SMED30000485

Overview
NameSMED30000485
Smed IDSMED30000485
Length (bp)1256
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000485 (SMED30000485) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000485 (SMED30000485) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000485 (SMED30000485) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000485 (SMED30000485) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000485

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30000485SMESG000069311.1 SmedASXL_004269SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30000485SMESG000069311.1 SMED30000485smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30000485SMESG000069311.1 SMED30000485smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30000485SMESG000069311.1 SMED30000485smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30000485SMESG000069311.1 SMED30000485smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30000485SMESG000069311.1 SMED30000485smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
tailSMED30000485SMESG000069311.1 dd_Smed_v6_11840_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000485SMESG000069311.1 dd_Smed_v4_11840_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30000485SMESG000069311.1 dd_Smed_v4_11840_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000485SMESG000069311.1 dd_Smed_v4_11840_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000485SMESG000069311.1 dd_Smed_v4_11840_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30000485SMESG000069311.1 dd_Smed_v4_11840_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000485 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000179:84051..85450 -6157
Homology
BLAST of SMED30000485 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 193.741 bits (491), Expect = 1.124e-54
Identity = 95/189 (50.26%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW----TVSICPGSDLN-----------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++++I +  LK H       +  PG  L             DI    D LE+  D I++  +++
Sbjct:  434 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVE 622          
BLAST of SMED30000485 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 194.126 bits (492), Expect = 2.918e-54
Identity = 95/189 (50.26%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW----TVSICPGSDLN-----------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++++I +  LK H       +  PG  L             DI    D LE+  D I++  +++
Sbjct:  532 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVE 720          
BLAST of SMED30000485 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 194.126 bits (492), Expect = 2.918e-54
Identity = 95/189 (50.26%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW----TVSICPGSDLN-----------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++++I +  LK H       +  PG  L             DI    D LE+  D I++  +++
Sbjct:  532 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVE 720          
BLAST of SMED30000485 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 194.126 bits (492), Expect = 2.918e-54
Identity = 95/189 (50.26%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW----TVSICPGSDLN-----------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++++I +  LK H       +  PG  L             DI    D LE+  D I++  +++
Sbjct:  532 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVE 720          
BLAST of SMED30000485 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 193.741 bits (491), Expect = 4.846e-54
Identity = 95/189 (50.26%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW----TVSICPGSDLN-----------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++++I +  LK H       +  PG  L             DI    D LE+  D I++  +++
Sbjct:  568 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVE 756          
BLAST of SMED30000485 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 194.126 bits (492), Expect = 1.312e-54
Identity = 88/161 (54.66%), Postives = 112/161 (69.57%), Query Frame = 1
Query:  691 KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLN-------VDIEQKLD 1152
            K++Y C+ C K FGQLSNLKVH RTHTGERPFKC +C K FTQLAHLQKH+LVHTGERPH C +C KRFSS+SNLKTH RLHN +K   C +C  +F+   +L++H R H  E PY C  C + +I+ SGL+ HW  + C   D+        +DI+ ++D
Sbjct:  505 KTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSMRDDLMDIKGEID 665          
BLAST of SMED30000485 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 194.126 bits (492), Expect = 1.409e-54
Identity = 88/161 (54.66%), Postives = 112/161 (69.57%), Query Frame = 1
Query:  691 KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLN-------VDIEQKLD 1152
            K++Y C+ C K FGQLSNLKVH RTHTGERPFKC +C K FTQLAHLQKH+LVHTGERPH C +C KRFSS+SNLKTH RLHN +K   C +C  +F+   +L++H R H  E PY C  C + +I+ SGL+ HW  + C   D+        +DI+ ++D
Sbjct:  505 KTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSMRDDLMDIKGEID 665          
BLAST of SMED30000485 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 102.449 bits (254), Expect = 3.466e-25
Identity = 51/121 (42.15%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  658 LSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHH 1020
            L   R   R     ++CQ C K F Q +NL  H+R HTGE+PF C +C + F+Q + L  H   HTGERP+ C+ C K F+ SS L  H R H   K   C IC  +F+ S  L  HM+ H
Sbjct:   93 LPVQRPMARSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          

HSP 2 Score: 93.5893 bits (231), Expect = 5.809e-22
Identity = 45/106 (42.45%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  778 RPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            +PF+C  CGK F+Q A+L  H  +HTGE+P  C VC + FS SS+L TH R H  E+   C  C+  F++S+ L  H+R HT   PY C  C   F     L  H 
Sbjct:  105 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHM 210          
BLAST of SMED30000485 vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 103.219 bits (256), Expect = 7.955e-25
Identity = 51/121 (42.15%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  658 LSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHH 1020
            L   R   R     ++CQ C K F Q +NL  H+R HTGE+PF C +C + F+Q + L  H   HTGERP+ C+ C K F+ SS L  H R H   K   C IC  +F+ S  L  HM+ H
Sbjct:  152 LPVQRPMARSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 272          

HSP 2 Score: 93.9745 bits (232), Expect = 1.328e-21
Identity = 45/105 (42.86%), Postives = 59/105 (56.19%), Query Frame = 1
Query:  778 RPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            +PF+C  CGK F+Q A+L  H  +HTGE+P  C VC + FS SS+L TH R H  E+   C  C+  F++S+ L  H+R HT   PY C  C   F     L  H
Sbjct:  164 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRH 268          
BLAST of SMED30000485 vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 103.99 bits (258), Expect = 1.363e-24
Identity = 54/141 (38.30%), Postives = 79/141 (56.03%), Query Frame = 1
Query:  649 SPSLS-YNRSPKRGHKSK-YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESF 1065
            SPS S +NR+P    + K + CQ C K F  ++ L+ HQ+ H  ++ F+C  CGK F + + L  H L+H+  RP+ C  C KRF   S++K H+ +H  EK  +C +C   FS S+ L  H R HT   P+ C  C  +F
Sbjct:  107 SPSASVWNRTPTPPVEIKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTF 247          

HSP 2 Score: 98.9821 bits (245), Expect = 7.405e-23
Identity = 46/121 (38.02%), Postives = 68/121 (56.20%), Query Frame = 1
Query:  697 KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNE 1059
            +++C+ C K F + S L  H   H+  RP+ C  CGK F Q + ++KH  +HTGE+PH+C+VC K FS SSNL TH+R H   K   C +C   F      + H   H    P +C++ ++
Sbjct:  153 QFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHPGHPEECVSASQ 273          

HSP 3 Score: 73.559 bits (179), Expect = 2.878e-14
Identity = 37/105 (35.24%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  778 RPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            +PF C  C K F+ +A L++H  VH  ++  EC  C K F  SS L TH  +H+  +   C+ C  +F   + +K H   HT E P++C  C ++F   S L  H
Sbjct:  124 KPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITH 228          
BLAST of SMED30000485 vs. Ensembl Fly
Match: Blimp-1 (gene:FBgn0035625 transcript:FBtr0331808)

HSP 1 Score: 196.052 bits (497), Expect = 1.062e-54
Identity = 97/190 (51.05%), Postives = 126/190 (66.32%), Query Frame = 1
Query:  577 PFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKS------------KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSIC 1110
            P  I+ P    S+SP+      S SP LS N    RG++S             Y+C +CCK FGQLSNLKVH RTH+GERPFKC++C K FTQLAHLQKH+LVHTGE+PH+C +C KRFSS+SNLKTH RLH+ +K   C +C  +F+   +LK+H R HT + PY C  C++ +I+ SGL+ HW  + C
Sbjct:  828 PLRISPPS---SLSPDGNSCPRSGSP-LSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSC 1013          
BLAST of SMED30000485 vs. Ensembl Fly
Match: Blimp-1 (gene:FBgn0035625 transcript:FBtr0345593)

HSP 1 Score: 196.052 bits (497), Expect = 1.062e-54
Identity = 97/190 (51.05%), Postives = 126/190 (66.32%), Query Frame = 1
Query:  577 PFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKS------------KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSIC 1110
            P  I+ P    S+SP+      S SP LS N    RG++S             Y+C +CCK FGQLSNLKVH RTH+GERPFKC++C K FTQLAHLQKH+LVHTGE+PH+C +C KRFSS+SNLKTH RLH+ +K   C +C  +F+   +LK+H R HT + PY C  C++ +I+ SGL+ HW  + C
Sbjct:  828 PLRISPPS---SLSPDGNSCPRSGSP-LSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSC 1013          
BLAST of SMED30000485 vs. Ensembl Fly
Match: Blimp-1 (gene:FBgn0035625 transcript:FBtr0077089)

HSP 1 Score: 196.052 bits (497), Expect = 1.062e-54
Identity = 97/190 (51.05%), Postives = 126/190 (66.32%), Query Frame = 1
Query:  577 PFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKS------------KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSIC 1110
            P  I+ P    S+SP+      S SP LS N    RG++S             Y+C +CCK FGQLSNLKVH RTH+GERPFKC++C K FTQLAHLQKH+LVHTGE+PH+C +C KRFSS+SNLKTH RLH+ +K   C +C  +F+   +LK+H R HT + PY C  C++ +I+ SGL+ HW  + C
Sbjct:  828 PLRISPPS---SLSPDGNSCPRSGSP-LSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSC 1013          
BLAST of SMED30000485 vs. Ensembl Fly
Match: Blimp-1 (gene:FBgn0035625 transcript:FBtr0331809)

HSP 1 Score: 196.052 bits (497), Expect = 1.062e-54
Identity = 97/190 (51.05%), Postives = 126/190 (66.32%), Query Frame = 1
Query:  577 PFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKS------------KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSIC 1110
            P  I+ P    S+SP+      S SP LS N    RG++S             Y+C +CCK FGQLSNLKVH RTH+GERPFKC++C K FTQLAHLQKH+LVHTGE+PH+C +C KRFSS+SNLKTH RLH+ +K   C +C  +F+   +LK+H R HT + PY C  C++ +I+ SGL+ HW  + C
Sbjct:  828 PLRISPPS---SLSPDGNSCPRSGSP-LSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSC 1013          
BLAST of SMED30000485 vs. Ensembl Fly
Match: Blimp-1 (gene:FBgn0035625 transcript:FBtr0331806)

HSP 1 Score: 196.052 bits (497), Expect = 1.177e-54
Identity = 97/190 (51.05%), Postives = 126/190 (66.32%), Query Frame = 1
Query:  577 PFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKS------------KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSIC 1110
            P  I+ P    S+SP+      S SP LS N    RG++S             Y+C +CCK FGQLSNLKVH RTH+GERPFKC++C K FTQLAHLQKH+LVHTGE+PH+C +C KRFSS+SNLKTH RLH+ +K   C +C  +F+   +LK+H R HT + PY C  C++ +I+ SGL+ HW  + C
Sbjct:  841 PLRISPPS---SLSPDGNSCPRSGSP-LSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSC 1026          
BLAST of SMED30000485 vs. Ensembl Zebrafish
Match: prdm1a (PR domain containing 1a, with ZNF domain [Source:ZFIN;Acc:ZDB-GENE-030131-2193])

HSP 1 Score: 193.356 bits (490), Expect = 3.318e-54
Identity = 97/178 (54.49%), Postives = 119/178 (66.85%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH-----WTVSICPGSDLN-----------VDIEQKLDMLEE 1164
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C+IC  +F+   +LK+H R HTRE P+QC +C+ ++I +S L++H       VS  P   L+            DI    D LEE
Sbjct:  515 KQNGKIKYECNVCTKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKICPAKFTQFVHLKLHKRLHTRERPHQCPHCHHNYIHLSSLRFHLKGYCLAVSPSPSCSLDELNRVNEEIERFDISDNADRLEE 692          
BLAST of SMED30000485 vs. Ensembl Zebrafish
Match: zgc:171727 (zgc:171727 [Source:ZFIN;Acc:ZDB-GENE-071004-26])

HSP 1 Score: 128.642 bits (322), Expect = 2.194e-34
Identity = 65/134 (48.51%), Postives = 80/134 (59.70%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C+ C + F Q+ +L+VH RTHTG++PF C  CGK F Q AHL  H  VHTGE+P  C +C K F+   NL+ H  LH  EK   CQ C+  FS    LKMHMR HT E PY C  C ++F   SGL  H  V
Sbjct:   94 FTCKQCGQGFNQIQHLEVHMRTHTGQKPFTCRKCGKSFAQKAHLIDHMRVHTGEKPFVCYLCGKGFTQKQNLQVHMNLHTGEKRFNCQQCEKSFSVKHTLKMHMRVHTGEKPYACSGCGKAFKQKSGLYSHNKV 227          

HSP 2 Score: 72.0182 bits (175), Expect = 5.738e-14
Identity = 42/107 (39.25%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQ-----------------------KHNL-----VHTGERPHECSVCLKRFSSSSNLKTHSRLH 936
            + C+ C K F Q ++L  H R HTGE+PF C+LCGKGFTQ  +LQ                       KH L     VHTGE+P+ CS C K F   S L +H++++
Sbjct:  122 FTCRKCGKSFAQKAHLIDHMRVHTGEKPFVCYLCGKGFTQKQNLQVHMNLHTGEKRFNCQQCEKSFSVKHTLKMHMRVHTGEKPYACSGCGKAFKQKSGLYSHNKVY 228          

HSP 3 Score: 65.0846 bits (157), Expect = 1.396e-11
Identity = 34/108 (31.48%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  778 RPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + + C  CGK F +  +L+ H  VH G++   C  C + F+   +L+ H R H  +K   C+ C   F+   +L  HMR HT E P+ C  C + F     L+ H  +
Sbjct:   64 KSYMCRHCGKSFCREKNLEIHMRVHFGDKLFTCKQCGQGFNQIQHLEVHMRTHTGQKPFTCRKCGKSFAQKAHLIDHMRVHTGEKPFVCYLCGKGFTQKQNLQVHMNL 171          

HSP 4 Score: 50.447 bits (119), Expect = 1.177e-6
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 1
Query:  697 KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVH 852
            ++ CQ C K F     LK+H R HTGE+P+ C  CGK F Q + L  HN V+
Sbjct:  177 RFNCQQCEKSFSVKHTLKMHMRVHTGEKPYACSGCGKAFKQKSGLYSHNKVY 228          
BLAST of SMED30000485 vs. Ensembl Zebrafish
Match: zgc:113343 (zgc:113343 [Source:ZFIN;Acc:ZDB-GENE-050327-90])

HSP 1 Score: 130.568 bits (327), Expect = 7.147e-34
Identity = 64/131 (48.85%), Postives = 86/131 (65.65%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            YQC  C K+F   ++LKVHQR HTGE+P++C  CGK FTQLA L+ H  +HTG +P+ CS C K FS+SS+L  H R+H  EK  +C  C   F+ +  LK H + HT E P+QC +C +SF  +S L+ H
Sbjct:  215 YQCSHCAKNFTYSNSLKVHQRIHTGEKPYRCSSCGKSFTQLASLKAHQRIHTGVKPYVCSDCGKSFSTSSSLTAHRRIHTGEKPYQCSHCGKSFNRTGGLKDHQKVHTGEKPHQCSSCGKSFTQMSNLRVH 345          

HSP 2 Score: 106.686 bits (265), Expect = 2.738e-25
Identity = 56/130 (43.08%), Postives = 73/130 (56.15%), Query Frame = 1
Query:  712 ICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
             C K +  ++ L  HQR HTGE+ ++C  C K FT    L+ H  +HTGE+P+ CS C K F+  ++LK H R+H   K   C  C   FS S+ L  H R HT E PYQC +C +SF    GLK H  V
Sbjct:  191 FCGKSYTTMNMLNEHQRIHTGEKLYQCSHCAKNFTYSNSLKVHQRIHTGEKPYRCSSCGKSFTQLASLKAHQRIHTGVKPYVCSDCGKSFSTSSSLTAHRRIHTGEKPYQCSHCGKSFNRTGGLKDHQKV 320          

HSP 3 Score: 95.1301 bits (235), Expect = 2.930e-21
Identity = 44/104 (42.31%), Postives = 65/104 (62.50%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHM 1011
            Y+C  C K F QL++LK HQR HTG +P+ C  CGK F+  + L  H  +HTGE+P++CS C K F+ +  LK H ++H  EK  +C  C   F+  + L++H+
Sbjct:  243 YRCSSCGKSFTQLASLKAHQRIHTGVKPYVCSDCGKSFSTSSSLTAHRRIHTGEKPYQCSHCGKSFNRTGGLKDHQKVHTGEKPHQCSSCGKSFTQMSNLRVHI 346          

HSP 4 Score: 90.1225 bits (222), Expect = 1.875e-19
Identity = 50/134 (37.31%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C  C K F Q   L  H R HTGERP+ C  CGK +   A L+ H   H+GE+P  C  C K F     LK H   HN+ K   C  C   F+   YL+ H+  H    PY C  C +S+ T++ L  H  +
Sbjct:   76 FTCTQCGKDFVQKGQLDKHMRIHTGERPYACSQCGKSYNDAATLKMHTKTHSGEKPFTCIQCGKSFIYRKTLKDHQLSHNAVKPFSCDQCSKAFTLEKYLRQHLHVHAAVKPYVCF-CGKSYTTMNMLNEHQRI 208          

HSP 5 Score: 87.0409 bits (214), Expect = 1.796e-18
Identity = 52/175 (29.71%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  577 PFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            P  I +      I  +   +++ T  +    ++ +   +  + C  C K +    +L  H R H+G+  F C  CGK F Q   L KH  +HTGERP+ CS C K ++ ++ LK H++ H+ EK   C  C   F     LK H   H    P+ C  C+++F     L+ H  V
Sbjct:    7 PCRIKEEETEEQIDADENAVSSQTEDTSRPKQAGRTAVEGSFICSECGKSYKSKDSLYRHTRFHSGQGLFTCTQCGKDFVQKGQLDKHMRIHTGERPYACSQCGKSYNDAATLKMHTKTHSGEKPFTCIQCGKSFIYRKTLKDHQLSHNAVKPFSCDQCSKAFTLEKYLRQHLHV 181          

HSP 6 Score: 82.4185 bits (202), Expect = 6.339e-17
Identity = 41/86 (47.67%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCE 957
            Y C  C K F   S+L  H+R HTGE+P++C  CGK F +   L+ H  VHTGE+PH+CS C K F+  SNL+ H    +S KL E
Sbjct:  271 YVCSDCGKSFSTSSSLTAHRRIHTGEKPYQCSHCGKSFNRTGGLKDHQKVHTGEKPHQCSSCGKSFTQMSNLRVHIEKIHSPKLLE 356          
BLAST of SMED30000485 vs. Ensembl Zebrafish
Match: BX005380.2 (pep chromosome:GRCz11:4:51151834:51159094:-1 gene:ENSDARG00000110454.1 transcript:ENSDART00000193565.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX005380.2)

HSP 1 Score: 125.176 bits (313), Expect = 2.488e-33
Identity = 63/141 (44.68%), Postives = 84/141 (59.57%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            KR +K+++ C  C K  G+  NLK+H R HTGE+P+ C  CGK F + +HL +H  +HTGE+P  C+ C K FS SS+LK H  +H  EK   C  C   FS S+ L  HMR HT E P+ C  C +SF   S L +H  +
Sbjct:   59 KRRNKNRFTCTQCGKSLGRKDNLKIHMRIHTGEKPYACTQCGKSFIRSSHLNEHMRIHTGEKPFTCTQCGKSFSCSSHLKQHMIIHTGEKPFACTQCGKSFSRSSSLNHHMRIHTGEKPFTCTQCRKSFSRSSSLNHHMRI 199          

HSP 2 Score: 108.612 bits (270), Expect = 2.996e-27
Identity = 55/115 (47.83%), Postives = 71/115 (61.74%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQC 1044
            Y C  C K F + S+L  H R HTGE+PF C  CGK F+  +HL++H ++HTGE+P  C+ C K FS SS+L  H R+H  EK   C  C+  FS S+ L  HMR HT E P+ C
Sbjct:   94 YACTQCGKSFIRSSHLNEHMRIHTGEKPFTCTQCGKSFSCSSHLKQHMIIHTGEKPFACTQCGKSFSRSSSLNHHMRIHTGEKPFTCTQCRKSFSRSSSLNHHMRIHTGEKPFTC 208          

HSP 3 Score: 55.8398 bits (133), Expect = 1.466e-8
Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECS 879
            + C  C K F + S+L  H R HTGE+PF C  C K F++ + L  H  +HTGE+P  C+
Sbjct:  150 FACTQCGKSFSRSSSLNHHMRIHTGEKPFTCTQCRKSFSRSSSLNHHMRIHTGEKPFTCT 209          
BLAST of SMED30000485 vs. Ensembl Zebrafish
Match: si:dkey-199m13.5 (si:dkey-199m13.5 [Source:ZFIN;Acc:ZDB-GENE-110913-174])

HSP 1 Score: 126.331 bits (316), Expect = 3.296e-33
Identity = 65/141 (46.10%), Postives = 85/141 (60.28%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            KR  K++  C  C K FG+ SNLK+H R HTGE+PF C  CG+ F   +HL+ H ++HTGE+P  C+ C K F  SS+L  H R+H  EK   C  C   FS S+YLK H+R HT E P+ C  C +SF   S L +H  +
Sbjct:   59 KRRDKNRLTCTQCGKSFGKQSNLKIHMRIHTGEKPFTCTQCGRSFNCSSHLKLHMMIHTGEKPFTCTQCGKSFIRSSSLNLHMRIHTGEKPFTCTQCGKSFSYSSYLKQHIRIHTGEKPFACTLCGKSFSCSSHLYHHMRI 199          

HSP 2 Score: 112.079 bits (279), Expect = 7.482e-28
Identity = 56/122 (45.90%), Postives = 75/122 (61.48%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESF 1065
            + C  C K F + S+L +H R HTGE+PF C  CGK F+  ++L++H  +HTGE+P  C++C K FS SS+L  H R+H  EK   C  C   FS S+ L  HMR HT E P+ C  C +SF
Sbjct:  122 FTCTQCGKSFIRSSSLNLHMRIHTGEKPFTCTQCGKSFSYSSYLKQHIRIHTGEKPFACTLCGKSFSCSSHLYHHMRIHTGEKPFSCTQCGKSFSRSSSLNQHMRIHTGEKPFTCTQCGKSF 243          

HSP 3 Score: 111.694 bits (278), Expect = 8.796e-28
Identity = 59/134 (44.03%), Postives = 76/134 (56.72%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C  C + F   S+LK+H   HTGE+PF C  CGK F + + L  H  +HTGE+P  C+ C K FS SS LK H R+H  EK   C +C   FS S++L  HMR HT E P+ C  C +SF   S L  H  +
Sbjct:   94 FTCTQCGRSFNCSSHLKLHMMIHTGEKPFTCTQCGKSFIRSSSLNLHMRIHTGEKPFTCTQCGKSFSYSSYLKQHIRIHTGEKPFACTLCGKSFSCSSHLYHHMRIHTGEKPFSCTQCGKSFSRSSSLNQHMRI 227          

HSP 4 Score: 106.301 bits (264), Expect = 8.325e-26
Identity = 55/115 (47.83%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQC 1044
            + C  C K F   S LK H R HTGE+PF C LCGK F+  +HL  H  +HTGE+P  C+ C K FS SS+L  H R+H  EK   C  C   FS   YL +HM  HT E P+ C
Sbjct:  150 FTCTQCGKSFSYSSYLKQHIRIHTGEKPFACTLCGKSFSCSSHLYHHMRIHTGEKPFSCTQCGKSFSRSSSLNQHMRIHTGEKPFTCTQCGKSFSRPPYLNLHMMSHTGEKPFTC 264          

HSP 5 Score: 59.3066 bits (142), Expect = 1.714e-9
Identity = 27/60 (45.00%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECS 879
            + C  C K F + S+L  H R HTGE+PF C  CGK F++  +L  H + HTGE+P  C+
Sbjct:  206 FSCTQCGKSFSRSSSLNQHMRIHTGEKPFTCTQCGKSFSRPPYLNLHMMSHTGEKPFTCT 265          
BLAST of SMED30000485 vs. Ensembl Xenopus
Match: chac2 (ChaC, cation transport regulator homolog 2 [Source:Xenbase;Acc:XB-GENE-5817326])

HSP 1 Score: 189.504 bits (480), Expect = 8.281e-53
Identity = 96/181 (53.04%), Postives = 122/181 (67.40%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGS--------DLN--------VDIEQKLDMLEEATD 1173
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C++C++S+I +  L +H   + CP S        DLN         DI    D L++  D
Sbjct:  496 KQNGKIKYECNVCSKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHFLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLKLHKRLHTRERPHKCIHCHKSYIHLCSLNFHMKGN-CPVSPRLGVSREDLNRMNEEIEKFDISDSADRLDDMED 675          
BLAST of SMED30000485 vs. Ensembl Xenopus
Match: chac2 (ChaC, cation transport regulator homolog 2 [Source:Xenbase;Acc:XB-GENE-5817326])

HSP 1 Score: 189.504 bits (480), Expect = 9.531e-53
Identity = 96/181 (53.04%), Postives = 122/181 (67.40%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGS--------DLN--------VDIEQKLDMLEEATD 1173
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C++C++S+I +  L +H   + CP S        DLN         DI    D L++  D
Sbjct:  527 KQNGKIKYECNVCSKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHFLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLKLHKRLHTRERPHKCIHCHKSYIHLCSLNFHMKGN-CPVSPRLGVSREDLNRMNEEIEKFDISDSADRLDDMED 706          
BLAST of SMED30000485 vs. Ensembl Xenopus
Match: ZBTB14 (zinc finger and BTB domain containing 14 [Source:NCBI gene;Acc:100487514])

HSP 1 Score: 130.183 bits (326), Expect = 6.585e-33
Identity = 55/136 (40.44%), Postives = 83/136 (61.03%), Query Frame = 1
Query:  685 GHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            GH+ ++ CQ C K F   + L+ H++ HT +RPF C +C K FT  AHL++H  +HTG +P+ C VC K F  + +LK H R+H++E+   C +C   F + ++LK H R H  E P+ C +C ++F   S LK H
Sbjct:  274 GHREQFACQACGKTFTDEARLRKHEKLHTADRPFVCEMCAKAFTTQAHLKEHLKIHTGYKPYSCEVCAKSFIRAPDLKKHERVHSNERPFACHLCDKAFKHKSHLKDHERRHRGEKPFICASCTKAFAKASDLKRH 409          

HSP 2 Score: 86.6557 bits (213), Expect = 6.416e-18
Identity = 43/118 (36.44%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  739 SNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            S++K     +     F C  CGK FT  A L+KH  +HT +RP  C +C K F++ ++LK H ++H   K   C++C   F  +  LK H R H+ E P+ C  C+++F   S LK H
Sbjct:  264 SDMKFEYLLYGHREQFACQACGKTFTDEARLRKHEKLHTADRPFVCEMCAKAFTTQAHLKEHLKIHTGYKPYSCEVCAKSFIRAPDLKKHERVHSNERPFACHLCDKAFKHKSHLKDH 381          

HSP 3 Score: 86.2705 bits (212), Expect = 1.043e-17
Identity = 37/83 (44.58%), Postives = 52/83 (62.65%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEK 948
            Y C++C K F +  +LK H+R H+ ERPF CHLC K F   +HL+ H   H GE+P  C+ C K F+ +S+LK H    +SE+
Sbjct:  335 YSCEVCAKSFIRAPDLKKHERVHSNERPFACHLCDKAFKHKSHLKDHERRHRGEKPFICASCTKAFAKASDLKRHENNMHSEQ 417          

HSP 4 Score: 61.2326 bits (147), Expect = 1.355e-9
Identity = 27/76 (35.53%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  874 CSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            C  C K F+  + L+ H +LH +++   C++C   F+   +LK H++ HT   PY C  C +SFI    LK H  V
Sbjct:  281 CQACGKTFTDEARLRKHEKLHTADRPFVCEMCAKAFTTQAHLKEHLKIHTGYKPYSCEVCAKSFIRAPDLKKHERV 356          
BLAST of SMED30000485 vs. Ensembl Xenopus
Match: ENSXETT00000036615.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:69279223:69283644:-1 gene:ENSXETG00000016061.1 transcript:ENSXETT00000036615.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 5.241e-31
Identity = 68/177 (38.42%), Postives = 97/177 (54.80%), Query Frame = 1
Query:  580 FSINKPIQSPSISPNLKCLT---ASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            F  N+P   P   PN        A T+P +  ++ P    +  Y C +C K FG  S L  H R HTGE+PF C+ C K F   ++L +H   HTGE+P+ CSVCLK FS +S++  H R+H  E+  +C  C+ +FS+ +Y   HMR H+ E PY+C +C + F   S L  H  +
Sbjct:   97 FEKNEPKSIPKEGPNESERDEGLACTNP-VKMDQKPSVPKERLYICSVCGKSFGGNSLLVRHMRIHTGEKPFACNHCDKSFNDKSYLLRHLRTHTGEKPYSCSVCLKCFSQNSSVIAHMRIHTGERPFQCPECEKRFSDKSYFVRHMRTHSGEKPYKCSHCEKCFSQTSSLTSHMRI 272          

HSP 2 Score: 106.686 bits (265), Expect = 2.346e-25
Identity = 60/138 (43.48%), Postives = 77/138 (55.80%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICP 1113
            + C  C K F   S L  H RTHTGE+P+ C +C K F+Q + +  H  +HTGERP +C  C KRFS  S    H R H+ EK  +C  C+  FS ++ L  HMR HT E PY+C +C + F   S L     VS CP
Sbjct:  167 FACNHCDKSFNDKSYLLRHLRTHTGEKPYSCSVCLKCFSQNSSVIAHMRIHTGERPFQCPECEKRFSDKSYFVRHMRTHSGEKPYKCSHCEKCFSQTSSLTSHMRIHTGEKPYKCSDCGKCFSQNSSL-----VSGCP 299          
BLAST of SMED30000485 vs. Ensembl Xenopus
Match: crp.4 (C-reactive protein, pentraxin-related, gene 4 [Source:Xenbase;Acc:XB-GENE-1018594])

HSP 1 Score: 126.716 bits (317), Expect = 7.247e-31
Identity = 57/140 (40.71%), Postives = 81/140 (57.86%), Query Frame = 1
Query:  679 KRGHKSK--YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            KR H  +  ++C IC KHF Q  NL+ H R H+GE+P+ C +CGK F     +Q+H ++HTGE+PH C +C + FS+ SNLK H + H ++K+  C  C   F+    L  H   HT E PY C+ C + F     L+ H
Sbjct:  532 KRSHTGEKPFECSICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAVSGDVQRHIVIHTGEKPHLCDICGRGFSNVSNLKEHEKTHVADKIFTCDECGKSFNMHRKLIKHRIRHTGEKPYNCVTCGKKFAGSGDLRRH 671          

HSP 2 Score: 117.472 bits (293), Expect = 8.784e-28
Identity = 53/120 (44.17%), Postives = 76/120 (63.33%), Query Frame = 1
Query:  706 CQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESF 1065
            C IC K F   SNL++H+R+HTGE+PF+C +CGK F+Q  +LQ H   H+GE+P+ C +C KRF+ S +++ H  +H  EK   C IC   FSN + LK H + H  +  + C  C +SF
Sbjct:  515 CNICGKRFKHPSNLELHKRSHTGEKPFECSICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAVSGDVQRHIVIHTGEKPHLCDICGRGFSNVSNLKEHEKTHVADKIFTCDECGKSF 634          

HSP 3 Score: 99.7525 bits (247), Expect = 7.500e-22
Identity = 48/133 (36.09%), Postives = 72/133 (54.14%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWT 1098
            Y C+IC K F    +++ H   HTGE+P  C +CG+GF+ +++L++H   H  ++   C  C K F+    L  H   H  EK   C  C  +F+ S  L+ H+R HT E PY C  CN++F   + L+ H T
Sbjct:  569 YICEICGKRFAVSGDVQRHIVIHTGEKPHLCDICGRGFSNVSNLKEHEKTHVADKIFTCDECGKSFNMHRKLIKHRIRHTGEKPYNCVTCGKKFAGSGDLRRHVRSHTGERPYTCDVCNKNFSRSAVLRRHKT 701          

HSP 4 Score: 97.8265 bits (242), Expect = 3.052e-21
Identity = 43/107 (40.19%), Postives = 61/107 (57.01%), Query Frame = 1
Query:  706 CQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTR 1026
            C IC + F  +SNLK H++TH  ++ F C  CGK F     L KH + HTGE+P+ C  C K+F+ S +L+ H R H  E+   C +C   FS S  L+ H   H++
Sbjct:  599 CDICGRGFSNVSNLKEHEKTHVADKIFTCDECGKSFNMHRKLIKHRIRHTGEKPYNCVTCGKKFAGSGDLRRHVRSHTGERPYTCDVCNKNFSRSAVLRRHKTTHSK 705          

HSP 5 Score: 92.8189 bits (229), Expect = 1.324e-19
Identity = 45/101 (44.55%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  790 CHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            C++CGK F   ++L+ H   HTGE+P ECS+C K FS + NL+TH R H+ EK   C+IC  +F+ S  ++ H+  HT E P+ C  C   F  VS LK H
Sbjct:  515 CNICGKRFKHPSNLELHKRSHTGEKPFECSICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAVSGDVQRHIVIHTGEKPHLCDICGRGFSNVSNLKEH 615          
BLAST of SMED30000485 vs. Ensembl Mouse
Match: Prdm1 (PR domain containing 1, with ZNF domain [Source:MGI Symbol;Acc:MGI:99655])

HSP 1 Score: 197.208 bits (500), Expect = 1.892e-55
Identity = 96/189 (50.79%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH-------WTVSICPGSDLN--------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++S+I +  LK H          +  P  DL          DI    D LE+  DS+++  +++
Sbjct:  566 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSYIHLCSLKVHLKGNCPAGPAAGLPLEDLTRINEEIERFDISDNADRLEDMEDSVDVTSMVE 754          
BLAST of SMED30000485 vs. Ensembl Mouse
Match: Prdm1 (PR domain containing 1, with ZNF domain [Source:MGI Symbol;Acc:MGI:99655])

HSP 1 Score: 197.208 bits (500), Expect = 2.497e-55
Identity = 96/189 (50.79%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH-------WTVSICPGSDLN--------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++S+I +  LK H          +  P  DL          DI    D LE+  DS+++  +++
Sbjct:  581 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSYIHLCSLKVHLKGNCPAGPAAGLPLEDLTRINEEIERFDISDNADRLEDMEDSVDVTSMVE 769          
BLAST of SMED30000485 vs. Ensembl Mouse
Match: Prdm1 (PR domain containing 1, with ZNF domain [Source:MGI Symbol;Acc:MGI:99655])

HSP 1 Score: 196.823 bits (499), Expect = 3.874e-55
Identity = 96/189 (50.79%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH-------WTVSICPGSDLN--------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++S+I +  LK H          +  P  DL          DI    D LE+  DS+++  +++
Sbjct:  599 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSYIHLCSLKVHLKGNCPAGPAAGLPLEDLTRINEEIERFDISDNADRLEDMEDSVDVTSMVE 787          
BLAST of SMED30000485 vs. Ensembl Mouse
Match: Zfp683 (zinc finger protein 683 [Source:MGI Symbol;Acc:MGI:3650254])

HSP 1 Score: 152.91 bits (385), Expect = 3.052e-41
Identity = 71/112 (63.39%), Postives = 85/112 (75.89%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMR 1014
            K   K  Y+C +C K+FGQLSNLKVH R H+GERPF+C LC K FTQLAHLQKH+LVHTGERPH+C VC KRFSSSSNLKTH RLH+  K  +C +C +  + + Y K+H R
Sbjct:  294 KENGKILYECNVCGKNFGQLSNLKVHLRVHSGERPFQCALCQKRFTQLAHLQKHHLVHTGERPHQCQVCHKRFSSSSNLKTHLRLHSGAKPSQCGLCPSYLTPNVYPKLHHR 405          

HSP 2 Score: 90.5077 bits (223), Expect = 2.700e-19
Identity = 41/96 (42.71%), Postives = 67/96 (69.79%), Query Frame = 1
Query:  784 FKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFIT 1071
            ++C++CGK F QL++L+ H  VH+GERP +C++C KRF+  ++L+ H  +H  E+  +CQ+C  +FS+S+ LK H+R H+   P QC  C  S++T
Sbjct:  301 YECNVCGKNFGQLSNLKVHLRVHSGERPFQCALCQKRFTQLAHLQKHHLVHTGERPHQCQVCHKRFSSSSNLKTHLRLHSGAKPSQCGLC-PSYLT 395          

HSP 3 Score: 66.2402 bits (160), Expect = 2.376e-11
Identity = 31/75 (41.33%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  868 HECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            +EC+VC K F   SNLK H R+H+ E+  +C +C+ +F+   +L+ H   HT E P+QC  C++ F + S LK H
Sbjct:  301 YECNVCGKNFGQLSNLKVHLRVHSGERPFQCALCQKRFTQLAHLQKHHLVHTGERPHQCQVCHKRFSSSSNLKTH 375          
BLAST of SMED30000485 vs. Ensembl Mouse
Match: Zfp93 (zinc finger protein 93 [Source:MGI Symbol;Acc:MGI:107611])

HSP 1 Score: 145.976 bits (367), Expect = 8.213e-38
Identity = 81/176 (46.02%), Postives = 104/176 (59.09%), Query Frame = 1
Query:  595 PIQSPSISPNLK------CLTA-STSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            PIQ PS+ P  K      C      S +L  ++    G K  Y+C  C K F + S+L +H+R HTGE+P+KC +CGKGFTQ AHLQ H  +HTGE+P++C  C KRFS SSNL TH R+H  EK  EC  C  +FS S  L +H R HT E PY+C  C + F + S  + H  V
Sbjct:  273 PIQ-PSVHPGRKRYWCHECGKGFRQSSALQTHQRVHTGEKP-YRCDSCGKGFSRSSDLNIHRRVHTGEKPYKCEVCGKGFTQWAHLQAHERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYECNECGKRFSLSGNLDIHQRVHTGEKPYKCEECGKGFSSASSFQSHQRV 446          

HSP 2 Score: 125.561 bits (314), Expect = 9.213e-31
Identity = 60/134 (44.78%), Postives = 84/134 (62.69%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y+C++C K F    +L  HQ  HTG++P+KC  CGKGF+  + LQ H+ VHTGE+P +C+VC K+FS +SNL+ H R+H  EK  +C  C   FS  + L++H R HT E P++C  C + F    GL  H  V
Sbjct:  481 YRCEVCGKRFPWSLSLHSHQSVHTGKKPYKCGECGKGFSHASSLQAHHSVHTGEKPFKCNVCQKQFSKTSNLQAHQRVHTGEKPYKCDTCGKAFSQKSSLQVHQRIHTGEKPFKCEECGKEFRWSVGLSSHQRV 614          

HSP 3 Score: 125.176 bits (313), Expect = 1.450e-30
Identity = 61/134 (45.52%), Postives = 78/134 (58.21%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y+C  C K F    NL +HQR HTGE+P+KC  CGKGF+  +  Q H  VHTGE+P  CSVC K FS SS+   H R+H  EK   C++C  +F  S  L  H   HT + PY+C  C + F   S L+ H +V
Sbjct:  397 YECNECGKRFSLSGNLDIHQRVHTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFHCSVCGKNFSRSSHFLDHQRIHTGEKPYRCEVCGKRFPWSLSLHSHQSVHTGKKPYKCGECGKGFSHASSLQAHHSV 530          

HSP 4 Score: 119.013 bits (297), Expect = 1.474e-28
Identity = 59/137 (43.07%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  691 KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            K  Y+C  C K F   S+L+ H   HTGE+PFKC++C K F++ ++LQ H  VHTGE+P++C  C K FS  S+L+ H R+H  EK  +C+ C  +F  S  L  H R HT E PY C  C + F   S    H  V
Sbjct:  506 KKPYKCGECGKGFSHASSLQAHHSVHTGEKPFKCNVCQKQFSKTSNLQAHQRVHTGEKPYKCDTCGKAFSQKSSLQVHQRIHTGEKPFKCEECGKEFRWSVGLSSHQRVHTGEKPYTCQQCGKGFSQASYFHMHQRV 642          

HSP 5 Score: 118.627 bits (296), Expect = 2.124e-28
Identity = 61/141 (43.26%), Postives = 88/141 (62.41%), Query Frame = 1
Query:  643 STSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESF 1065
            S S  L+ +R    G K  Y+C++C K F Q ++L+ H+R HTGE+P+KC  CGK F+  ++L  H  VHT E+P+EC+ C KRFS S NL  H R+H  EK  +C+ C   FS+++  + H R HT E P+ C  C ++F
Sbjct:  323 SRSSDLNIHRRVHTGEKP-YKCEVCGKGFTQWAHLQAHERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYECNECGKRFSLSGNLDIHQRVHTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFHCSVCGKNF 462          

HSP 6 Score: 117.857 bits (294), Expect = 3.691e-28
Identity = 55/134 (41.04%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C +C K+F + S+   HQR HTGE+P++C +CGK F     L  H  VHTG++P++C  C K FS +S+L+ H  +H  EK  +C +C+ QFS ++ L+ H R HT E PY+C  C ++F   S L+ H  +
Sbjct:  453 FHCSVCGKNFSRSSHFLDHQRIHTGEKPYRCEVCGKRFPWSLSLHSHQSVHTGKKPYKCGECGKGFSHASSLQAHHSVHTGEKPFKCNVCQKQFSKTSNLQAHQRVHTGEKPYKCDTCGKAFSQKSSLQVHQRI 586          

HSP 7 Score: 113.235 bits (282), Expect = 1.327e-26
Identity = 58/134 (43.28%), Postives = 79/134 (58.96%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y+C  C K F   SNL  HQR HT E+P++C+ CGK F+   +L  H  VHTGE+P++C  C K FSS+S+ ++H R+H  EK   C +C   FS S++   H R HT E PY+C  C + F     L  H +V
Sbjct:  369 YKCGDCGKRFSCSSNLHTHQRVHTEEKPYECNECGKRFSLSGNLDIHQRVHTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFHCSVCGKNFSRSSHFLDHQRIHTGEKPYRCEVCGKRFPWSLSLHSHQSV 502          

HSP 8 Score: 112.849 bits (281), Expect = 1.837e-26
Identity = 58/127 (45.67%), Postives = 76/127 (59.84%), Query Frame = 1
Query:  643 STSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHT 1023
            S + SL  + S   G K  ++C +C K F + SNL+ HQR HTGE+P+KC  CGK F+Q + LQ H  +HTGE+P +C  C K F  S  L +H R+H  EK   CQ C   FS ++Y  MH R HT
Sbjct:  519 SHASSLQAHHSVHTGEKP-FKCNVCQKQFSKTSNLQAHQRVHTGEKPYKCDTCGKAFSQKSSLQVHQRIHTGEKPFKCEECGKEFRWSVGLSSHQRVHTGEKPYTCQQCGKGFSQASYFHMHQRVHT 644          

HSP 9 Score: 103.605 bits (257), Expect = 2.695e-23
Identity = 50/120 (41.67%), Postives = 69/120 (57.50%), Query Frame = 1
Query:  742 NLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            ++ +    H G + + CH CGKGF Q + LQ H  VHTGE+P+ C  C K FS SS+L  H R+H  EK  +C++C   F+   +L+ H R HT E PY+C +C + F   S L  H  V
Sbjct:  271 SVPIQPSVHPGRKRYWCHECGKGFRQSSALQTHQRVHTGEKPYRCDSCGKGFSRSSDLNIHRRVHTGEKPYKCEVCGKGFTQWAHLQAHERIHTGEKPYKCGDCGKRFSCSSNLHTHQRV 390          
BLAST of SMED30000485 vs. UniProt/SwissProt
Match: sp|Q60636|PRDM1_MOUSE (PR domain zinc finger protein 1 OS=Mus musculus OX=10090 GN=Prdm1 PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.710e-54
Identity = 96/189 (50.79%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH-------WTVSICPGSDLN--------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++S+I +  LK H          +  P  DL          DI    D LE+  DS+++  +++
Sbjct:  599 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSYIHLCSLKVHLKGNCPAGPAAGLPLEDLTRINEEIERFDISDNADRLEDMEDSVDVTSMVE 787          
BLAST of SMED30000485 vs. UniProt/SwissProt
Match: sp|Q93560|BLMP1_CAEEL (B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=blmp-1 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.793e-53
Identity = 88/161 (54.66%), Postives = 112/161 (69.57%), Query Frame = 1
Query:  691 KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLN-------VDIEQKLD 1152
            K++Y C+ C K FGQLSNLKVH RTHTGERPFKC +C K FTQLAHLQKH+LVHTGERPH C +C KRFSS+SNLKTH RLHN +K   C +C  +F+   +L++H R H  E PY C  C + +I+ SGL+ HW  + C   D+        +DI+ ++D
Sbjct:  505 KTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSMRDDLMDIKGEID 665          
BLAST of SMED30000485 vs. UniProt/SwissProt
Match: sp|O75626|PRDM1_HUMAN (PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 2.327e-53
Identity = 95/189 (50.26%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW----TVSICPGSDLN-----------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C  C++++I +  LK H       +  PG  L             DI    D LE+  D I++  +++
Sbjct:  568 KQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDISVISVVE 756          
BLAST of SMED30000485 vs. UniProt/SwissProt
Match: sp|I7HJS4|ZN683_MOUSE (Tissue-resident T-cell transcription regulator protein ZNF683 OS=Mus musculus OX=10090 GN=Znf683 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.135e-40
Identity = 71/112 (63.39%), Postives = 85/112 (75.89%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMR 1014
            K   K  Y+C +C K+FGQLSNLKVH R H+GERPF+C LC K FTQLAHLQKH+LVHTGERPH+C VC KRFSSSSNLKTH RLH+  K  +C +C +  + + Y K+H R
Sbjct:  294 KENGKILYECNVCGKNFGQLSNLKVHLRVHSGERPFQCALCQKRFTQLAHLQKHHLVHTGERPHQCQVCHKRFSSSSNLKTHLRLHSGAKPSQCGLCPSYLTPNVYPKLHHR 405          

HSP 2 Score: 90.5077 bits (223), Expect = 1.889e-18
Identity = 41/96 (42.71%), Postives = 67/96 (69.79%), Query Frame = 1
Query:  784 FKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFIT 1071
            ++C++CGK F QL++L+ H  VH+GERP +C++C KRF+  ++L+ H  +H  E+  +CQ+C  +FS+S+ LK H+R H+   P QC  C  S++T
Sbjct:  301 YECNVCGKNFGQLSNLKVHLRVHSGERPFQCALCQKRFTQLAHLQKHHLVHTGERPHQCQVCHKRFSSSSNLKTHLRLHSGAKPSQCGLC-PSYLT 395          

HSP 3 Score: 66.2402 bits (160), Expect = 1.662e-10
Identity = 31/75 (41.33%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  868 HECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            +EC+VC K F   SNLK H R+H+ E+  +C +C+ +F+   +L+ H   HT E P+QC  C++ F + S LK H
Sbjct:  301 YECNVCGKNFGQLSNLKVHLRVHSGERPFQCALCQKRFTQLAHLQKHHLVHTGERPHQCQVCHKRFSSSSNLKTH 375          
BLAST of SMED30000485 vs. UniProt/SwissProt
Match: sp|Q8IZ20|ZN683_HUMAN (Tissue-resident T-cell transcription regulator protein ZNF683 OS=Homo sapiens OX=9606 GN=ZNF683 PE=1 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 8.738e-38
Identity = 74/137 (54.01%), Postives = 91/137 (66.42%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECS--------------------VCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRE 1029
            K+  K  Y+C IC K FGQLSNLKVH R H+GERPF+C LC K FTQLAHLQKH+LVHTGERPH+CS                    VC KRFSSSSNLKTH RLH+  +  +C +C+++F+   +LK+H R H  +
Sbjct:  315 KKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPFQCALCQKSFTQLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLHSGARPFQCSVCRSRFTQHIHLKLHHRLHAPQ 451          

HSP 2 Score: 55.0694 bits (131), Expect = 6.351e-7
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  868 HECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            +EC++C K F   SNLK H R+H+ E+  +C +C+  F+   +L+ H   HT E P++C     S   V G + HW
Sbjct:  322 YECNICGKSFGQLSNLKVHLRVHSGERPFQCALCQKSFTQLAHLQKHHLVHTGERPHKC-----SIPWVPG-RNHW 391          
BLAST of SMED30000485 vs. TrEMBL
Match: A0A0N4YUG4 (Uncharacterized protein OS=Nippostrongylus brasiliensis OX=27835 GN=NBR_LOCUS20887 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 9.848e-57
Identity = 89/160 (55.62%), Postives = 115/160 (71.88%), Query Frame = 1
Query:  691 KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEAT 1170
            K++Y C+ C K FGQLSNLKVH RTHTGERPFKC +CGK FTQLAHLQKHNLVHTGERPH C +C KRFSS+SNLKTH RLHN +K   C +C  +F+   +L++H R H  E PY CL+C + +I+ SGL+ HW  + C   +  + +E++ + +   T
Sbjct:   36 KTRYACKECHKTFGQLSNLKVHVRTHTGERPFKCTVCGKEFTQLAHLQKHNLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYACDVCSAKFTQYVHLRLHKRLHANERPYACLSCGKKYISPSGLRTHWKTTTCKPDEKEMKLEKEDEAVSSTT 195          
BLAST of SMED30000485 vs. TrEMBL
Match: A0A2G9TPP9 (Zinc finger, C2H2 type (Fragment) OS=Teladorsagia circumcincta OX=45464 GN=TELCIR_19105 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 2.163e-56
Identity = 88/160 (55.00%), Postives = 115/160 (71.88%), Query Frame = 1
Query:  691 KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEAT 1170
            K++Y C+ C K FGQLSNLKVH RTHTGERPFKC +CGK FTQLAHLQKHNLVHTGERPH C +C KRFSS+SNLKTH RLHN +K   C +C  +F+   +L++H R H  E PY C++C + +I+ SGL+ HW  + C   +  + +E++ + +   T
Sbjct:    9 KTRYACKECHKTFGQLSNLKVHVRTHTGERPFKCTVCGKEFTQLAHLQKHNLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYACDVCSAKFTQYVHLRLHKRLHANERPYACMSCGKKYISPSGLRTHWKTTTCKPDEKEMKMEREDEAVSSTT 168          
BLAST of SMED30000485 vs. TrEMBL
Match: A0A1I7Z8R8 (Uncharacterized protein OS=Steinernema glaseri OX=37863 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.691e-56
Identity = 91/151 (60.26%), Postives = 113/151 (74.83%), Query Frame = 1
Query:  685 GHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICP--GSDLNV 1131
            G K++Y+C +C K FGQLSNLKVHQRTHTGERPFKC +C K FTQLAHLQKH+LVHTGE+PH+C VC KRFSS+SNLKTH RLHN +K   C +C ++F+   +LK+H R HT E P+ C  C + +I+ SGL+ HW  + C   GSDL  
Sbjct:   19 GAKTRYRCGLCSKTFGQLSNLKVHQRTHTGERPFKCTVCHKEFTQLAHLQKHHLVHTGEKPHQCPVCQKRFSSTSNLKTHLRLHNGQKPYPCDLCGSKFTQYVHLKLHKRLHTNERPFSCTMCGKKYISPSGLRTHWKTTACKPVGSDLQA 169          
BLAST of SMED30000485 vs. TrEMBL
Match: K1QVM1 (PR domain zinc finger protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10024223 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 5.107e-56
Identity = 94/152 (61.84%), Postives = 112/152 (73.68%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVD 1134
            K+  K  Y+C +C K FGQLSNLKVH RTHTGERPF C  CGKGFTQLAHLQKH+LVHTGE+PHEC+VC KRFSS+SNLKTH RLH+ EK   C++C  +F+   +LK+H R HT E PY+C  CN  +I+ SGLK HW    C    LN+D
Sbjct:  528 KKDGKMHYECNVCYKSFGQLSNLKVHLRTHTGERPFVCQTCGKGFTQLAHLQKHHLVHTGEKPHECTVCGKRFSSTSNLKTHMRLHSGEKPFHCKLCPAKFTQFVHLKLHKRLHTNERPYECPQCNRKYISASGLKTHWKTGNCIPPGLNID 679          
BLAST of SMED30000485 vs. TrEMBL
Match: A0A267ETN9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009329g1 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.905e-56
Identity = 98/166 (59.04%), Postives = 119/166 (71.69%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDS 1176
            K+  K  Y+C +C K FGQLSNLKVH RTHTGERPFKC LC KGFTQLAHLQKHNLVHTGE+PH C VC KRFSS+SNLKTH RLH+ EK   C++C  +F+   +LK+H R HT E P++C  C + +I+ SGLK HW    C GS+L  D+   L+ +   TDS
Sbjct:  364 KKDGKMHYECNVCLKSFGQLSNLKVHLRTHTGERPFKCDLCDKGFTQLAHLQKHNLVHTGEKPHACYVCHKRFSSTSNLKTHMRLHSGEKPFSCKLCPAKFTQFVHLKLHKRLHTNERPFECPKCCKKYISASGLKTHWRSGPCFGSELATDLNSILNSI--VTDS 527          
BLAST of SMED30000485 vs. Ensembl Cavefish
Match: prdm1a (PR/SET domain 1 [Source:NCBI gene;Acc:103047552])

HSP 1 Score: 185.267 bits (469), Expect = 1.571e-51
Identity = 94/190 (49.47%), Postives = 127/190 (66.84%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH---WTVSICPG-----SDLN--------VDIEQKLDMLEEATDSINLKMLIK 1200
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R HTRE P++C +C+ ++I +  L+ H   + ++  P       +LN         DI    D LEE  + ++++ L++
Sbjct:  505 KQNGKIKYECNVCSKTFGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLKLHKRLHTRERPHKCPHCHRNYIHLCSLRLHLKGYCLAAMPSPCCSLDELNRINEEIERFDISDHADRLEE-IEGVDVERLVE 693          
BLAST of SMED30000485 vs. Ensembl Cavefish
Match: ENSAMXT00000045728.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:15025411:15026762:1 gene:ENSAMXG00000043107.1 transcript:ENSAMXT00000045728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 5.851e-36
Identity = 71/165 (43.03%), Postives = 93/165 (56.36%), Query Frame = 1
Query:  607 PSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            P  SP+L+ L A++   ++    P  G +    C  C K F +LSN K HQR HTGE+P+ C  CGK FTQ + L+ H  +HTGE+PH CS C K F   S+L+TH R+H  EK   C  C   F+  + LK+H R HT E PY C  C +SF   S L  H  +
Sbjct:    3 PEKSPDLQMLFATSFRQMN----PSPGKEKTLHCSDCGKSFNKLSNFKAHQRIHTGEKPYHCPDCGKSFTQQSSLKLHQRIHTGEKPHHCSDCGKSFIQQSDLRTHQRIHTGEKPYHCSDCGKSFTQQSKLKIHQRIHTGEKPYHCSECGKSFTQQSDLTIHQCI 163          

HSP 2 Score: 118.242 bits (295), Expect = 2.236e-30
Identity = 59/113 (52.21%), Postives = 72/113 (63.72%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPY 1038
            Y C  C K F Q S LK+HQR HTGE+P+ C  CGK FTQ + L  H  +HTGE+P+ CS C K F++ SNLKTH R+H  EK   C  C   F++ + LK H R HTRE PY
Sbjct:  114 YHCSDCGKSFTQQSKLKIHQRIHTGEKPYHCSECGKSFTQQSDLTIHQCIHTGEKPYHCSECWKGFTTQSNLKTHLRIHTGEKPYHCSECWKSFTSQSNLKKHQRVHTREKPY 226          

HSP 3 Score: 117.857 bits (294), Expect = 3.959e-30
Identity = 61/134 (45.52%), Postives = 79/134 (58.96%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C  C K F Q S+L+ HQR HTGE+P+ C  CGK FTQ + L+ H  +HTGE+P+ CS C K F+  S+L  H  +H  EK   C  C   F+  + LK H+R HT E PY C  C +SF + S LK H  V
Sbjct:   86 HHCSDCGKSFIQQSDLRTHQRIHTGEKPYHCSDCGKSFTQQSKLKIHQRIHTGEKPYHCSECGKSFTQQSDLTIHQCIHTGEKPYHCSECWKGFTTQSNLKTHLRIHTGEKPYHCSECWKSFTSQSNLKKHQRV 219          

HSP 4 Score: 117.472 bits (293), Expect = 5.006e-30
Identity = 61/134 (45.52%), Postives = 76/134 (56.72%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F Q S+LK+HQR HTGE+P  C  CGK F Q + L+ H  +HTGE+P+ CS C K F+  S LK H R+H  EK   C  C   F+  + L +H   HT E PY C  C + F T S LK H  +
Sbjct:   58 YHCPDCGKSFTQQSSLKLHQRIHTGEKPHHCSDCGKSFIQQSDLRTHQRIHTGEKPYHCSDCGKSFTQQSKLKIHQRIHTGEKPYHCSECGKSFTQQSDLTIHQCIHTGEKPYHCSECWKGFTTQSNLKTHLRI 191          
BLAST of SMED30000485 vs. Ensembl Cavefish
Match: ENSAMXT00000008864.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001044.1:53038:55522:1 gene:ENSAMXG00000008613.2 transcript:ENSAMXT00000008864.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 5.110e-35
Identity = 67/134 (50.00%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F + SNLK HQR HTGE+P+ C  CGK FTQ +HL+KH  +HTGE+P+ CS C K F+  SNLK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:  163 YHCSDCGKSFTKQSNLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI 296          

HSP 2 Score: 129.798 bits (325), Expect = 5.826e-33
Identity = 64/134 (47.76%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F + SNLK+HQR HTGE+P+ C  CGK FT+ ++L+ H  +HTGE+P+ CS C K F+  SNLK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:  219 YHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI 352          

HSP 3 Score: 129.798 bits (325), Expect = 5.826e-33
Identity = 64/134 (47.76%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F + SNLK+HQR HTGE+P+ C  CGK FT+ ++L+ H  +HTGE+P+ CS C K F+  SNLK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:  247 YHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI 380          

HSP 4 Score: 129.798 bits (325), Expect = 5.826e-33
Identity = 64/134 (47.76%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F + SNLK+HQR HTGE+P+ C  CGK FT+ ++L+ H  +HTGE+P+ CS C K F+  SNLK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:  275 YHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI 408          

HSP 5 Score: 129.798 bits (325), Expect = 5.826e-33
Identity = 64/134 (47.76%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F + SNLK+HQR HTGE+P+ C  CGK FT+ ++L+ H  +HTGE+P+ CS C K F+  SNLK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:  303 YHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI 436          

HSP 6 Score: 127.487 bits (319), Expect = 3.648e-32
Identity = 64/134 (47.76%), Postives = 82/134 (61.19%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F Q S+LK HQR HTGE+P+ C  CGK FT+ ++L+ H  +HTGE+P+ CS C K F+  SNLK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:  191 YHCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI 324          

HSP 7 Score: 120.939 bits (302), Expect = 9.416e-30
Identity = 60/127 (47.24%), Postives = 79/127 (62.20%), Query Frame = 1
Query:  721 KHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            K F + S LK HQR HTGE+P+ C  CGK FT+ ++L+KH  +HTGE+P+ CS C K F+  S+LK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:  142 KSFTKQSTLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRI 268          

HSP 8 Score: 120.168 bits (300), Expect = 1.796e-29
Identity = 66/155 (42.58%), Postives = 83/155 (53.55%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTY---------------------LKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C K F + SNLK+HQR HTGE+P+ C  CGK FTQ + L+KH  +HTGE+P+ CS C K F+  S+LK H R+H  EK   C  C   F+  T+                     LK H R HT E PY C +C +SF   S LK H  +
Sbjct:   30 YYCFDCGKSFTKQSNLKIHQRIHTGEKPYYCFDCGKSFTQQSDLKKHQRIHTGEKPYHCSDCAKSFTKQSDLKKHQRIHTGEKPYHCSDCGKSFTKQTHSHRRETVSLLRLWKSFTKQSTLKKHQRIHTGEKPYHCSDCGKSFTKQSNLKKHQRI 184          

HSP 9 Score: 117.472 bits (293), Expect = 1.229e-28
Identity = 58/125 (46.40%), Postives = 77/125 (61.60%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITV 1074
            Y C  C K F + SNLK+HQR HTGE+P+ C  CGK FT+ ++L+ H  +HTGE+P+ CS C K F+  SNLK H R+H  EK   C  C   F+  + LK+H R HT E PY C +  E  + +
Sbjct:  331 YHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDCGKSFTKQSNLKIHQRIHTGEKPYHCSDLYEELLNL 455          

HSP 10 Score: 109.383 bits (272), Expect = 1.006e-25
Identity = 57/129 (44.19%), Postives = 77/129 (59.69%), Query Frame = 1
Query:  721 KHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSI 1107
            K F + S+LK HQR HTGE+P+ C  CGK FT+ ++L+ H  +HTGE+P+ C  C K F+  S+LK H R+H  EK   C  C   F+  + LK H R HT E PY C +C +SF   +      TVS+
Sbjct:    9 KSFTKQSDLKKHQRIHTGEKPYYCFDCGKSFTKQSNLKIHQRIHTGEKPYYCFDCGKSFTQQSDLKKHQRIHTGEKPYHCSDCAKSFTKQSDLKKHQRIHTGEKPYHCSDCGKSFTKQTHSHRRETVSL 137          

HSP 11 Score: 58.9214 bits (141), Expect = 5.061e-9
Identity = 30/72 (41.67%), Postives = 40/72 (55.56%), Query Frame = 1
Query:  886 LKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            +K F+  S+LK H R+H  EK   C  C   F+  + LK+H R HT E PY C +C +SF   S LK H  +
Sbjct:    8 VKSFTKQSDLKKHQRIHTGEKPYYCFDCGKSFTKQSNLKIHQRIHTGEKPYYCFDCGKSFTQQSDLKKHQRI 79          
BLAST of SMED30000485 vs. Ensembl Cavefish
Match: ENSAMXT00000006669.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000553.1:46556:53044:-1 gene:ENSAMXG00000039016.1 transcript:ENSAMXT00000006669.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 7.683e-35
Identity = 74/166 (44.58%), Postives = 99/166 (59.64%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLI 1197
            Y C  C K F   S+LK HQR HTGE+P+ C +CGK FT+ +HL+ H  +HTGE+P+ CSVC KRF++ S+LKTH R+H  EK   C  C+  F+  ++LK H R HT E P+ C +C +SF T S LK H  +    G  L   ++      +   DSI   MLI
Sbjct:  383 YHCSDCEKSFTTQSDLKRHQRIHTGEKPYYCSVCGKSFTKQSHLKTHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRIHTGEKPFHCADCEKSFTTQSHLKTHQRIHTGEKPFHCADCEKSFTTQSHLKTHQRIHT--GEKLYQCLDCGFYTPKTIQDSIQ-DMLI 545          

HSP 2 Score: 129.028 bits (323), Expect = 3.465e-32
Identity = 62/131 (47.33%), Postives = 83/131 (63.36%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            + C  C K F   S+LK HQR HTGE+P+ C +CG  F Q   LQ+H  +HTGE+P+ CSVC KRF++ S+LKTH R+H  EK   C +C   F+  ++LK H R HT E P+ C +C +SF T   L+ H
Sbjct:  215 FHCADCEKSFTTQSHLKTHQRIHTGEKPYHCSVCGMNFHQKITLQRHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRIHTGEKPYHCSVCGKSFTTQSHLKTHQRIHTGEKPFHCADCEKSFTTQGELQRH 345          

HSP 3 Score: 125.946 bits (315), Expect = 4.886e-31
Identity = 61/134 (45.52%), Postives = 80/134 (59.70%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C +C K F   S+LK HQR HTGE+P+ C +CGK FT  +HL+ H  +HTGE+P  C+ C K F++   L+ H R+H  EK   C  C   F+N   L+ H R HT E PY C +C +SF T S LK H  +
Sbjct:  271 YHCSVCGKRFTTQSHLKTHQRIHTGEKPYHCSVCGKSFTTQSHLKTHQRIHTGEKPFHCADCEKSFTTQGELQRHKRIHTGEKPYHCSECAMNFTNQYNLQRHQRIHTGEKPYHCSDCEKSFTTQSDLKRHQRI 404          

HSP 4 Score: 124.405 bits (311), Expect = 1.452e-30
Identity = 61/134 (45.52%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C  +F    NL+ HQR HTGE+P+ C  C K FT  + L++H  +HTGE+P+ CSVC K F+  S+LKTH R+H  EK   C +C  +F+  ++LK H R HT E P+ C +C +SF T S LK H  +
Sbjct:  355 YHCSECAMNFTNQYNLQRHQRIHTGEKPYHCSDCEKSFTTQSDLKRHQRIHTGEKPYYCSVCGKSFTKQSHLKTHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRIHTGEKPFHCADCEKSFTTQSHLKTHQRI 488          

HSP 5 Score: 119.398 bits (298), Expect = 6.948e-29
Identity = 59/134 (44.03%), Postives = 80/134 (59.70%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C +C  +F Q   L+ HQR HTGE+P+ C +CGK FT  +HL+ H  +HTGE+P+ CSVC K F++ S+LKTH R+H  EK   C  C+  F+    L+ H R HT E PY C  C  +F     L+ H  +
Sbjct:  243 YHCSVCGMNFHQKITLQRHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRIHTGEKPYHCSVCGKSFTTQSHLKTHQRIHTGEKPFHCADCEKSFTTQGELQRHKRIHTGEKPYHCSECAMNFTNQYNLQRHQRI 376          

HSP 6 Score: 118.627 bits (296), Expect = 1.360e-28
Identity = 61/134 (45.52%), Postives = 77/134 (57.46%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C +C K F   S+LK HQR HTGE+PF C  C K FT    LQ+H  +HTGE+P+ CS C   F++  NL+ H R+H  EK   C  C+  F+  + LK H R HT E PY C  C +SF   S LK H  +
Sbjct:  299 YHCSVCGKSFTTQSHLKTHQRIHTGEKPFHCADCEKSFTTQGELQRHKRIHTGEKPYHCSECAMNFTNQYNLQRHQRIHTGEKPYHCSDCEKSFTTQSDLKRHQRIHTGEKPYYCSVCGKSFTKQSHLKTHQRI 432          

HSP 7 Score: 117.472 bits (293), Expect = 3.666e-28
Identity = 58/131 (44.27%), Postives = 76/131 (58.02%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            Y C +C K F   S+LK HQR HTGE+PF C  C K FT    LQ+H  +HTGE+P+ CS C   F++  NL+ H R+H  EK   C  C+  F+    L+ H R HT E P+ C +C +SF T   L+ H
Sbjct:   75 YHCSVCGKSFTTQSHLKTHQRIHTGEKPFHCSDCEKSFTTQGELQRHKRIHTGEKPYHCSECAMNFTNQYNLQRHQRIHTGEKPFHCADCEKSFTTQGELQRHKRVHTGEKPFHCADCEKSFTTQGELQRH 205          

HSP 8 Score: 115.161 bits (287), Expect = 1.978e-27
Identity = 56/126 (44.44%), Postives = 76/126 (60.32%), Query Frame = 1
Query:  724 HFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            H+ + S+LK HQR HTGE+P+ C +CGK FT  +HL+ H  +HTGE+P  CS C K F++   L+ H R+H  EK   C  C   F+N   L+ H R HT E P+ C +C +SF T   L+ H  V
Sbjct:   55 HWRETSHLKTHQRIHTGEKPYHCSVCGKSFTTQSHLKTHQRIHTGEKPFHCSDCEKSFTTQGELQRHKRIHTGEKPYHCSECAMNFTNQYNLQRHQRIHTGEKPFHCADCEKSFTTQGELQRHKRV 180          

HSP 9 Score: 114.39 bits (285), Expect = 4.564e-27
Identity = 58/134 (43.28%), Postives = 76/134 (56.72%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C  C K F     L+ H+R HTGE+PF C  C K FT  +HL+ H  +HTGE+P+ CSVC   F     L+ H R+H  EK   C +C  +F+  ++LK H R HT E PY C  C +SF T S LK H  +
Sbjct:  187 FHCADCEKSFTTQGELQRHKRIHTGEKPFHCADCEKSFTTQSHLKTHQRIHTGEKPYHCSVCGMNFHQKITLQRHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRIHTGEKPYHCSVCGKSFTTQSHLKTHQRI 320          

HSP 10 Score: 113.235 bits (282), Expect = 9.486e-27
Identity = 57/134 (42.54%), Postives = 77/134 (57.46%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C  C K F     L+ H+R HTGE+P+ C  C   FT   +LQ+H  +HTGE+P+ CS C K F++ S+LK H R+H  EK   C +C   F+  ++LK H R HT E PY C  C + F T S LK H  +
Sbjct:  327 FHCADCEKSFTTQGELQRHKRIHTGEKPYHCSECAMNFTNQYNLQRHQRIHTGEKPYHCSDCEKSFTTQSDLKRHQRIHTGEKPYYCSVCGKSFTKQSHLKTHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRI 460          

HSP 11 Score: 112.849 bits (281), Expect = 1.473e-26
Identity = 58/134 (43.28%), Postives = 74/134 (55.22%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C  C K F     L+ H+R HTGE+PF C  C K FT    LQ+H  +HTGE+P  C+ C K F++ S+LKTH R+H  EK   C +C   F     L+ H R HT E PY C  C + F T S LK H  +
Sbjct:  159 FHCADCEKSFTTQGELQRHKRVHTGEKPFHCADCEKSFTTQGELQRHKRIHTGEKPFHCADCEKSFTTQSHLKTHQRIHTGEKPYHCSVCGMNFHQKITLQRHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRI 292          

HSP 12 Score: 107.457 bits (267), Expect = 8.831e-25
Identity = 56/134 (41.79%), Postives = 73/134 (54.48%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y C  C  +F    NL+ HQR HTGE+PF C  C K FT    LQ+H  VHTGE+P  C+ C K F++   L+ H R+H  EK   C  C+  F+  ++LK H R HT E PY C  C  +F     L+ H  +
Sbjct:  131 YHCSECAMNFTNQYNLQRHQRIHTGEKPFHCADCEKSFTTQGELQRHKRVHTGEKPFHCADCEKSFTTQGELQRHKRIHTGEKPFHCADCEKSFTTQSHLKTHQRIHTGEKPYHCSVCGMNFHQKITLQRHQRI 264          

HSP 13 Score: 105.145 bits (261), Expect = 5.046e-24
Identity = 53/134 (39.55%), Postives = 74/134 (55.22%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + C  C K F     L+ H+R HTGE+P+ C  C   FT   +LQ+H  +HTGE+P  C+ C K F++   L+ H R+H  EK   C  C+  F+    L+ H R HT E P+ C +C +SF T S LK H  +
Sbjct:  103 FHCSDCEKSFTTQGELQRHKRIHTGEKPYHCSECAMNFTNQYNLQRHQRIHTGEKPFHCADCEKSFTTQGELQRHKRVHTGEKPFHCADCEKSFTTQGELQRHKRIHTGEKPFHCADCEKSFTTQSHLKTHQRI 236          
BLAST of SMED30000485 vs. Ensembl Cavefish
Match: ENSAMXT00000050172.1 (zinc finger protein 883-like [Source:NCBI gene;Acc:103025136])

HSP 1 Score: 137.117 bits (344), Expect = 9.734e-35
Identity = 86/248 (34.68%), Postives = 128/248 (51.61%), Query Frame = 1
Query:  358 DFFLVSTRIIKEHEELILSNEP---KLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            D     T  +K+H+++    +P   KL    FN     + S +++ E   +  K +Q +     +    +  R+ +  +  +P Q P+      C    + PSL          +  Y C  C K F  LS LK H+RTHTGE+P++C +C K F+  + L +H  VHTGE+PHECS C K F   SNL+ H R+H +EK   C  C   F++S+ LK+H R+HT E PYQC NC +SF  +  L+ H
Sbjct:  436 DKTFTCTVYLKKHQKIHTGEKPYECKLCQKKFN-----LLSALKTHERTHTGEKPYQCMTCGKCFSSSASLIRHRIIHTGKQPHQCPT------CGKKFSYPSLLKKHQRVHTQEKPYPCSHCDKAFAVLSGLKAHERTHTGEKPYQCSVCQKTFSNSSILARHQSVHTGEKPHECSTCGKSFPRLSNLRVHQRVHTNEKPYSCPQCDKTFAHSSSLKVHQRNHTGEKPYQCSNCEKSFTQLGHLQSH 672          

HSP 2 Score: 127.102 bits (318), Expect = 2.930e-31
Identity = 63/134 (47.01%), Postives = 84/134 (62.69%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y+C++C K F  LS LK H+RTHTGE+P++C  CGK F+  A L +H ++HTG++PH+C  C K+FS  S LK H R+H  EK   C  C   F+  + LK H R HT E PYQC  C ++F   S L  H +V
Sbjct:  458 YECKLCQKKFNLLSALKTHERTHTGEKPYQCMTCGKCFSSSASLIRHRIIHTGKQPHQCPTCGKKFSYPSLLKKHQRVHTQEKPYPCSHCDKAFAVLSGLKAHERTHTGEKPYQCSVCQKTFSNSSILARHQSV 591          

HSP 3 Score: 117.087 bits (292), Expect = 7.008e-28
Identity = 59/131 (45.04%), Postives = 82/131 (62.60%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            YQC  C K F     LK HQ+ HTGE+P++C LC K F  L+ L+ H   HTGE+P++C  C K FSSS++L  H  +H  ++  +C  C  +FS  + LK H R HT+E PY C +C+++F  +SGLK H
Sbjct:  430 YQCSQCDKTFTCTVYLKKHQKIHTGEKPYECKLCQKKFNLLSALKTHERTHTGEKPYQCMTCGKCFSSSASLIRHRIIHTGKQPHQCPTCGKKFSYPSLLKKHQRVHTQEKPYPCSHCDKAFAVLSGLKAH 560          

HSP 4 Score: 116.701 bits (291), Expect = 9.703e-28
Identity = 70/169 (41.42%), Postives = 88/169 (52.07%), Query Frame = 1
Query:  595 PIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            P + PS S NL+ L       +  NR      K+ Y C  C + +   S LK+H R HTGERPFKC  CGK F Q   L+ H  +HTGE+P++C+ C K F SS  L TH R H   K   C  C   F  S+ L +H R HT + PYQC  C + F T S L  H  +
Sbjct:  211 PQKPPSTSRNLRKL-------IKRNRL-----KTLYTCSECGRSYPTSSYLKIHMRIHTGERPFKCTHCGKAFNQSGSLRIHQRIHTGEKPYKCTQCHKTFISSGQLTTHLRGHAGIKPFRCSECGKSFLESSALTIHRRIHTGQKPYQCTVCEKCFTTSSSLANHQAM 367          

HSP 5 Score: 115.161 bits (287), Expect = 2.902e-27
Identity = 62/158 (39.24%), Postives = 89/158 (56.33%), Query Frame = 1
Query:  628 KCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            KC T S+S +   N       K  + C +C   F  L  LK+H RTHTGE+P+KC  CGK FTQ   L  H  +H  ++ ++CS C K F+ +  LK H ++H  EK  EC++C+ +F+  + LK H R HT E PYQC+ C + F + + L  H  +
Sbjct:  353 KCFTTSSSLA---NHQAMHKKKRPFPCSLCSLSFTTLGKLKIHLRTHTGEKPYKCLQCGKTFTQSGSLTVHQKLHASDQVYQCSQCDKTFTCTVYLKKHQKIHTGEKPYECKLCQKKFNLLSALKTHERTHTGEKPYQCMTCGKCFSSSASLIRHRII 507          

HSP 6 Score: 109.768 bits (273), Expect = 2.027e-25
Identity = 61/148 (41.22%), Postives = 84/148 (56.76%), Query Frame = 1
Query:  649 SPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            S +L+ +R    G K  YQC +C K F   S+L  HQ  H  +RPF C LC   FT L  L+ H   HTGE+P++C  C K F+ S +L  H +LH S+++ +C  C   F+ + YLK H + HT E PY+C  C + F  +S LK H
Sbjct:  330 SSALTIHRRIHTGQKP-YQCTVCEKCFTTSSSLANHQAMHKKKRPFPCSLCSLSFTTLGKLKIHLRTHTGEKPYKCLQCGKTFTQSGSLTVHQKLHASDQVYQCSQCDKTFTCTVYLKKHQKIHTGEKPYECKLCQKKFNLLSALKTH 476          

HSP 7 Score: 96.2857 bits (238), Expect = 5.509e-21
Identity = 48/110 (43.64%), Postives = 67/110 (60.91%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRE 1029
            YQC +C K F   S L  HQ  HTGE+P +C  CGK F +L++L+ H  VHT E+P+ C  C K F+ SS+LK H R H  EK  +C  C+  F+   +L+ H R H+++
Sbjct:  570 YQCSVCQKTFSNSSILARHQSVHTGEKPHECSTCGKSFPRLSNLRVHQRVHTNEKPYSCPQCDKTFAHSSSLKVHQRNHTGEKPYQCSNCEKSFTQLGHLQSHQRTHSKK 679          

HSP 8 Score: 81.2629 bits (199), Expect = 4.720e-16
Identity = 44/104 (42.31%), Postives = 64/104 (61.54%), Query Frame = 1
Query:  637 TASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEK 948
            T S S  L+ ++S   G K  ++C  C K F +LSNL+VHQR HT E+P+ C  C K F   + L+ H   HTGE+P++CS C K F+   +L++H R H+ +K
Sbjct:  578 TFSNSSILARHQSVHTGEKP-HECSTCGKSFPRLSNLRVHQRVHTNEKPYSCPQCDKTFAHSSSLKVHQRNHTGEKPYQCSNCEKSFTQLGHLQSHQRTHSKKK 680          
BLAST of SMED30000485 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003937.1 (pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gene:ENSPMAG00000003606.1 transcript:ENSPMAT00000003937.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.874 bits (455), Expect = 4.786e-55
Identity = 89/178 (50.00%), Postives = 119/178 (66.85%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPG-------SDLNVDIEQKLDMLEEATDSINLKM 1191
            K+  K+ Y+C IC K FGQLSNLKVH R H+GERPFKC  CGKGFTQLAHLQKH+LVHTGE+P++C VC +RFSS+SNLKTH RLH+ EK  +C++C  +F+   +LK+H R H RE P++C +C  S+I    L  H     CP         D    + Q++D+ + + ++  L M
Sbjct:    8 KQNGKTIYECNICGKTFGQLSNLKVHLRIHSGERPFKCQTCGKGFTQLAHLQKHHLVHTGEKPYQCQVCCRRFSSTSNLKTHLRLHSGEKPFQCKLCPAKFTQFIHLKLHRRLHARERPHRCADCQRSYIHQISLSLHLN-GFCPSQQGPASEQDPLARVNQEIDIFDVSEEAEKLSM 184          
BLAST of SMED30000485 vs. Ensembl Sea Lamprey
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 146.362 bits (368), Expect = 7.139e-39
Identity = 84/180 (46.67%), Postives = 109/180 (60.56%), Query Frame = 1
Query:  655 SLSYNRSPKRGHKSK--YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIE-QKLDMLEEATDSINL 1185
            SL Y   P R H  K  Y+C +C K FGQLSNLKVH R H+GERPFKC  CGKGFTQLAHLQKH+L HTGE+P++C VC KRFSS+SNLK              ++C  +F+   +LK H   H RE P++C  C +S+I    L  H     CP SD   D+  + L ++ +  ++ +L
Sbjct:  411 SLPY---PLRKHNGKIIYECNVCRKTFGQLSNLKVHLRVHSGERPFKCQTCGKGFTQLAHLQKHHL-HTGEKPYQCQVCHKRFSSTSNLK--------------KLCPAKFTQFIHLKQHRHLHARERPHRCPGCQQSYIHQISLTMHLR-GFCP-SDPRPDVSPEYLALVNQKIEAFDL 570          
BLAST of SMED30000485 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001428.1 (pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1 gene:ENSPMAG00000001294.1 transcript:ENSPMAT00000001428.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 6.339e-30
Identity = 60/132 (45.45%), Postives = 81/132 (61.36%), Query Frame = 1
Query:  697 KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            +++C +C K F + S LK H  THTGERP KC +CGK F Q   L+ H   HTGERPH+CS+C K F   + LK+H   H  E+  +C +C+  F +ST LK HM+ H+ E PY+C  C + F   + LK H
Sbjct:  227 RHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNH 358          

HSP 2 Score: 112.079 bits (279), Expect = 8.100e-28
Identity = 60/131 (45.80%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            ++C +C K F +   LK H  THTGERP KC +CGKGF +L+ LQ H  +HTGE+ H+C VC K FS S  LK H R H  E    C +C+  F   + LK HM  HT E P++C  C ++F   + LK H
Sbjct:  144 HRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSH 274          

HSP 3 Score: 110.923 bits (276), Expect = 2.171e-27
Identity = 58/131 (44.27%), Postives = 80/131 (61.07%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            ++C +C K F +   L+ H R HTGE   +C +CGKGF++   L+ H + HTGERPH+C VC K F   S L+ H+ +H  EK+ +C +C   FS S  LK HMR+HT E  ++C  C + FI  S LK H
Sbjct:  116 HKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNH 246          

HSP 4 Score: 109.768 bits (273), Expect = 4.679e-27
Identity = 57/113 (50.44%), Postives = 74/113 (65.49%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPY 1038
            ++C +C K F Q + LK H +THTGERP KC LC K F Q   L+ H L HTGER ++CSVC K F  S++LK+H + H+ EK  +C  CK  F +ST LK HM+ HT E P+
Sbjct:  256 HKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSHMKTHSGEKPYKCSACKKDFRHSTTLKNHMKTHTGEKPH 368          

HSP 5 Score: 109.768 bits (273), Expect = 5.476e-27
Identity = 58/131 (44.27%), Postives = 77/131 (58.78%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            ++C +C K FG+LS L+ H   HTGE+  KC +CGKGF++   L++H   HTGE  H CSVC K F   S LK H   H  E+  +C +C   F   T LK HM+ HT E P++C  C + F   +GLK H
Sbjct:  172 HKCPVCGKGFGRLSTLQNHATMHTGEKVHKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSH 302          

HSP 6 Score: 107.071 bits (266), Expect = 4.011e-26
Identity = 56/131 (42.75%), Postives = 77/131 (58.78%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            ++C +C K F +   LK H R HTGE   +C +C KGF + + L+ H + HTGERPH+CSVC K F   + LK+H + H  E+  +C +C+  F   T LK HM  HT E  Y+C  C + FI  + LK H
Sbjct:  200 HKCLVCGKGFSRSVQLKRHMRNHTGEWRHRCSVCQKGFIRPSELKNHMMTHTGERPHKCSVCGKAFKQYTALKSHMKTHTGERPHKCSLCEKDFKQCTGLKSHMLTHTGERAYKCSVCEKDFIHSTSLKSH 330          

HSP 7 Score: 99.3673 bits (246), Expect = 2.031e-23
Identity = 49/122 (40.16%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESF 1065
            ++C +C K F + S+LK H  +HTGE+P+KC++C   F   ++L+ H  +H GE+P+ CSVC K F+ SS L TH+ +H +EK   C +C   FS    LK H+  H+ + P++C  C + F
Sbjct:    4 HKCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEF 125          

HSP 8 Score: 99.3673 bits (246), Expect = 2.584e-23
Identity = 52/134 (38.81%), Postives = 75/134 (55.97%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            Y+C +C K F + S L  H   H  E+P  C +CGKGF++   L+ H ++H+G+ PH+C++C K F     L+ H R H  E    C +C   FS S  LK HM  HT E P++C  C + F  +S L+ H T+
Sbjct:   60 YRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTHMMTHTGERPHKCPVCGKGFGRLSTLQNHATM 193          

HSP 9 Score: 93.9745 bits (232), Expect = 1.685e-21
Identity = 51/131 (38.93%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            Y+C +C   F   SNLK H   H GE+P++C +CGKGF + + L  H  +H  E+PH C VC K FS    LK H  +H+ +   +C +C  +F     L+ HMR+HT E  ++C  C + F     LK H
Sbjct:   32 YKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCPHKCALCGKEFRKEMQLQDHMRNHTGEWSHRCSVCGKGFSRSFVLKTH 162          

HSP 10 Score: 82.4185 bits (202), Expect = 1.321e-17
Identity = 44/115 (38.26%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  775 ERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV--SICP 1113
            ERP KC +C K F + + L+ H + HTGE+P++C +C   F ++SNLK H  +HN EK   C +C   F+ S+ L  H   H  E P+ C  C + F     LK H  +    CP
Sbjct:    1 ERPHKCSVCSKSFVRPSDLKNHVMSHTGEKPYKCYMCENAFVTASNLKNHMSIHNGEKPYRCSVCGKGFNRSSTLATHATIHATEKPHICPVCGKGFSRPFALKCHVVIHSGDCP 115          
BLAST of SMED30000485 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000467.1 (pep scaffold:Pmarinus_7.0:GL480927:176958:178556:1 gene:ENSPMAG00000000421.1 transcript:ENSPMAT00000000467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.714e-29
Identity = 64/144 (44.44%), Postives = 79/144 (54.86%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLA--------HLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNS-----EKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            Y C+ C K F   S LK HQR HTGERP+ C  CG+GF Q++        +L+ H   HTGE+P+ C  C KRFS  SNLK H R+H         +  C+ C  +F+  T LK H R HT E PY CL C  +F   S LK H
Sbjct:  200 YACEDCGKTFSLTSTLKNHQRIHTGERPYICSHCGRGFAQISSLTVHRISNLKNHQRTHTGEKPYSCEKCGKRFSDVSNLKAHQRIHADPFSKMAYMFVCKDCGKRFAKVTTLKNHRRIHTGERPYVCLECGRAFAQNSTLKNH 343          

HSP 2 Score: 97.0561 bits (240), Expect = 1.474e-22
Identity = 56/152 (36.84%), Postives = 76/152 (50.00%), Query Frame = 1
Query:  706 CQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGF----TQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYL--------KMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDL 1125
            C  C + F  +S L VHQRTH+ E P+ C  C   F      +++L++H   H+GE+P+ C  C K FS +S LK H R+H  E+   C  C   F+  + L        K H R HT E PY C  C + F  VS LK H  +   P S +
Sbjct:  142 CTECGRGFASISRLLVHQRTHSDEMPYACGECEAAFPLKSMLMSNLRRHQRTHSGEKPYACEDCGKTFSLTSTLKNHQRIHTGERPYICSHCGRGFAQISSLTVHRISNLKNHQRTHTGEKPYSCEKCGKRFSDVSNLKAHQRIHADPFSKM 293          

HSP 3 Score: 92.0485 bits (227), Expect = 8.270e-21
Identity = 52/133 (39.10%), Postives = 66/133 (49.62%), Query Frame = 1
Query:  706 CQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSS----SNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            C+ C K F   S LK H+R H  E P  C  CG+GF  ++ L  H   H+ E P+ C  C   F       SNL+ H R H+ EK   C+ C   FS ++ LK H R HT E PY C +C   F  +S L  H
Sbjct:  114 CKACGKKFASKSLLKRHRRRHAFEMPRVCTECGRGFASISRLLVHQRTHSDEMPYACGECEAAFPLKSMLMSNLRRHQRTHSGEKPYACEDCGKTFSLTSTLKNHQRIHTGERPYICSHCGRGFAQISSLTVH 246          

HSP 4 Score: 79.7221 bits (195), Expect = 1.010e-16
Identity = 45/115 (39.13%), Postives = 61/115 (53.04%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFK-------CHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHT 1023
            Y C+ C K F  +SNLK HQR H    PF        C  CGK F ++  L+ H  +HTGERP+ C  C + F+ +S LK H + H  EK   C  C  +F+  + +  HM+ HT
Sbjct:  264 YSCEKCGKRFSDVSNLKAHQRIHAD--PFSKMAYMFVCKDCGKRFAKVTTLKNHRRIHTGERPYVCLECGRAFAQNSTLKNHQKTHG-EKSYVCSECGERFTKISVMNKHMKAHT 375          

HSP 5 Score: 46.9802 bits (110), Expect = 4.811e-6
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTG 858
            Y C  C + F Q S LK HQ+TH GE+ + C  CG+ FT+++ + KH   HTG
Sbjct:  325 YVCLECGRAFAQNSTLKNHQKTH-GEKSYVCSECGERFTKISVMNKHMKAHTG 376          
BLAST of SMED30000485 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008540.1 (pep scaffold:Pmarinus_7.0:GL486672:772:1638:-1 gene:ENSPMAG00000007731.1 transcript:ENSPMAT00000008540.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 2.251e-29
Identity = 60/139 (43.17%), Postives = 80/139 (57.55%), Query Frame = 1
Query:  700 YQCQICCKHFGQ-LSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNS-------TYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            + C  C K F    + LK H  THTGE+PF+C +C +GFTQ A L+ H  VHTGE+P  C +C + F+ SS LK H RLH  EK   C+IC   F+ S       + LK H+R H  ++PYQC  C+  F+  + L  H
Sbjct:   72 FGCDACGKRFSHSTATLKTHMHTHTGEKPFRCEICNRGFTQNATLKTHLHVHTGEKPFRCKICNRGFTQSSKLKVHLRLHTGEKPYRCKICNQAFTQSFNLKIHLSTLKTHLRRHAGKSPYQCGVCDREFLLKAHLSAH 210          

HSP 2 Score: 97.0561 bits (240), Expect = 1.106e-23
Identity = 56/140 (40.00%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  685 GHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFS-SSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            G +    C++C   F +   L  HQ  H  ERP +C +C   F+Q AHL+ H   HTG++P  C  C KRFS S++ LKTH   H  EK   C+IC   F+ +  LK H+  HT E P++C  CN  F   S LK H  +
Sbjct:   13 GDREASCCRLCGLTFARPCGLTRHQCPH--ERPHRCDVCELRFSQHAHLESHRRTHTGDKPFGCDACGKRFSHSTATLKTHMHTHTGEKPFRCEICNRGFTQNATLKTHLHVHTGEKPFRCKICNRGFTQSSKLKVHLRL 150          
BLAST of SMED30000485 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 93.9745 bits (232), Expect = 4.357e-21
Identity = 51/136 (37.50%), Postives = 82/136 (60.29%), Query Frame = 1
Query:  682 RGHKSKYQC--QICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGL 1083
            RG KS+YQC    C + F Q   L  H + H+  +P+KC  C + F+    L +H   H+GE+P++C +C K+F+ SS+LK H R H  EK  +C+IC  +F+ S+ L  H++ H ++  Y+C +C++SF  +  L
Sbjct:  733 RG-KSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKK--YKCSDCSKSFDDLGKL 865          

HSP 2 Score: 76.2554 bits (186), Expect = 2.177e-15
Identity = 48/131 (36.64%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  715 CCKHFGQLSNLKVH-QRTH--TGERPFKC--HLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            C K F     L  H +  H   G+  ++C  H C + F Q   L +H  VH+  +P++C  C + FSS   L  H+R H+ EK  +C IC  +F+ S+ LK+H+R HT E P QC  C + F   S L  H
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKH 842          

HSP 3 Score: 66.2402 bits (160), Expect = 3.588e-12
Identity = 32/74 (43.24%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKT 921
            Y+C IC K F   S+LK+H RTHTGE+P +C +CGK F + ++L KH  + T ++ ++CS C K F     L +
Sbjct:  796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKH--IKTHQKKYKCSDCSKSFDDLGKLNS 867          
BLAST of SMED30000485 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 91.6633 bits (226), Expect = 2.394e-20
Identity = 44/114 (38.60%), Postives = 65/114 (57.02%), Query Frame = 1
Query:  697 KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEK--LCECQICKTQFSNSTYLKMHMRHHTRET 1032
            K++C  C + F Q ++L+VH R+H G +PF C  CGK FTQ  +L+ H  +HTGE+P+ C +C K+FS   NL  H   H   K  +C+ + C   F+    +K H     +ET
Sbjct:  592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKET 705          

HSP 2 Score: 82.4185 bits (202), Expect = 2.479e-17
Identity = 40/105 (38.10%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  787 KCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCL--NCNESFITVSGLKYHW 1095
            +C  C + F+Q  HL+ H   H G +P  C  C KRF+   NL+TH RLH  EK   C IC  +FS    L  H+  H +  P+ C   NCN++F  +  +K H 
Sbjct:  594 ECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          
BLAST of SMED30000485 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 68.5514 bits (166), Expect = 5.960e-13
Identity = 33/90 (36.67%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  682 RGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECS---------VCLKRFSSSSNLKTH 924
            R + + + C +C K F +  NLK H RTHT ERPF C +CGK F +    ++H  +HTG++ + C           C K+F+ S  L  H
Sbjct:  563 RKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRH 652          

HSP 2 Score: 55.8398 bits (133), Expect = 7.601e-9
Identity = 33/97 (34.02%), Postives = 49/97 (50.52%), Query Frame = 1
Query:  784 FKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEK--LCECQI-------CKTQFSNSTYLKMHMRHHTRETPYQCL 1047
            F C +CGK FT+  +L+ H   HT ERP  CS+C K F+   + K H  LH  +K  +C  ++       C  +F+ S  L    RH   E+  +C+
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALG---RHFKTESGRRCI 662          
BLAST of SMED30000485 vs. Ensembl Yeast
Match: MIG3 (Transcriptional regulator; partially nonfunctional in S288C strains but has a major role in catabolite repression and ethanol response in some other strains; involved in response to toxic agents; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genesenvironment [Source:SGD;Acc:S000000830])

HSP 1 Score: 65.855 bits (159), Expect = 3.093e-12
Identity = 28/56 (50.00%), Postives = 38/56 (67.86%), Query Frame = 1
Query:  775 ERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSV--CLKRFSSSSNLKTHSRLH 936
            +RPF+C +C +GF +L H ++H   HTGE+PH+C+V  C K FS S  LK H R H
Sbjct:   14 QRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTH 69          

HSP 2 Score: 52.373 bits (124), Expect = 5.973e-8
Identity = 25/65 (38.46%), Postives = 39/65 (60.00%), Query Frame = 1
Query:  667 NRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHL--CGKGFTQLAHLQKHNLVHT 855
            +R P    +  ++C+IC + F +L + K H RTHTGE+P KC +  C K F++   L++H   HT
Sbjct:    6 DRFPPDNDQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHT 70          
BLAST of SMED30000485 vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 60.077 bits (144), Expect = 1.843e-10
Identity = 30/73 (41.10%), Postives = 42/73 (57.53%), Query Frame = 1
Query:  778 RPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSV--CLKRFSSSSNLKTHSRLHNSE---KLCECQICKTQF 981
            RPF+C  C +GF +L H ++H   HTGE+PH C+   C K FS S  LK H R H  +   +L +  + K +F
Sbjct:   15 RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRLKKASVQKQEF 87          

HSP 2 Score: 50.8322 bits (120), Expect = 1.869e-7
Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHL--CGKGFTQLAHLQKHNLVHTGE---RPHECSVCLKRFSSSSNLKT 921
            ++C  C + F +L + K H RTHTGE+P  C    CGK F++   L++H   HTG+   R  + SV  + F + S + T
Sbjct:   17 FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRLKKASVQKQEFLTVSGIPT 95          
BLAST of SMED30000485 vs. Ensembl Nematostella
Match: EDO49116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU6])

HSP 1 Score: 132.109 bits (331), Expect = 6.239e-37
Identity = 62/131 (47.33%), Postives = 88/131 (67.18%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            Y+CQ C K F   ++LK+H R HTGE+P+ C++C +GF QL +LQ+H L HTGE+PH+C+ C K F SSS+L+ H R+H  E+  +C+ C   F+ S  L+ H+  HT E PY+C  CN  FI+ S L+ H
Sbjct:   32 YKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTH 162          

HSP 2 Score: 109.768 bits (273), Expect = 1.180e-28
Identity = 54/131 (41.22%), Postives = 79/131 (60.31%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            Y CQ C K F +  N + H   HTG++P+KC  C K F   AHL+ HN +HTGE+P+ C++C + F+  +NL+ H   H  EK  +C  C   F +S+ L+ H+R HT E PY+C  C+++F T   L+ H
Sbjct:    4 YTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSH 134          

HSP 3 Score: 99.7525 bits (247), Expect = 6.165e-25
Identity = 49/107 (45.79%), Postives = 69/107 (64.49%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHH 1020
            Y C IC + F QL+NL+ H  THTGE+P KC  C K F   + L++H  +HTGERP++C  C K F++S NL++H   H  EK  +C IC  +F +S+ L+ H+R H
Sbjct:   60 YTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIRIH 166          

HSP 4 Score: 89.3521 bits (220), Expect = 3.068e-21
Identity = 41/106 (38.68%), Postives = 68/106 (64.15%), Query Frame = 1
Query:  775 ERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            ++P+ C  C K FT+  + Q+H L+HTG++P++C  C K F+ +++LK H+R+H  EK   C IC   F+  T L+ H+  HT E P++C  C ++F++ S L+ H
Sbjct:    1 DKPYTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRH 106          
BLAST of SMED30000485 vs. Ensembl Nematostella
Match: EDO40036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B6])

HSP 1 Score: 119.013 bits (297), Expect = 2.223e-31
Identity = 63/140 (45.00%), Postives = 80/140 (57.14%), Query Frame = 1
Query:  673 SPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            +PK+ HK    C  C K F   +NLK H R HTGE+P+ C  C + FT+ + L KH   HTGERP++C  C K FS S  LK H R+H  EK   C +C+  F+    LK HMR HT E PY+C  C++ F   S L  H
Sbjct:   84 APKKEHK----CDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMRVHTGEKPYPCPLCERAFAKGYNLKTHMRTHTGEKPYKCDFCSKLFSQHSTLMQH 219          

HSP 2 Score: 98.2117 bits (243), Expect = 1.125e-23
Identity = 48/112 (42.86%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETP 1035
            Y C+ C + F + S+L  H+R HTGERP+KC  C K F+Q   L+ H  VHTGE+P+ C +C + F+   NLKTH R H  EK  +C  C   FS  + L  H++ H    P
Sbjct:  117 YTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMRVHTGEKPYPCPLCERAFAKGYNLKTHMRTHTGEKPYKCDFCSKLFSQHSTLMQHVQRHQGNAP 228          

HSP 3 Score: 96.2857 bits (238), Expect = 4.911e-23
Identity = 52/132 (39.39%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            YQC  C +      +L  H R H  ++  KC  CGK F   A+L+ H  +HTGE+P+ C  C + F+  S+L  H R H  E+  +C+ C   FS S  LK+HMR HT E PY C  C  +F     LK H 
Sbjct:   61 YQCHHCPEKLKLRCHLNYHLRIHAPKKEHKCDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMRVHTGEKPYPCPLCERAFAKGYNLKTHM 192          

HSP 4 Score: 89.3521 bits (220), Expect = 1.531e-20
Identity = 48/132 (36.36%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  706 CQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            C  C   F     L  H   +TG+ P++CH C +      HL  H  +H  ++ H+C  C K+F+S +NLK H R+H  EK   C+ C+  F+  + L  H R HT E PY+C  C+++F    GLK H  V
Sbjct:   35 CDGCKVAFAFQYQLDKHIYRNTGDVPYQCHHCPEKLKLRCHLNYHLRIHAPKKEHKCDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMRV 166          

HSP 5 Score: 46.595 bits (109), Expect = 6.394e-6
Identity = 27/82 (32.93%), Postives = 39/82 (47.56%), Query Frame = 1
Query:  859 ERPHECSVCLKRFSSSSNLKTHSRLHNSE-KLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + P +C VC + F+S + L+ H   H  E K   C  CK  F+    L  H+  +T + PYQC +C E       L YH  +
Sbjct:    1 DEPLQCEVCKEEFTSETKLRKHLSSHKVEVKRLHCDGCKVAFAFQYQLDKHIYRNTGDVPYQCHHCPEKLKLRCHLNYHLRI 82          
BLAST of SMED30000485 vs. Ensembl Nematostella
Match: EDO47692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLH7])

HSP 1 Score: 114.39 bits (285), Expect = 8.791e-31
Identity = 52/125 (41.60%), Postives = 81/125 (64.80%), Query Frame = 1
Query:  727 FGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + +LS L++H RTH+G +P++C +C K FTQ A+L  H  +H+GE+P  C VC ++FS SS++ TH R HN E+  +C++C   F++S+ L  H+R HT E PYQC  C++ F     +  H  +
Sbjct:    3 YARLSTLRLHMRTHSGVKPYQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRI 127          

HSP 2 Score: 104.375 bits (259), Expect = 4.725e-27
Identity = 49/107 (45.79%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHH 1020
            YQC +C K F Q +NL  H R H+GE+PF+C +CG+ F+Q + +  H   H GERP++C VC K F+ SS L  H R H  EK  +C+IC  +FS S  +  H R H
Sbjct:   22 YQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRIH 128          

HSP 3 Score: 90.1225 bits (222), Expect = 8.373e-22
Identity = 37/80 (46.25%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHN 939
            ++C++C + F Q S++  H RTH GERP+KC +C K F   + L KH   HTGE+P++C +C +RFS S N+  H R+HN
Sbjct:   50 FRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRIHN 129          
BLAST of SMED30000485 vs. Ensembl Nematostella
Match: EDO43177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ64])

HSP 1 Score: 115.161 bits (287), Expect = 1.273e-30
Identity = 55/132 (41.67%), Postives = 82/132 (62.12%), Query Frame = 1
Query:  706 CQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            C +C K + + S LK H R HTG++PF+C  C K F+Q A+L+ H  VH+ E+P +C +C +RF+ SS++ TH R+H+ E+  +C++C   FS+S+ L   +R HT E PYQC  C  SF     L  H  +
Sbjct:   36 CHVCHKIYSRPSTLKAHLRVHTGKKPFRCPTCQKSFSQDANLKAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMRIHSGERPYKCKVCARGFSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSRHMRI 167          

HSP 2 Score: 101.293 bits (251), Expect = 2.185e-25
Identity = 49/108 (45.37%), Postives = 65/108 (60.19%), Query Frame = 1
Query:  691 KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMR 1014
            K  ++C  C K F Q +NLK H R H+ E+PFKCH+C + F Q + +  H  +H+GERP++C VC + FS SS L    R H  EK  +C+IC   FS S  L  HMR
Sbjct:   59 KKPFRCPTCQKSFSQDANLKAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMRIHSGERPYKCKVCARGFSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSRHMR 166          

HSP 3 Score: 81.2629 bits (199), Expect = 3.106e-18
Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEK 948
            ++C IC + F Q S++  H R H+GERP+KC +C +GF+  + L K    HTGE+P++C +C   FS S NL  H R++   K
Sbjct:   90 FKCHICHRRFAQSSSVTTHMRIHSGERPYKCKVCARGFSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSRHMRIYRKRK 172          
BLAST of SMED30000485 vs. Ensembl Nematostella
Match: EDO43181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ74])

HSP 1 Score: 113.235 bits (282), Expect = 3.084e-30
Identity = 52/124 (41.94%), Postives = 74/124 (59.68%), Query Frame = 1
Query:  721 KHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            K + +   LK HQR HTGE+PFKC +CG+ F Q + L+ H  VHTG++P++C VC + FS SS +K H R H  EK  +C IC  +F++ + +K H R HT   P+ C  C   F  +  +  H
Sbjct:    1 KKYARAFTLKTHQRVHTGEKPFKCPICGRPFAQSSGLESHKRVHTGQKPYKCEVCERGFSHSSAVKNHMRTHTGEKPFQCPICNKKFADQSTVKKHERTHTGIKPFTCPECGLKFTQIGNMNKH 124          

HSP 2 Score: 89.3521 bits (220), Expect = 1.477e-21
Identity = 39/105 (37.14%), Postives = 63/105 (60.00%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMR 1014
            ++C IC + F Q S L+ H+R HTG++P+KC +C +GF+  + ++ H   HTGE+P +C +C K+F+  S +K H R H   K   C  C  +F+    +  H+R
Sbjct:   22 FKCPICGRPFAQSSGLESHKRVHTGQKPYKCEVCERGFSHSSAVKNHMRTHTGEKPFQCPICNKKFADQSTVKKHERTHTGIKPFTCPECGLKFTQIGNMNKHLR 126          
BLAST of SMED30000485 vs. Ensembl Medaka
Match: prdm1 (PR/SET domain 1 [Source:NCBI gene;Acc:101164431])

HSP 1 Score: 181.8 bits (460), Expect = 4.769e-50
Identity = 89/171 (52.05%), Postives = 118/171 (69.01%), Query Frame = 1
Query:  679 KRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH---WTVSICPGS-DLNVDIEQKLDMLEEATDSI 1179
            K+  K KY+C +C K FGQLSNLKVH R H+GERPFKC  C KGFTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK   C++C  +F+   +LK+H R H+RE P++C +C+  +I +  L+ H   + +++  GS    V  +  L+ +  A + I
Sbjct:  578 KQNGKIKYECNVCSKTFGQLSNLKVHLRVHSGERPFKCQTCSKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYHCKLCPAKFTQFVHLKLHKRLHSRERPHKCPHCHRHYIHLCSLRLHLKGYCLAVNSGSRSPTVSSQAALEEMHRANEEI 748          
BLAST of SMED30000485 vs. Ensembl Medaka
Match: prdm1b (PR domain containing 1b, with ZNF domain [Source:ZFIN;Acc:ZDB-GENE-080618-2])

HSP 1 Score: 175.252 bits (443), Expect = 1.303e-48
Identity = 96/197 (48.73%), Postives = 126/197 (63.96%), Query Frame = 1
Query:  622 NLKCLTASTSP-------SLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMR-HHTRETPYQCLNCNESFITVSGLKYHWTVSICP-GSDLNVDIEQKLDMLEEATDSINL 1185
            NL    + T+P       SL Y    + G K KY+C IC K FGQLSNLKVH R H+GERPF+C LC K FTQLAHLQKH+LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ EK  +C++C T+F+   +LK+H R H +++ P +C  C ++F     L  H T S CP G   N    + ++  + + ++  L
Sbjct:  343 NLSMTKSGTAPRNGPGHKSLPYPLKKQNG-KIKYECNICSKTFGQLSNLKVHLRVHSGERPFQCDLCKKSFTQLAHLQKHHLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCNTKFTQYIHLKLHRRLHSSQDRPNRCQRCTQAFFHRFSLCIHQT-SCCPAGPGANPRTSEMVERFDASQEAAAL 537          
BLAST of SMED30000485 vs. Ensembl Medaka
Match: prdm1b (PR domain zinc finger protein 1-like [Source:NCBI gene;Acc:101173518])

HSP 1 Score: 168.318 bits (425), Expect = 2.174e-45
Identity = 85/153 (55.56%), Postives = 109/153 (71.24%), Query Frame = 1
Query:  655 SLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICP 1113
            +LSY  + + G K +Y+C IC K FGQLSNLKVH R H+GERPFKC  C K FTQLAHLQKH LVHTGE+PHEC VC KRFSS+SNLKTH RLH+ E+  +C++C  +F+   +LK+H R HT E  ++C +C+ +F+    L+ H     CP
Sbjct:  517 TLSYPLTRENG-KIRYECNICKKIFGQLSNLKVHLRVHSGERPFKCQTCNKNFTQLAHLQKHYLVHTGEKPHECKVCHKRFSSTSNLKTHLRLHSGERPYQCKLCPARFTQFIHLKLHKRLHTGERLHRCPHCSCAFLHYCSLQVHLQ-GFCP 667          
BLAST of SMED30000485 vs. Ensembl Medaka
Match: ENSORLT00000026807.1 (pep primary_assembly:ASM223467v1:2:474256:520244:1 gene:ENSORLG00000024174.1 transcript:ENSORLT00000026807.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 3.562e-35
Identity = 67/131 (51.15%), Postives = 83/131 (63.36%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            + C+ C + F Q+S+LK H RTHTGE+PF C  C KGF+ L+ L+KH   HTGE+P  C  C K FS  SNLKTH R H  EK   C+ CK  FS  +YL++HMR HT E P+ C  C +SF  V  LK H
Sbjct:  222 FSCEECKQSFSQISHLKTHMRTHTGEKPFSCIECAKGFSDLSSLKKHTRTHTGEKPFSCKECDKSFSQISNLKTHMRTHTGEKPFSCKECKKSFSRISYLQIHMRTHTGEKPFSCKECKKSFSLVHNLKTH 352          

HSP 2 Score: 129.413 bits (324), Expect = 8.974e-33
Identity = 63/132 (47.73%), Postives = 82/132 (62.12%), Query Frame = 1
Query:  697 KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            ++ C+ C   F Q+S+LK H RTHTGE+PF C  C KGF+ L+ L+ H   HTGE+P  C  C K F+  S+LKTH R H  EK   C+ CK  FS  ++LK HMR HT E P+ C+ C + F  +S LK H
Sbjct:  137 QFSCKECGGSFSQISDLKRHMRTHTGEKPFSCIECAKGFSDLSSLKTHTRTHTGEKPFSCKECDKSFNRISHLKTHMRTHTGEKPFSCEECKQSFSQISHLKTHMRTHTGEKPFSCIECAKGFSDLSSLKKH 268          

HSP 3 Score: 129.028 bits (323), Expect = 1.639e-32
Identity = 66/138 (47.83%), Postives = 83/138 (60.14%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLN----CNESFITVSGLKYHWTV 1101
            + C+ C K F Q+SNLK H RTHTGE+PF C  C K F+++++LQ H   HTGE+P  C  C K FS   NLKTH+R H  EK   C+ C   FS  +YL+ HMR HT E P+ C      CN+SF   S LK H  +
Sbjct:  278 FSCKECDKSFSQISNLKTHMRTHTGEKPFSCKECKKSFSRISYLQIHMRTHTGEKPFSCKECKKSFSLVHNLKTHTRTHTGEKPFSCKECDKSFSRISYLQTHMRTHTGEKPFSCKECDKKCNKSFSRSSSLKTHMRI 415          

HSP 4 Score: 125.946 bits (315), Expect = 1.625e-31
Identity = 64/136 (47.06%), Postives = 83/136 (61.03%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKR----FSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            + C+ C K F  + NLK H RTHTGE+PF C  C K F+++++LQ H   HTGE+P  C  C K+    FS SS+LKTH R+H  EK   C+ CK  FS+ + LK HMR HT E P+ C  C + F  +S LK H 
Sbjct:  334 FSCKECKKSFSLVHNLKTHTRTHTGEKPFSCKECDKSFSRISYLQTHMRTHTGEKPFSCKECDKKCNKSFSRSSSLKTHMRIHTGEKPFSCKECKKSFSDVSALKKHMRTHTGEKPFSCKECKKCFSQISNLKTHM 469          

HSP 5 Score: 124.79 bits (312), Expect = 4.130e-31
Identity = 61/132 (46.21%), Postives = 81/132 (61.36%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            + C+ C K F ++S+LK H RTHTGE+PF C  C + F+Q++HL+ H   HTGE+P  C  C K FS  S+LK H+R H  EK   C+ C   FS  + LK HMR HT E P+ C  C +SF  +S L+ H 
Sbjct:  194 FSCKECDKSFNRISHLKTHMRTHTGEKPFSCEECKQSFSQISHLKTHMRTHTGEKPFSCIECAKGFSDLSSLKKHTRTHTGEKPFSCKECDKSFSQISNLKTHMRTHTGEKPFSCKECKKSFSRISYLQIHM 325          

HSP 6 Score: 123.25 bits (308), Expect = 1.433e-30
Identity = 62/132 (46.97%), Postives = 78/132 (59.09%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            + C  C K F  LS+LK H RTHTGE+PF C  C K F +++HL+ H   HTGE+P  C  C + FS  S+LKTH R H  EK   C  C   FS+ + LK H R HT E P+ C  C++SF  +S LK H 
Sbjct:  166 FSCIECAKGFSDLSSLKTHTRTHTGEKPFSCKECDKSFNRISHLKTHMRTHTGEKPFSCEECKQSFSQISHLKTHMRTHTGEKPFSCIECAKGFSDLSSLKKHTRTHTGEKPFSCKECDKSFSQISNLKTHM 297          

HSP 7 Score: 117.087 bits (292), Expect = 2.488e-28
Identity = 61/132 (46.21%), Postives = 77/132 (58.33%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            + C  C K F  LS+LK H RTHTGE+PF C  C K F+Q+++L+ H   HTGE+P  C  C K FS  S L+ H R H  EK   C+ CK  FS    LK H R HT E P+ C  C++SF  +S L+ H 
Sbjct:  250 FSCIECAKGFSDLSSLKKHTRTHTGEKPFSCKECDKSFSQISNLKTHMRTHTGEKPFSCKECKKSFSRISYLQIHMRTHTGEKPFSCKECKKSFSLVHNLKTHTRTHTGEKPFSCKECDKSFSRISYLQTHM 381          

HSP 8 Score: 105.145 bits (261), Expect = 2.915e-24
Identity = 51/110 (46.36%), Postives = 67/110 (60.91%), Query Frame = 1
Query:  766 HTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHW 1095
            HTGE+ F C  CG  F+Q++ L++H   HTGE+P  C  C K FS  S+LKTH+R H  EK   C+ C   F+  ++LK HMR HT E P+ C  C +SF  +S LK H 
Sbjct:  132 HTGEKQFSCKECGGSFSQISDLKRHMRTHTGEKPFSCIECAKGFSDLSSLKTHTRTHTGEKPFSCKECDKSFNRISHLKTHMRTHTGEKPFSCEECKQSFSQISHLKTHM 241          

HSP 9 Score: 95.1301 bits (235), Expect = 7.073e-21
Identity = 69/181 (38.12%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  508 KDFQKLMLMFDYLW--MNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCH----LCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRET 1032
            K+ +K      YL   M TH     PFS  +  +S S+  NLK  T + +           G K  + C+ C K F ++S L+ H RTHTGE+PF C      C K F++ + L+ H  +HTGE+P  C  C K FS  S LK H R H  EK   C+ CK  FS  + LK HMR H R+ 
Sbjct:  309 KECKKSFSRISYLQIHMRTHT-GEKPFSCKECKKSFSLVHNLKTHTRTHT-----------GEKP-FSCKECDKSFSRISYLQTHMRTHTGEKPFSCKECDKKCNKSFSRSSSLKTHMRIHTGEKPFSCKECKKSFSDVSALKKHMRTHTGEKPFSCKECKKCFSQISNLKTHMRTHRRKA 476          
BLAST of SMED30000485 vs. Ensembl Medaka
Match: ENSORLT00000030675.1 (zinc finger protein 37 [Source:NCBI gene;Acc:101161026])

HSP 1 Score: 138.272 bits (347), Expect = 5.955e-35
Identity = 65/131 (49.62%), Postives = 83/131 (63.36%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            + C+IC K F Q+S+L  H +THTGE+PF C  C KGFTQ++ L+KH   HTGE+P  C+ C K FS  S+L+TH R H  EK   C+ C   F+  + LK HMR HT E P+ C  C+ SF  VS LK H
Sbjct:  724 FTCKICEKCFSQISSLNTHMKTHTGEKPFSCKECDKGFTQISDLKKHMRTHTGEKPFPCTECNKNFSCVSSLRTHMRTHTGEKPFSCKECNKSFTQISSLKTHMRTHTGEKPFSCKECDASFSDVSNLKRH 854          

HSP 2 Score: 127.102 bits (318), Expect = 3.512e-31
Identity = 60/132 (45.45%), Postives = 82/132 (62.12%), Query Frame = 1
Query:  697 KYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            +Y C+ C K F + S+LK H RTHTGE+PF C  CG+ F+ ++ L++H   HTGE+P  C +C K FS  S+L TH + H  EK   C+ C   F+  + LK HMR HT E P+ C  CN++F  VS L+ H
Sbjct:  667 RYTCKECDKSFSRNSHLKAHIRTHTGEKPFACKECGRCFSVVSQLKRHMRTHTGEKPFTCKICEKCFSQISSLNTHMKTHTGEKPFSCKECDKGFTQISDLKKHMRTHTGEKPFPCTECNKNFSCVSSLRTH 798          

HSP 3 Score: 125.176 bits (313), Expect = 1.542e-30
Identity = 60/131 (45.80%), Postives = 77/131 (58.78%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            + C+ C + F  +S LK H RTHTGE+PF C +C K F+Q++ L  H   HTGE+P  C  C K F+  S+LK H R H  EK   C  C   FS  + L+ HMR HT E P+ C  CN+SF  +S LK H
Sbjct:  696 FACKECGRCFSVVSQLKRHMRTHTGEKPFTCKICEKCFSQISSLNTHMKTHTGEKPFSCKECDKGFTQISDLKKHMRTHTGEKPFPCTECNKNFSCVSSLRTHMRTHTGEKPFSCKECNKSFTQISSLKTH 826          

HSP 4 Score: 112.464 bits (280), Expect = 2.827e-26
Identity = 61/172 (35.47%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  583 SINKPIQSPS--ISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYH 1092
            S+ +  QSP+  + P++K   +S   S  +         + Y C  C K FG  +  ++H + H+GE+ + C  C K F++ +HL+ H   HTGE+P  C  C + FS  S LK H R H  EK   C+IC+  FS  + L  HM+ HT E P+ C  C++ F  +S LK H
Sbjct:  599 SVEERKQSPNEMVPPSVKSGESSKIVSDLFLYVKTDSDDTLYICTECGKSFGFWAQFRLHMKIHSGEKRYTCKECDKSFSRNSHLKAHIRTHTGEKPFACKECGRCFSVVSQLKRHMRTHTGEKPFTCKICEKCFSQISSLNTHMKTHTGEKPFSCKECDKGFTQISDLKKH 770          

HSP 5 Score: 105.145 bits (261), Expect = 7.030e-24
Identity = 50/108 (46.30%), Postives = 67/108 (62.04%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHT 1023
            + C+ C K F Q+S+LK H RTHTGE+PF C  C K F+ ++ L+ H   HTGE+P  C  C K F+  S+LKTH R H  EK   C+ C   FS+ + LK H++ HT
Sbjct:  752 FSCKECDKGFTQISDLKKHMRTHTGEKPFPCTECNKNFSCVSSLRTHMRTHTGEKPFSCKECNKSFTQISSLKTHMRTHTGEKPFSCKECDASFSDVSNLKRHLKTHT 859          
BLAST of SMED30000485 vs. Planmine SMEST
Match: SMESG000069311.1 (SMESG000069311.1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 392/393 (99.75%), Postives = 392/393 (99.75%), Query Frame = 1
Query:   73 MGKFMTQANFNTCFKFDKLLNDRVQESIKLTKIVLPSNLYTDRDSKFENCIRTVKFIEQNQCIAFLGNKLHQWLKFLYHSSSGYHANVMLVYKGQDFFLVSTRIIKEHEELILSNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKXXXXXXXXXXISDVWNK 1251
            MGKFMTQANFNTCFKFDKLLNDRVQESI LTKIVLPSNLYTDRDSKFENCIRTVKFIEQNQCIAFLGNKLHQWLKFLYHSSSGYHANVMLVYKGQDFFLVSTRIIKEHEELILSNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKEERRFSFSEEISDVWNK
Sbjct:    1 MGKFMTQANFNTCFKFDKLLNDRVQESINLTKIVLPSNLYTDRDSKFENCIRTVKFIEQNQCIAFLGNKLHQWLKFLYHSSSGYHANVMLVYKGQDFFLVSTRIIKEHEELILSNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKEERRFSFSEEISDVWNK 393          
BLAST of SMED30000485 vs. Planmine SMEST
Match: SMESG000069311.1 (SMESG000069311.1)

HSP 1 Score: 783.867 bits (2023), Expect = 0.000e+0
Identity = 388/389 (99.74%), Postives = 388/389 (99.74%), Query Frame = 1
Query:   85 MTQANFNTCFKFDKLLNDRVQESIKLTKIVLPSNLYTDRDSKFENCIRTVKFIEQNQCIAFLGNKLHQWLKFLYHSSSGYHANVMLVYKGQDFFLVSTRIIKEHEELILSNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKXXXXXXXXXXISDVWNK 1251
            MTQANFNTCFKFDKLLNDRVQESI LTKIVLPSNLYTDRDSKFENCIRTVKFIEQNQCIAFLGNKLHQWLKFLYHSSSGYHANVMLVYKGQDFFLVSTRIIKEHEELILSNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKEERRFSFSEEISDVWNK
Sbjct:    1 MTQANFNTCFKFDKLLNDRVQESINLTKIVLPSNLYTDRDSKFENCIRTVKFIEQNQCIAFLGNKLHQWLKFLYHSSSGYHANVMLVYKGQDFFLVSTRIIKEHEELILSNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNRSPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKEERRFSFSEEISDVWNK 389          
BLAST of SMED30000485 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 226.868 bits (577), Expect = 1.668e-68
Identity = 144/357 (40.34%), Postives = 201/357 (56.30%), Query Frame = 1
Query:  289 WLKFLYHSSSGYHANVMLV----YKGQDFFLVSTRIIKEHEELIL--SNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNT---HGRNPLPFS---INKPIQSPSISPNLKCLTASTSPSLSYNR-----SPKR--------GH-----------KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKXXXXXXXXXXISDVWNK 1251
            WLK +  ++S   +NV+ +          +L     I +  ELIL  S   K+ ++S  SWK+R+ +I++   + S    ++  +   +  +W N       N +  S   I    ++  I P+     A T   L+ N      S K+        GH           KSKY C +C K FGQLSNLKVHQRTHTGERPF C  CGKGFTQLAHLQKHNLVHTGE+PHECSVC KRFSS+SNLKTH RLH  EK  +C+ CKT+F+   +L++H+R HT E P+ C  CN+ +I++SG++ HW+ S C  S  + D    L+M+E+     N K+  K E +  ++ EI+DVW +
Sbjct:  187 WLKVMRKNTSLNESNVVPICGDYSSSSGVYLHLKPPIAKETELILYQSLSEKIPTVSSRSWKFRIENILQISPKQSQSVYNYSHIYNFWCNIWRNKLFHMTMNSISSSHCNIGNISKTEPIYPHSSISQAVTKSILNENNRDIILSKKQIFSNEKINGHHLSYTLIKTDGKSKYNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISGIRTHWSNSSCYDSSDDTD-NVLLEMIEDLEHKYNGKISFKAETKCVYNIEIADVWQR 542          
BLAST of SMED30000485 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 226.868 bits (577), Expect = 2.754e-68
Identity = 144/357 (40.34%), Postives = 201/357 (56.30%), Query Frame = 1
Query:  289 WLKFLYHSSSGYHANVMLV----YKGQDFFLVSTRIIKEHEELIL--SNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQKLMLMFDYLWMNT---HGRNPLPFS---INKPIQSPSISPNLKCLTASTSPSLSYNR-----SPKR--------GH-----------KSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSDLNVDIEQKLDMLEEATDSINLKMLIKXXXXXXXXXXISDVWNK 1251
            WLK +  ++S   +NV+ +          +L     I +  ELIL  S   K+ ++S  SWK+R+ +I++   + S    ++  +   +  +W N       N +  S   I    ++  I P+     A T   L+ N      S K+        GH           KSKY C +C K FGQLSNLKVHQRTHTGERPF C  CGKGFTQLAHLQKHNLVHTGE+PHECSVC KRFSS+SNLKTH RLH  EK  +C+ CKT+F+   +L++H+R HT E P+ C  CN+ +I++SG++ HW+ S C  S  + D    L+M+E+     N K+  K E +  ++ EI+DVW +
Sbjct:  214 WLKVMRKNTSLNESNVVPICGDYSSSSGVYLHLKPPIAKETELILYQSLSEKIPTVSSRSWKFRIENILQISPKQSQSVYNYSHIYNFWCNIWRNKLFHMTMNSISSSHCNIGNISKTEPIYPHSSISQAVTKSILNENNRDIILSKKQIFSNEKINGHHLSYTLIKTDGKSKYNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCNKCYISISGIRTHWSNSSCYDSSDDTD-NVLLEMIEDLEHKYNGKISFKAETKCVYNIEIADVWQR 569          
BLAST of SMED30000485 vs. Planmine SMEST
Match: SMESG000000679.1 (SMESG000000679.1)

HSP 1 Score: 124.02 bits (310), Expect = 5.196e-31
Identity = 57/135 (42.22%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  703 QCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSI 1107
            QC +C + + + S LK+H RTH+GERPFKC++C K F+Q+A+L  H  +H+GE+P  C +C + FS SS++ TH R H+ E+   C  C   FS+S+ L  H R H+ E PY+C  C   F     L  H  V +
Sbjct:  318 QCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNRHMRVHL 452          

HSP 2 Score: 110.538 bits (275), Expect = 2.541e-26
Identity = 49/107 (45.79%), Postives = 70/107 (65.42%), Query Frame = 1
Query:  700 YQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHH 1020
            ++C +C K F Q++NL  H+R H+GE+PF CH+C + F+Q + +  H   H+GERP+ C  C K FS SS L  H+R+H+ EK  +C+IC  +FS S  L  HMR H
Sbjct:  345 FKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNRHMRVH 451          

HSP 3 Score: 97.8265 bits (242), Expect = 6.830e-22
Identity = 46/109 (42.20%), Postives = 67/109 (61.47%), Query Frame = 1
Query:  775 ERPFKCHLCGKGFTQLAHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICKTQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTV 1101
            + P +CHLCG+ + + + L+ H   H+GERP +C+VC K FS  +NL  H R+H+ EK   C IC   FS S+ +  HMR H+ E PY+C +C+++F   S L  H  V
Sbjct:  314 DEPNQCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRV 422          
The following BLAST results are available for this feature:
BLAST of SMED30000485 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRDM11.124e-5450.26PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
PRDM12.918e-5450.26PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
PRDM12.918e-5450.26PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
PRDM12.918e-5450.26PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
PRDM14.846e-5450.26PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
back to top
BLAST of SMED30000485 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
blmp-11.312e-5454.66B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-11.409e-5454.66B lymphocyte-induced maturation protein 1 homolog ... [more]
che-13.466e-2542.15Transcription factor che-1 [Source:UniProtKB/Swis... [more]
che-17.955e-2542.15Transcription factor che-1 [Source:UniProtKB/Swis... [more]
pag-31.363e-2438.30Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Blimp-11.062e-5451.05gene:FBgn0035625 transcript:FBtr0331808[more]
Blimp-11.062e-5451.05gene:FBgn0035625 transcript:FBtr0345593[more]
Blimp-11.062e-5451.05gene:FBgn0035625 transcript:FBtr0077089[more]
Blimp-11.062e-5451.05gene:FBgn0035625 transcript:FBtr0331809[more]
Blimp-11.177e-5451.05gene:FBgn0035625 transcript:FBtr0331806[more]
back to top
BLAST of SMED30000485 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm1a3.318e-5454.49PR domain containing 1a, with ZNF domain [Source:Z... [more]
zgc:1717272.194e-3448.51zgc:171727 [Source:ZFIN;Acc:ZDB-GENE-071004-26][more]
zgc:1133437.147e-3448.85zgc:113343 [Source:ZFIN;Acc:ZDB-GENE-050327-90][more]
BX005380.22.488e-3344.68pep chromosome:GRCz11:4:51151834:51159094:-1 gene:... [more]
si:dkey-199m13.53.296e-3346.10si:dkey-199m13.5 [Source:ZFIN;Acc:ZDB-GENE-110913-... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chac28.281e-5353.04ChaC, cation transport regulator homolog 2 [Source... [more]
chac29.531e-5353.04ChaC, cation transport regulator homolog 2 [Source... [more]
ZBTB146.585e-3340.44zinc finger and BTB domain containing 14 [Source:N... [more]
ENSXETT00000036615.15.241e-3138.42pep primary_assembly:Xenopus_tropicalis_v9.1:7:692... [more]
crp.47.247e-3140.71C-reactive protein, pentraxin-related, gene 4 [Sou... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prdm11.892e-5550.79PR domain containing 1, with ZNF domain [Source:MG... [more]
Prdm12.497e-5550.79PR domain containing 1, with ZNF domain [Source:MG... [more]
Prdm13.874e-5550.79PR domain containing 1, with ZNF domain [Source:MG... [more]
Zfp6833.052e-4163.39zinc finger protein 683 [Source:MGI Symbol;Acc:MGI... [more]
Zfp938.213e-3846.02zinc finger protein 93 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of SMED30000485 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60636|PRDM1_MOUSE2.710e-5450.79PR domain zinc finger protein 1 OS=Mus musculus OX... [more]
sp|Q93560|BLMP1_CAEEL1.793e-5354.66B lymphocyte-induced maturation protein 1 homolog ... [more]
sp|O75626|PRDM1_HUMAN2.327e-5350.26PR domain zinc finger protein 1 OS=Homo sapiens OX... [more]
sp|I7HJS4|ZN683_MOUSE2.135e-4063.39Tissue-resident T-cell transcription regulator pro... [more]
sp|Q8IZ20|ZN683_HUMAN8.738e-3854.01Tissue-resident T-cell transcription regulator pro... [more]
back to top
BLAST of SMED30000485 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N4YUG49.848e-5755.63Uncharacterized protein OS=Nippostrongylus brasili... [more]
A0A2G9TPP92.163e-5655.00Zinc finger, C2H2 type (Fragment) OS=Teladorsagia ... [more]
A0A1I7Z8R83.691e-5660.26Uncharacterized protein OS=Steinernema glaseri OX=... [more]
K1QVM15.107e-5661.84PR domain zinc finger protein 1 OS=Crassostrea gig... [more]
A0A267ETN95.905e-5659.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm1a1.571e-5149.47PR/SET domain 1 [Source:NCBI gene;Acc:103047552][more]
ENSAMXT00000045728.15.851e-3643.03pep primary_assembly:Astyanax_mexicanus-2.0:2:1502... [more]
ENSAMXT00000008864.25.110e-3550.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000006669.27.683e-3544.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050172.19.734e-3534.68zinc finger protein 883-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003937.14.786e-5550.00pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gen... [more]
PRDM17.139e-3946.67PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
ENSPMAT00000001428.16.339e-3045.45pep scaffold:Pmarinus_7.0:GL481113:143068:144258:1... [more]
ENSPMAT00000000467.11.714e-2944.44pep scaffold:Pmarinus_7.0:GL480927:176958:178556:1... [more]
ENSPMAT00000008540.12.251e-2943.17pep scaffold:Pmarinus_7.0:GL486672:772:1638:-1 gen... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP14.357e-2137.50Zinc-regulated transcription factor; binds to zinc... [more]
AZF12.394e-2038.60Zinc-finger transcription factor; involved in diau... [more]
CRZ15.960e-1336.67Transcription factor, activates transcription of s... [more]
MIG33.093e-1250.00Transcriptional regulator; partially nonfunctional... [more]
MIG21.843e-1041.10Zinc finger transcriptional repressor; cooperates ... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491166.239e-3747.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400362.223e-3145.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476928.791e-3141.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431771.273e-3041.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431813.084e-3041.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30000485 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm14.769e-5052.05PR/SET domain 1 [Source:NCBI gene;Acc:101164431][more]
prdm1b1.303e-4848.73PR domain containing 1b, with ZNF domain [Source:Z... [more]
prdm1b2.174e-4555.56PR domain zinc finger protein 1-like [Source:NCBI ... [more]
ENSORLT00000026807.13.562e-3551.15pep primary_assembly:ASM223467v1:2:474256:520244:1... [more]
ENSORLT00000030675.15.955e-3549.62zinc finger protein 37 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of SMED30000485 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069311.10.000e+099.75SMESG000069311.1[more]
SMESG000069311.10.000e+099.74SMESG000069311.1[more]
SMESG000005754.11.668e-6840.34SMESG000005754.1[more]
SMESG000005754.12.754e-6840.34SMESG000005754.1[more]
SMESG000000679.15.196e-3142.22SMESG000000679.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000485 ID=SMED30000485|Name=SMED30000485|organism=Schmidtea mediterranea sexual|type=transcript|length=1256bp
GTGAATTAGTAAATCAATTATAAAAATTTACTTTCAATTCTAAAAAATTA
TTTTCATTTTCTTTTTTGAATCATGGGAAAATTTATGACGCAAGCCAATT
TCAACACTTGTTTCAAATTCGACAAGTTGCTCAATGACAGAGTTCAAGAG
AGCATTAAGTTGACAAAAATCGTTTTGCCATCAAATTTGTATACCGATCG
AGATTCGAAATTCGAAAATTGTATTAGAACTGTAAAATTTATTGAACAAA
ATCAATGCATCGCATTTCTGGGAAATAAATTGCATCAATGGCTGAAATTT
TTGTATCATTCCTCGTCAGGTTACCACGCAAATGTCATGCTTGTATACAA
AGGACAGGACTTCTTTTTGGTTTCAACGAGAATAATTAAAGAACACGAAG
AGTTGATTTTGTCTAATGAACCAAAACTGGCAAGTATGAGCTTCAATAGC
TGGAAATATCGGGTTACTAGCATTATTGAATCAAAAGAAGAGGATTCTTC
CAGACCAAAAGACTTTCAAAAACTGATGTTAATGTTTGATTATTTGTGGA
TGAATACTCATGGACGAAATCCATTGCCTTTCTCCATCAACAAACCTATT
CAATCTCCATCGATTAGTCCAAATTTAAAATGCCTAACCGCCAGTACTAG
TCCATCATTAAGTTACAATCGCTCTCCAAAGCGTGGACACAAATCAAAAT
ATCAATGTCAAATCTGTTGTAAACATTTCGGACAGTTATCCAATTTGAAA
GTCCATCAGAGAACTCACACCGGTGAACGACCTTTCAAGTGTCATCTGTG
TGGAAAAGGTTTCACGCAATTGGCCCATTTACAGAAACACAATCTCGTTC
ACACAGGAGAACGACCACACGAGTGTTCGGTTTGTTTGAAACGGTTCAGC
AGTTCGAGTAACTTGAAAACTCATTCCCGATTGCATAATTCGGAAAAGTT
ATGTGAATGTCAAATTTGTAAAACCCAATTTTCTAATTCGACATACTTGA
AAATGCATATGAGACATCACACTAGAGAAACACCGTATCAGTGTTTGAAT
TGCAATGAATCATTCATCACCGTCAGCGGACTCAAATATCATTGGACAGT
CAGCATTTGTCCTGGCTCTGATCTCAATGTTGACATTGAACAGAAACTCG
ACATGCTCGAGGAAGCAACAGATTCGATTAATTTAAAAATGTTGATAAAA
GAAGAAAGAAGATTCAGTTTTTCAGAAGAAATCTCAGATGTTTGGAATAA
ATGAGC
back to top

protein sequence of SMED30000485-orf-1

>SMED30000485-orf-1 ID=SMED30000485-orf-1|Name=SMED30000485-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=394bp
MGKFMTQANFNTCFKFDKLLNDRVQESIKLTKIVLPSNLYTDRDSKFENC
IRTVKFIEQNQCIAFLGNKLHQWLKFLYHSSSGYHANVMLVYKGQDFFLV
STRIIKEHEELILSNEPKLASMSFNSWKYRVTSIIESKEEDSSRPKDFQK
LMLMFDYLWMNTHGRNPLPFSINKPIQSPSISPNLKCLTASTSPSLSYNR
SPKRGHKSKYQCQICCKHFGQLSNLKVHQRTHTGERPFKCHLCGKGFTQL
AHLQKHNLVHTGERPHECSVCLKRFSSSSNLKTHSRLHNSEKLCECQICK
TQFSNSTYLKMHMRHHTRETPYQCLNCNESFITVSGLKYHWTVSICPGSD
LNVDIEQKLDMLEEATDSINLKMLIKEERRFSFSEEISDVWNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0048869cellular developmental process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 238..260
e-value: 0.0079
score: 25.4
coord: 266..288
e-value: 0.02
score: 24.0
coord: 210..232
e-value: 0.03
score: 23.5
coord: 294..316
e-value: 0.84
score: 18.7
coord: 322..342
e-value: 64.0
score: 6.2
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 238..260
e-value: 3.8E-4
score: 20.7
coord: 210..232
e-value: 0.0081
score: 16.6
coord: 266..288
e-value: 0.0041
score: 17.5
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 212..232
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 294..316
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 268..288
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 240..260
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 210..237
score: 16.041
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 294..321
score: 12.009
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 266..293
score: 13.11
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 238..265
score: 16.249
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 287..314
e-value: 1.9E-6
score: 29.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 237..261
e-value: 1.8E-14
score: 55.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 315..344
e-value: 1.5E-6
score: 29.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 208..236
e-value: 2.3E-12
score: 48.5
NoneNo IPR availablePFAMPF12874zf-metcoord: 296..315
e-value: 0.0089
score: 16.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 262..286
e-value: 8.6E-12
score: 46.6
NoneNo IPR availablePANTHERPTHR16515FAMILY NOT NAMEDcoord: 189..368
NoneNo IPR availablePANTHERPTHR16515:SF26PR DOMAIN ZINC FINGER PROTEIN 1coord: 189..368
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 232..284
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 288..340
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 208..241