e-value: 0.00275606
score: 34.43
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 325..452
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 468..602
IPR010911Rab-binding domainPROSITEPS50916RABBDcoord: 31..179
score: 9.515
IPR017455Zinc finger, FYVE-relatedPROSITEPS50178ZF_FYVEcoord: 79..167
score: 9.474
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 36..183