serine/threonine-protein kinase 33

Overview
Nameserine/threonine-protein kinase 33
Smed IDSMED30000483
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of serine/threonine-protein kinase 33 (SMED30000483) t-SNE clustered cells

Violin plots show distribution of expression levels for serine/threonine-protein kinase 33 (SMED30000483) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of serine/threonine-protein kinase 33 (SMED30000483) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for serine/threonine-protein kinase 33 (SMED30000483) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000483

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000483SMESG000068620.1 SmedASXL_011655SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000483SMESG000068620.1 dd_Smed_v6_11695_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000483SMESG000068620.1 dd_Smed_v4_11695_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Human
Match: STK33 (serine/threonine kinase 33 [Source:HGNC Symbol;Acc:HGNC:14568])

HSP 1 Score: 202.216 bits (513), Expect = 2.175e-59
Identity = 113/317 (35.65%), Postives = 182/317 (57.41%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY-CGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQMAN 998
            N ++  +  I+     ++++ Y    I+G GSFG+V +A        WA+KK  + K        ++ E++++  +KH++I+ ++++ ET K  ++VMELC  G LK+  ++ G FSE E + I+     A+ YLHN +I HRDLK+EN++++S      +  +DN   N  IK+ DFGL+V+ +   E M++  CGTP+YM PE+I    YS+QCDIWS+G+VMY L+ G+ PF   S E L E I    ++ +       S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   54 NFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKS------SLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFE--NAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKN 362          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Human
Match: STK33 (serine/threonine kinase 33 [Source:HGNC Symbol;Acc:HGNC:14568])

HSP 1 Score: 202.216 bits (513), Expect = 5.687e-59
Identity = 113/317 (35.65%), Postives = 182/317 (57.41%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY-CGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQMAN 998
            N ++  +  I+     ++++ Y    I+G GSFG+V +A        WA+KK  + K        ++ E++++  +KH++I+ ++++ ET K  ++VMELC  G LK+  ++ G FSE E + I+     A+ YLHN +I HRDLK+EN++++S      +  +DN   N  IK+ DFGL+V+ +   E M++  CGTP+YM PE+I    YS+QCDIWS+G+VMY L+ G+ PF   S E L E I    ++ +       S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   95 NFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKS------SLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFE--NAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKN 403          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Human
Match: STK33 (serine/threonine kinase 33 [Source:HGNC Symbol;Acc:HGNC:14568])

HSP 1 Score: 202.216 bits (513), Expect = 5.687e-59
Identity = 113/317 (35.65%), Postives = 182/317 (57.41%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY-CGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQMAN 998
            N ++  +  I+     ++++ Y    I+G GSFG+V +A        WA+KK  + K        ++ E++++  +KH++I+ ++++ ET K  ++VMELC  G LK+  ++ G FSE E + I+     A+ YLHN +I HRDLK+EN++++S      +  +DN   N  IK+ DFGL+V+ +   E M++  CGTP+YM PE+I    YS+QCDIWS+G+VMY L+ G+ PF   S E L E I    ++ +       S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   95 NFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKS------SLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFE--NAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKN 403          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Human
Match: STK33 (serine/threonine kinase 33 [Source:HGNC Symbol;Acc:HGNC:14568])

HSP 1 Score: 202.216 bits (513), Expect = 5.687e-59
Identity = 113/317 (35.65%), Postives = 182/317 (57.41%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY-CGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQMAN 998
            N ++  +  I+     ++++ Y    I+G GSFG+V +A        WA+KK  + K        ++ E++++  +KH++I+ ++++ ET K  ++VMELC  G LK+  ++ G FSE E + I+     A+ YLHN +I HRDLK+EN++++S      +  +DN   N  IK+ DFGL+V+ +   E M++  CGTP+YM PE+I    YS+QCDIWS+G+VMY L+ G+ PF   S E L E I    ++ +       S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   95 NFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKS------SLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFE--NAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKN 403          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Human
Match: STK33 (serine/threonine kinase 33 [Source:HGNC Symbol;Acc:HGNC:14568])

HSP 1 Score: 162.54 bits (410), Expect = 6.660e-46
Identity = 90/227 (39.65%), Postives = 134/227 (59.03%), Query Frame = 3
Query:  345 FMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY-CGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGA--DQKESINVLLLMKQMANSKRT 1010
            ++VMELC  G LK+  ++ G FSE E + I+     A+ YLHN +I HRDLK+EN++++S      +  +DN   N  IK+ DFGL+V+ +   E M++  CGTP+YM PE+I    YS+QCDIWS+G+VMY L+ G+ PF   S E L E I    ++ +       S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N+  +
Sbjct:    2 YLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKS------SLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFE--NAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPES 220          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Celegans
Match: F32D8.1 (pep chromosome:WBcel235:V:10880837:10883399:1 gene:WBGene00009326.1 transcript:F32D8.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32D8.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.613e-42
Identity = 94/284 (33.10%), Postives = 148/284 (52.11%), Query Frame = 3
Query:  108 KYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTE----RTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN--LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLT 941
            +  G   ++K YE  +IIG G+F  V   +   DG   A+K+ E    R K  ++  E+ ++++I+H +I+SI +   T+   F+V E    G L +   K G+  E +   I +Q   AL YLH RN+ HRD+K ENLLL             ++FS   +KL DFGL+  +      +   CGTP Y  PE++R   YS +CDIWS+G+V+Y +++G  PF + +   L + I+    N D +P E    S K+ + +  L+N     R  AS++  H W+ 
Sbjct:   60 RVDGRQDIEKQYEIGAIIGKGNFSSVHLTRRKEDGTKCALKQVEKRAMRGKCFFVDNEVEMLSLIQHDHIISIIDAFSTENQYFIVFEHAQYGDLYETIRKNGRIEEPDAAIITLQVASALNYLHERNVVHRDVKPENLLLV------------DKFS---VKLCDFGLACHI---LGPLYRICGTPTYCAPEVLRETGYSTRCDIWSLGVVLYVMLVGYAPFRAPDQTRLFKLIMQAKPNLD-MP-EWKGISLKAKDLVSRLMNKTEERRPLASQIMAHPWIA 323          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 140.584 bits (353), Expect = 6.627e-38
Identity = 83/275 (30.18%), Postives = 148/275 (53.82%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSD-GCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFH--SCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            Y+   ++G+G+F  VF A+  SD G ++AVK    K  + K   ++ E+ ++  ++H NIV + +  +  ++ ++VMEL +GG L D+    G ++E +  +++ Q ++A+ ++H+  + HRDLK ENLL         N   D++     I + DFGLS     +  +M   CGTP Y+ PE+++ K Y K  D+WS+G++ Y L+ G  PF+  S  NL   I+      D    +    S+ + + +  L+  DP  R++  +   H W++G
Sbjct:   22 YDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYY-------NQDEDSK-----IMISDFGLSK--TEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWD--QISDSAKDFITHLMCCDPEARFTCQDALSHPWISG 280          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Celegans
Match: rskn-2 (Putative ribosomal protein S6 kinase alpha-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18846])

HSP 1 Score: 143.665 bits (361), Expect = 5.170e-37
Identity = 94/293 (32.08%), Postives = 155/293 (52.90%), Query Frame = 3
Query:  102 FIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTNYIQWELHLMTIIK-HKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY-CGTPLYMPPEIIR-GKS---YSKQCDIWSMGIVMYTLMLGKKPFHS---CENLTESI-----LNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            F KY     LDK      ++G G+F VV + + + DG  +AVK   +   +  Q E  ++ +++ H NIV + ++     + ++VME+ +G  L ++  K  +F+E+E   IM Q V A++YLH++ I HRDLK EN+L +S+             S+  ++L+DFG +  L  + E  ++  C T  Y  PE++  G S   Y++QCD+WS+G+V++T++ G+ PFH+    E+ TE +       F+   D       + S  +   + GLL  DP  R S  EL  H WL
Sbjct:  375 FAKYK----LDK--SDAGLLGKGAFSVVRRCERVVDGAQFAVKIVSQKFASQAQREARILEMVQGHPNIVQLHDVHSDPLHFYLVMEILTGNELLERIRKLERFTESEAADIMRQLVSAVKYLHDKRIVHRDLKPENILFESID------------SSARLRLVDFGFARLLPNSMEQQLKTPCFTLQYAAPEVLDVGDSQPEYNEQCDLWSLGVVLFTMLSGQVPFHARSRQESATEIMQRICRAEFSFTGDAWT----NVSADAKNLITGLLTVDPKKRLSMQELTAHMWL 645          

HSP 2 Score: 83.5741 bits (205), Expect = 5.830e-17
Identity = 64/222 (28.83%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVF---KAKCLSDGCLWAVKKTERTKTNYIQWEL-HLMT-------IIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLS-VQLKMNQEMMVEYCGTPLYMPPEIIRGK--SYSKQCDIWSMGIVMYTLMLGKKPF 764
            +  + ++G G++G VF   K        ++A+K   +T+    Q  L H M        +     +V++    +TD    +VME   GG L       G F     + ++ + V A+  LH R + +RDLK+EN+LL    +               +KL DFGLS + L    +    YCGT  YM PE+I      YS   D WS+G++ + L+ G  PF
Sbjct:   17 FALLRVLGKGAYGKVFLVRKVGGKDHNTIYAMKVLRKTRVLTKQKTLEHTMAERQVLERLRGTPFLVNLFYAFQTDTKLHIVMEYVRGGELFTHLCSRGHFDLEAARFVIAELVVAIDSLHQRKVIYRDLKLENILLDEEGH---------------VKLTDFGLSKLFLPGELDRANSYCGTIEYMSPEVINRPEGGYSDVVDWWSLGVISFELLTGCSPF 223          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Celegans
Match: R06A10.4 (pep chromosome:WBcel235:I:1089666:1095796:-1 gene:WBGene00019911.1 transcript:R06A10.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R06A10.4)

HSP 1 Score: 136.732 bits (343), Expect = 4.226e-36
Identity = 84/270 (31.11%), Postives = 140/270 (51.85%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF-HSCEN-LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            YE ++++G GSF  V + +       +AVK         +  EL++++ + H  ++ ++E+ ++    F+VM++ SGG + D+    G++SE E ++ +   +  L YLH+  + HRDLK ENLL             D+R    L+ + DFGL+ Q     E M E CGTP Y+ PE++    Y+++ D+W++G++ Y LM G  PF   C + L   I+  N    P   +  S SE + + +  LL  +   R S+S    H WLTG
Sbjct:   71 YEVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVN-GDCGAVNNELNILSRLSHPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHSIRVTHRDLKPENLLYA-----------DSRPEARLL-ITDFGLAYQATKPNETMTETCGTPEYIAPELLLRVPYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYP---QFWSGSELAKQFVDSLLETNSVERLSSSAAMKHEWLTG 324          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Celegans
Match: rskn-2 (Putative ribosomal protein S6 kinase alpha-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18846])

HSP 1 Score: 140.584 bits (353), Expect = 6.629e-36
Identity = 94/301 (31.23%), Postives = 155/301 (51.50%), Query Frame = 3
Query:  102 FIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTNYIQWELHLMTIIK-HKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY---------CGTPLYMPPEIIR-GKS---YSKQCDIWSMGIVMYTLMLGKKPFHS---CENLTESI-----LNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            F KY     LDK      ++G G+F VV + + + DG  +AVK   +   +  Q E  ++ +++ H NIV + ++     + ++VME+ +G  L ++  K  +F+E+E   IM Q V A++YLH++ I HRDLK EN+L +S+             S+  ++L+DFG +  L  + E  ++          C T  Y  PE++  G S   Y++QCD+WS+G+V++T++ G+ PFH+    E+ TE +       F+   D       + S  +   + GLL  DP  R S  EL  H WL
Sbjct:  375 FAKYK----LDK--SDAGLLGKGAFSVVRRCERVVDGAQFAVKIVSQKFASQAQREARILEMVQGHPNIVQLHDVHSDPLHFYLVMEILTGNELLERIRKLERFTESEAADIMRQLVSAVKYLHDKRIVHRDLKPENILFESID------------SSARLRLVDFGFARLLPNSMEQQLKSVQVLRKMTPCFTLQYAAPEVLDVGDSQPEYNEQCDLWSLGVVLFTMLSGQVPFHARSRQESATEIMQRICRAEFSFTGDAWT----NVSADAKNLITGLLTVDPKKRLSMQELTAHMWL 653          

HSP 2 Score: 83.5741 bits (205), Expect = 5.971e-17
Identity = 64/222 (28.83%), Postives = 102/222 (45.95%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVF---KAKCLSDGCLWAVKKTERTKTNYIQWEL-HLMT---IIKHKN----IVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLS-VQLKMNQEMMVEYCGTPLYMPPEIIRGK--SYSKQCDIWSMGIVMYTLMLGKKPF 764
            +  + ++G G++G VF   K        ++A+K   +T+    Q  L H M    +++       +V++    +TD    +VME   GG L       G F     + ++ + V A+  LH R + +RDLK+EN+LL    +               +KL DFGLS + L    +    YCGT  YM PE+I      YS   D WS+G++ + L+ G  PF
Sbjct:   17 FALLRVLGKGAYGKVFLVRKVGGKDHNTIYAMKVLRKTRVLTKQKTLEHTMAERQVLERLRGTPFLVNLFYAFQTDTKLHIVMEYVRGGELFTHLCSRGHFDLEAARFVIAELVVAIDSLHQRKVIYRDLKLENILLDEEGH---------------VKLTDFGLSKLFLPGELDRANSYCGTIEYMSPEVINRPEGGYSDVVDWWSLGVISFELLTGCSPF 223          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111274)

HSP 1 Score: 142.895 bits (359), Expect = 1.303e-36
Identity = 85/283 (30.04%), Postives = 147/283 (51.94%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTK----TNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYL-IKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINS-----DPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKE 959
            Y    IIG G+F +VFK K    G  +A+K  ++ K     +YI  E+ +M  + H +I+S+   ++ +   ++V+E  SGG L D   +  +FSE + + ++     A+ YLH+  I HRD+K ENLL++            +   N L +KL DFGL+ ++    +++   CGTP Y+ PEI+    Y  + D+W+ GI++Y L+ G  PF + +N  E + +  I+      DP   ++G   +   + +  +L  DP  R+++ ++  HSW  G    E
Sbjct:  477 YSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKL-----------DEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIG---DGVRDLIANMLQADPDVRFTSEDILDHSWTIGNKGNE 742          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111277)

HSP 1 Score: 142.895 bits (359), Expect = 1.303e-36
Identity = 85/283 (30.04%), Postives = 147/283 (51.94%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTK----TNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYL-IKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINS-----DPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKE 959
            Y    IIG G+F +VFK K    G  +A+K  ++ K     +YI  E+ +M  + H +I+S+   ++ +   ++V+E  SGG L D   +  +FSE + + ++     A+ YLH+  I HRD+K ENLL++            +   N L +KL DFGL+ ++    +++   CGTP Y+ PEI+    Y  + D+W+ GI++Y L+ G  PF + +N  E + +  I+      DP   ++G   +   + +  +L  DP  R+++ ++  HSW  G    E
Sbjct:  477 YSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKL-----------DEHGNVLELKLADFGLACEV---NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIG---DGVRDLIANMLQADPDVRFTSEDILDHSWTIGNKGNE 742          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 135.961 bits (341), Expect = 1.249e-35
Identity = 90/282 (31.91%), Postives = 148/282 (52.48%), Query Frame = 3
Query:  126 SLDKYYETISIIGSGSFGVVFKAKCL-SDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKM-NQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFH--SCENLTESILNFNINSD-PLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            S+++ Y    ++G+G+F  V  A+   S G  +AVK    K  + K   ++ E+ ++  + H NIV + E  E     ++VMEL +GG L D+  + G ++E +  H++ Q ++A+ Y+H + + HRDLK ENLL  S  +  K            I + DFGLS   KM +  +M   CGTP Y+ PE++  K Y K  D+WS+G++ Y L+ G  PF+  +  NL   IL  +   D P   E+   SE +   ++ L+      RY+  +   H+W++G
Sbjct:   26 SIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSK------------IMISDFGLS---KMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEI---SESAKHFIKNLMCVTVEKRYTCKQALGHAWISG 289          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 136.732 bits (343), Expect = 1.475e-34
Identity = 83/274 (30.29%), Postives = 139/274 (50.73%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTK------TNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQ-FSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSD-PLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            YE   ++G G F  V+KA+CL      A+K  ++        TN ++ E+ + + +KH +++ +    +   Y ++V+EL   G L    N   + F+ETE   I+ Q V  L YLH+ NI HRD+ + NLLL                    +K+ DFGL+ QLK   E  +  CGTP Y+ PE++   S+    D+WS+G ++YTL++G+ PF +  +  +S LN  + S+  +P  L   S ++ + +  LL   P  R +   +  H ++
Sbjct:   14 YEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSR---------------EMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFET--DAVQSTLNKVVMSEYIMPAHL---SYEAQDLINKLLKKLPHERITLEAVLCHPFM 267          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0301503)

HSP 1 Score: 135.191 bits (339), Expect = 7.077e-34
Identity = 96/304 (31.58%), Postives = 149/304 (49.01%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSY-SKQCDIWSMGIVMYTLMLGKKPFH--SCENLTESILN------FNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLT-GADQKESINVLLLMKQMANSKR 1007
            Y+ I  IG G+F  V  AK L  G   A+K  ++T+ N      +  E+ +M ++ H NIV + ++IET+K  +++ME  SGG + D     G+  E E +    Q V A++Y H + I HRDLK ENLLL S  N               IK+ DFG S +     ++   +CG+P Y  PE+ +GK Y   + D+WS+G+++YTL+ G  PF   +   L E +L       F +++D   CE           LR  L  +P+ R S   +    W+  G ++ E    +     +A+ KR
Sbjct:  481 YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELN---------------IKIADFGFSNEFTPGSKLDT-FCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTD---CE---------NLLRKFLVLNPAKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKR 756          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Zebrafish
Match: stk33 (serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GENE-040724-242])

HSP 1 Score: 216.853 bits (551), Expect = 5.459e-65
Identity = 119/321 (37.07%), Postives = 190/321 (59.19%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSC--ENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESI---NVLLLMKQMANS 1001
            N+++  +   +     S+ K Y     +G GSFGVV +A  +     WA+KK  + K       +++ E+ +M  +KH++I+ ++E+ ET K  ++V ELC GG LKD   K   F+E E +HI+    +A+ YLH ++I HRDLK+EN+L++S      + GNDN   N  IK+ DFGLSVQ     ++ M+   CGTP+YM PE++ G  YS+QCD+WS+G++MY L+ G+ PF S   E L+E I+   +  S P+     + S+ +   +R LL  DP++R +A+EL  + W++G D   ++   NVL +M+Q  N+
Sbjct:   27 NSAEKKVPHTRIEDESSIQKIYSFGRKLGQGSFGVVCEATHIETQRKWAIKKVNKEKAGTSGVKHLEREVSIMKQVKHEHIIHLEEVFETPKRMYLVTELCEGGDLKDLLQKNKHFTEEETRHIIKSLSEAIVYLHKKDIVHRDLKLENILVKSC-----HQGNDNDMVN--IKVTDFGLSVQKGGVGSENMLQATCGTPIYMAPEVVNGHQYSQQCDLWSIGVIMYMLLCGEPPFGSSSKERLSEMIMKGELTFSGPV---WNTISDAAKNVIRCLLKVDPAHRITANELLDNPWISG-DTSTAVTRTNVLEMMRQFRNA 336          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Zebrafish
Match: stk33 (serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GENE-040724-242])

HSP 1 Score: 216.853 bits (551), Expect = 6.261e-65
Identity = 119/321 (37.07%), Postives = 190/321 (59.19%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSC--ENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESI---NVLLLMKQMANS 1001
            N+++  +   +     S+ K Y     +G GSFGVV +A  +     WA+KK  + K       +++ E+ +M  +KH++I+ ++E+ ET K  ++V ELC GG LKD   K   F+E E +HI+    +A+ YLH ++I HRDLK+EN+L++S      + GNDN   N  IK+ DFGLSVQ     ++ M+   CGTP+YM PE++ G  YS+QCD+WS+G++MY L+ G+ PF S   E L+E I+   +  S P+     + S+ +   +R LL  DP++R +A+EL  + W++G D   ++   NVL +M+Q  N+
Sbjct:   27 NSAEKKVPHTRIEDESSIQKIYSFGRKLGQGSFGVVCEATHIETQRKWAIKKVNKEKAGTSGVKHLEREVSIMKQVKHEHIIHLEEVFETPKRMYLVTELCEGGDLKDLLQKNKHFTEEETRHIIKSLSEAIVYLHKKDIVHRDLKLENILVKSC-----HQGNDNDMVN--IKVTDFGLSVQKGGVGSENMLQATCGTPIYMAPEVVNGHQYSQQCDLWSIGVIMYMLLCGEPPFGSSSKERLSEMIMKGELTFSGPV---WNTISDAAKNVIRCLLKVDPAHRITANELLDNPWISG-DTSTAVTRTNVLEMMRQFRNA 336          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Zebrafish
Match: camk1db (calcium/calmodulin-dependent protein kinase 1Db [Source:ZFIN;Acc:ZDB-GENE-070112-1872])

HSP 1 Score: 158.303 bits (399), Expect = 4.839e-44
Identity = 97/298 (32.55%), Postives = 160/298 (53.69%), Query Frame = 3
Query:   72 MENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            M   S+ +++      +D + K +E   I+G+G+F  V  A+  + G ++AVK    K  R K + I+ E+ ++  IKH+NIV+++++ E+  + +++M+L SGG L D+  + G ++E +   ++ Q +DA+ YLH+  I HRDLK ENLL     NP + +          I + DFGLS       ++M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL      D    +    S+ + + +  L+  DP  R++  E   H W+ G
Sbjct:    1 MARGSEESVNGSWKKQVDDIRKIFEFKEILGTGAFSEVVLAQEKATGDMYAVKCIPKKALRGKESGIENEIAVLRKIKHENIVALEDIYESPSHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYF---NPHEESK---------IMISDFGLSKMEGAANDIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD-ENDSKLFEQILKAEYEFDSPYWD--DISDSAKDFINNLMQKDPEKRFTCDEALRHPWIAG 283          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Zebrafish
Match: camk1db (calcium/calmodulin-dependent protein kinase 1Db [Source:ZFIN;Acc:ZDB-GENE-070112-1872])

HSP 1 Score: 157.918 bits (398), Expect = 9.429e-44
Identity = 97/298 (32.55%), Postives = 160/298 (53.69%), Query Frame = 3
Query:   72 MENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            M   S+ +++      +D + K +E   I+G+G+F  V  A+  + G ++AVK    K  R K + I+ E+ ++  IKH+NIV+++++ E+  + +++M+L SGG L D+  + G ++E +   ++ Q +DA+ YLH+  I HRDLK ENLL     NP + +          I + DFGLS       ++M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL      D    +    S+ + + +  L+  DP  R++  E   H W+ G
Sbjct:    1 MARGSEESVNGSWKKQVDDIRKIFEFKEILGTGAFSEVVLAQEKATGDMYAVKCIPKKALRGKESGIENEIAVLRKIKHENIVALEDIYESPSHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYF---NPHEESK---------IMISDFGLSKMEGAANDIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD-ENDSKLFEQILKAEYEFDSPYWD--DISDSAKDFINNLMQKDPEKRFTCDEALRHPWIAG 283          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 152.91 bits (385), Expect = 5.042e-42
Identity = 94/274 (34.31%), Postives = 152/274 (55.47%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN--LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            Y+   ++G+G+F  VF A+      L A+K    K    K N I+ E+ ++  IKH+NIVS++++ E+  + ++VM+L SGG L D+  + G ++E +   ++ Q +DA++YLH+  I HRDLK ENLL  S+             SN +I   DFGLS +++ +  +M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+   +  L E IL      D    +    S+ + + +  L+  DPS RY+  +   H W++G
Sbjct:   21 YDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKALEGKENSIENEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEED----------SNIMIS--DFGLS-KIEDSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWD--DISDSAKDFISHLMEKDPSLRYTCEQALLHPWISG 279          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Xenopus
Match: fbln1 (fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765])

HSP 1 Score: 186.037 bits (471), Expect = 4.245e-54
Identity = 110/320 (34.38%), Postives = 170/320 (53.12%), Query Frame = 3
Query:   75 ENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQ--KESINVLLLMKQMAN 998
            +N+++  +   +     ++ + Y     +G GSFGVV +A        WA+KK  R K        ++ E+ ++  +KH +I+ ++E+ ET K  ++V ELC GG L    ++    S+ E +H++      + YLH + I HRDLK+EN+L++S      N G DN      IK+ DFGL+VQ     ++ M+   CGTP+YM PE+I    YS+QCDIWS G++MY L+ G  PF   S E L E I    +  SD +       S  + + L+ LL  DP++R +A+EL  + W+TG     +   NVL LM    N
Sbjct:   20 DNSAESKVPHTRMDDEAAIQQIYTFGKKLGQGSFGVVIEATHKETATKWAMKKVNREKAGSSAVKLLEREVSILKRVKHDHIIHLEEVFETPKRMYLVTELCEGGELPKILHRKKCLSKAETRHVIRNLGSPIAYLHRKGIVHRDLKLENILVKS------NDGADNEELILNIKVTDFGLAVQKGGVGSENMLQSTCGTPIYMAPEVINDHDYSQQCDIWSTGVIMYMLLSGNPPFMAGSEEKLFEDIRRGELKFSDAV---WQGISNAAKDVLQRLLKVDPAHRITANELLDNPWITGETTLVQRPTNVLELMNAWKN 330          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Xenopus
Match: fbln1 (fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765])

HSP 1 Score: 186.422 bits (472), Expect = 4.997e-54
Identity = 110/320 (34.38%), Postives = 170/320 (53.12%), Query Frame = 3
Query:   75 ENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQ--KESINVLLLMKQMAN 998
            +N+++  +   +     ++ + Y     +G GSFGVV +A        WA+KK  R K        ++ E+ ++  +KH +I+ ++E+ ET K  ++V ELC GG L    ++    S+ E +H++      + YLH + I HRDLK+EN+L++S      N G DN      IK+ DFGL+VQ     ++ M+   CGTP+YM PE+I    YS+QCDIWS G++MY L+ G  PF   S E L E I    +  SD +       S  + + L+ LL  DP++R +A+EL  + W+TG     +   NVL LM    N
Sbjct:   20 DNSAESKVPHTRMDDEAAIQQIYTFGKKLGQGSFGVVIEATHKETATKWAMKKVNREKAGSSAVKLLEREVSILKRVKHDHIIHLEEVFETPKRMYLVTELCEGGELPKILHRKKCLSKAETRHVIRNLGSPIAYLHRKGIVHRDLKLENILVKS------NDGADNEELILNIKVTDFGLAVQKGGVGSENMLQSTCGTPIYMAPEVINDHDYSQQCDIWSTGVIMYMLLSGNPPFMAGSEEKLFEDIRRGELKFSDAV---WQGISNAAKDVLQRLLKVDPAHRITANELLDNPWITGETTLVQRPTNVLELMNAWKN 330          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Xenopus
Match: fbln1 (fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765])

HSP 1 Score: 182.57 bits (462), Expect = 2.889e-53
Identity = 104/306 (33.99%), Postives = 164/306 (53.59%), Query Frame = 3
Query:   75 ENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKES 962
            +N+++  +   +     ++ + Y     +G GSFGVV +A        WA+KK  R K        ++ E+ ++  +KH +I+ ++E+ ET K  ++V ELC GG L    ++    S+ E +H++      + YLH + I HRDLK+EN+L++S      N G DN      IK+ DFGL+VQ     ++ M+   CGTP+YM PE+I    YS+QCDIWS G++MY L+ G  PF   S E L E I    +  SD +       S  + + L+ LL  DP++R +A+EL  + W+T +    S
Sbjct:   20 DNSAESKVPHTRMDDEAAIQQIYTFGKKLGQGSFGVVIEATHKETATKWAMKKVNREKAGSSAVKLLEREVSILKRVKHDHIIHLEEVFETPKRMYLVTELCEGGELPKILHRKKCLSKAETRHVIRNLGSPIAYLHRKGIVHRDLKLENILVKS------NDGADNEELILNIKVTDFGLAVQKGGVGSENMLQSTCGTPIYMAPEVINDHDYSQQCDIWSTGVIMYMLLSGNPPFMAGSEEKLFEDIRRGELKFSDAV---WQGISNAAKDVLQRLLKVDPAHRITANELLDNPWITASTAASS 316          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Xenopus
Match: fbln1 (fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765])

HSP 1 Score: 182.57 bits (462), Expect = 7.279e-53
Identity = 111/320 (34.69%), Postives = 169/320 (52.81%), Query Frame = 3
Query:   75 ENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQ--KESINVLLLMKQMAN 998
            +N+++  +   +     ++ + Y     +G GSFGVV +A        WA+KK  R K        ++ E+ ++  +KH +I+ ++E+ ET K  ++  ELC GG L    ++    S+TE +H       A+ YLH + I HRDLK+EN+L++S      N G DN      IK+ DFGL+VQ     ++ M+   CGTP+YM PE+I    YS+QCDIWS G++MY L+ G  PF   S E L E I    +  SD +       S  + + L+ LL  DP++R +A+EL  + W+TG     +   NVL LM    N
Sbjct:   20 DNSAESKVPHTRMDDEAAIQQIYTFGKKLGQGSFGVVIEATHKETATKWAMKKVNREKAGSSAVKLLEREVSILKRVKHDHIIHLEEVFETPKRMYLGTELCEGGELPKILHRKKCLSKTETRHGNRSLGSAIGYLHRKGIVHRDLKLENILVKS------NDGADNEELILNIKVTDFGLAVQKGGVGSENMLQSTCGTPIYMAPEVINDHDYSQQCDIWSTGVIMYMLLSGNPPFMAGSEEKLFEDIRRGELKFSDAV---WQGISNAAKDVLQRLLKVDPAHRITANELLDNPWITGETTLVQRPTNVLELMNAWKN 330          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Xenopus
Match: anapc16 (anaphase promoting complex subunit 16 [Source:Xenbase;Acc:XB-GENE-953456])

HSP 1 Score: 148.288 bits (373), Expect = 1.037e-40
Identity = 93/275 (33.82%), Postives = 152/275 (55.27%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            ++T++  G G+F  V  A+  + G L+AVK    K  + K + I+ E+ ++  IKH+NIV+++++ E+  + ++VM+L SGG L D+  + G ++E +   ++ Q +DA+ YLH   I HRDLK ENLL  S     K            I + DFGLS +++   ++M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL  +   D    +    SE + + ++ L+  D + RY+  +   H W+ G
Sbjct:   12 HQTLTATGLGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPSHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVSYLHRLGIVHRDLKPENLLYFSQVEESK------------IMISDFGLS-KMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD-ENDSKLFEQILKADYEFDSPYWD--DISESAKDFIQHLMEKDSNKRYTCEQALRHPWIAG 270          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Mouse
Match: Stk33 (serine/threonine kinase 33 [Source:MGI Symbol;Acc:MGI:2152419])

HSP 1 Score: 202.216 bits (513), Expect = 1.841e-59
Identity = 113/313 (36.10%), Postives = 180/313 (57.51%), Query Frame = 3
Query:   96 ISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQL--KMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGA--DQKESINVLLLMKQMAN 998
            I  I+      ++++Y    I+G GSFG+VF+A     G  WA+KK  + K        ++ E+ ++  + H++I+ ++++ E+ +  ++VMELC  G LK   ++ G FSE E + I+     A+ YLHN++I HRDLK+EN++++S      +  +DN   N  IK+ DFGLSVQ     ++ MM   CGTP+YM PE+I    YS+QCDIWS+G++M+ L+ G+ PF  +S E L E I    +   +P+     S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   96 IPHIRMDDGAGIEEFYTFGRILGQGSFGMVFEAIDKETGAKWAIKKVNKEKAGSSAMKLLEREVSILKTVNHQHIIHLEQVFESPQKMYLVMELCEDGELKAVMDQRGHFSENETRLIIQSLASAIAYLHNKDIVHRDLKLENIMVKS------SFIDDNNEMNLNIKVTDFGLSVQKHGSRSEGMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMFILLCGEPPFLANSEEKLYELIKKGELRFENPV---WESVSDSAKNTLKQLMKVDPAHRITAKELLDNQWLTGNTLSSARPTNVLEMMKEWKN 399          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Mouse
Match: Stk33 (serine/threonine kinase 33 [Source:MGI Symbol;Acc:MGI:2152419])

HSP 1 Score: 202.216 bits (513), Expect = 1.841e-59
Identity = 113/313 (36.10%), Postives = 180/313 (57.51%), Query Frame = 3
Query:   96 ISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQL--KMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGA--DQKESINVLLLMKQMAN 998
            I  I+      ++++Y    I+G GSFG+VF+A     G  WA+KK  + K        ++ E+ ++  + H++I+ ++++ E+ +  ++VMELC  G LK   ++ G FSE E + I+     A+ YLHN++I HRDLK+EN++++S      +  +DN   N  IK+ DFGLSVQ     ++ MM   CGTP+YM PE+I    YS+QCDIWS+G++M+ L+ G+ PF  +S E L E I    +   +P+     S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   96 IPHIRMDDGAGIEEFYTFGRILGQGSFGMVFEAIDKETGAKWAIKKVNKEKAGSSAMKLLEREVSILKTVNHQHIIHLEQVFESPQKMYLVMELCEDGELKAVMDQRGHFSENETRLIIQSLASAIAYLHNKDIVHRDLKLENIMVKS------SFIDDNNEMNLNIKVTDFGLSVQKHGSRSEGMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMFILLCGEPPFLANSEEKLYELIKKGELRFENPV---WESVSDSAKNTLKQLMKVDPAHRITAKELLDNQWLTGNTLSSARPTNVLEMMKEWKN 399          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Mouse
Match: Stk33 (serine/threonine kinase 33 [Source:MGI Symbol;Acc:MGI:2152419])

HSP 1 Score: 202.216 bits (513), Expect = 1.841e-59
Identity = 113/313 (36.10%), Postives = 180/313 (57.51%), Query Frame = 3
Query:   96 ISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQL--KMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGA--DQKESINVLLLMKQMAN 998
            I  I+      ++++Y    I+G GSFG+VF+A     G  WA+KK  + K        ++ E+ ++  + H++I+ ++++ E+ +  ++VMELC  G LK   ++ G FSE E + I+     A+ YLHN++I HRDLK+EN++++S      +  +DN   N  IK+ DFGLSVQ     ++ MM   CGTP+YM PE+I    YS+QCDIWS+G++M+ L+ G+ PF  +S E L E I    +   +P+     S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   96 IPHIRMDDGAGIEEFYTFGRILGQGSFGMVFEAIDKETGAKWAIKKVNKEKAGSSAMKLLEREVSILKTVNHQHIIHLEQVFESPQKMYLVMELCEDGELKAVMDQRGHFSENETRLIIQSLASAIAYLHNKDIVHRDLKLENIMVKS------SFIDDNNEMNLNIKVTDFGLSVQKHGSRSEGMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMFILLCGEPPFLANSEEKLYELIKKGELRFENPV---WESVSDSAKNTLKQLMKVDPAHRITAKELLDNQWLTGNTLSSARPTNVLEMMKEWKN 399          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Mouse
Match: Stk33 (serine/threonine kinase 33 [Source:MGI Symbol;Acc:MGI:2152419])

HSP 1 Score: 185.267 bits (469), Expect = 3.014e-54
Identity = 104/286 (36.36%), Postives = 166/286 (58.04%), Query Frame = 3
Query:  180 VVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQL--KMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGA--DQKESINVLLLMKQMANS 1001
            +VF+A     G  WA+KK  + K        ++ E+ ++  + H++I+ ++++ E+ +  ++VMELC  G LK   ++ G FSE E + I+     A+ YLHN++I HRDLK+EN++++S      +  +DN   N  IK+ DFGLSVQ     ++ MM   CGTP+YM PE+I    YS+QCDIWS+G++M+ L+ G+ PF  +S E L E I    +   +P+     S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N+
Sbjct:    1 MVFEAIDKETGAKWAIKKVNKEKAGSSAMKLLEREVSILKTVNHQHIIHLEQVFESPQKMYLVMELCEDGELKAVMDQRGHFSENETRLIIQSLASAIAYLHNKDIVHRDLKLENIMVKS------SFIDDNNEMNLNIKVTDFGLSVQKHGSRSEGMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMFILLCGEPPFLANSEEKLYELIKKGELRFENPV---WESVSDSAKNTLKQLMKVDPAHRITAKELLDNQWLTGNTLSSARPTNVLEMMKEWKNN 277          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 154.066 bits (388), Expect = 3.158e-42
Identity = 95/281 (33.81%), Postives = 154/281 (54.80%), Query Frame = 3
Query:  123 DSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            + + K +E    +G+G+F  V  A+  + G L+AVK    K  + K + I+ E+ ++  IKH+NIV+++++ E+  + ++VM+L SGG L D+  + G ++E +   ++ Q +DA+ YLH   I HRDLK ENLL  S     K            I + DFGLS +++   ++M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL      D    +    S+ + + +R L+  DP+ RY+  +   H W+ G
Sbjct:   17 EDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESK------------IMISDFGLS-KMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD-ENDSKLFEQILKAEYEFDSPYWD--DISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAG 281          
BLAST of serine/threonine-protein kinase 33 vs. UniProt/SwissProt
Match: sp|Q924X7|STK33_MOUSE (Serine/threonine-protein kinase 33 OS=Mus musculus OX=10090 GN=Stk33 PE=1 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 1.288e-58
Identity = 113/313 (36.10%), Postives = 180/313 (57.51%), Query Frame = 3
Query:   96 ISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQL--KMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGA--DQKESINVLLLMKQMAN 998
            I  I+      ++++Y    I+G GSFG+VF+A     G  WA+KK  + K        ++ E+ ++  + H++I+ ++++ E+ +  ++VMELC  G LK   ++ G FSE E + I+     A+ YLHN++I HRDLK+EN++++S      +  +DN   N  IK+ DFGLSVQ     ++ MM   CGTP+YM PE+I    YS+QCDIWS+G++M+ L+ G+ PF  +S E L E I    +   +P+     S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   96 IPHIRMDDGAGIEEFYTFGRILGQGSFGMVFEAIDKETGAKWAIKKVNKEKAGSSAMKLLEREVSILKTVNHQHIIHLEQVFESPQKMYLVMELCEDGELKAVMDQRGHFSENETRLIIQSLASAIAYLHNKDIVHRDLKLENIMVKS------SFIDDNNEMNLNIKVTDFGLSVQKHGSRSEGMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMFILLCGEPPFLANSEEKLYELIKKGELRFENPV---WESVSDSAKNTLKQLMKVDPAHRITAKELLDNQWLTGNTLSSARPTNVLEMMKEWKN 399          
BLAST of serine/threonine-protein kinase 33 vs. UniProt/SwissProt
Match: sp|Q9BYT3|STK33_HUMAN (Serine/threonine-protein kinase 33 OS=Homo sapiens OX=9606 GN=STK33 PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.731e-58
Identity = 113/317 (35.65%), Postives = 182/317 (57.41%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEY-CGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQMAN 998
            N ++  +  I+     ++++ Y    I+G GSFG+V +A        WA+KK  + K        ++ E++++  +KH++I+ ++++ ET K  ++VMELC  G LK+  ++ G FSE E + I+     A+ YLHN +I HRDLK+EN++++S      +  +DN   N  IK+ DFGL+V+ +   E M++  CGTP+YM PE+I    YS+QCDIWS+G+VMY L+ G+ PF   S E L E I    ++ +       S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   95 NFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKS------SLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFE--NAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKN 403          
BLAST of serine/threonine-protein kinase 33 vs. UniProt/SwissProt
Match: sp|Q0VD22|STK33_BOVIN (Serine/threonine-protein kinase 33 OS=Bos taurus OX=9913 GN=STK33 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 5.442e-56
Identity = 118/321 (36.76%), Postives = 180/321 (56.07%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVE-YCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESI----LNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQMAN 998
            N ++  +  I+     +L + Y    I+G GSFG+V +A        WA+KK  + K        ++ E+ ++  +KH++I+ ++++ ET K  ++VMELC  G LK+   + G FSE E + I+     A+ YLHN++I HRDLK+EN++++S      N  N N      IK+ DFGL+V+     E+M++  CGTP+YM PE+I    YS+QCDIWS+G++MY L+ GK PF   S E L E I    L+F  NS        S S+ +   L+ L+  DP++R +A EL  + WLTG         NVL +MK+  N
Sbjct:   95 NFTEGKVPHIRMDNGAALQEIYTFGRILGQGSFGMVIEAIDKERETKWAIKKVNKEKAGSSAVKLLEREVDILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILERKGHFSENETRWIIQSLASAIAYLHNKDIVHRDLKLENIMVKSSFIDANNEMNLN------IKVTDFGLAVKKHGRSEVMLQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMYILLCGKAPFMASSEEKLFELIKKGELHFK-NSI-----WNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNTVSSARPTNVLEMMKEWKN 403          
BLAST of serine/threonine-protein kinase 33 vs. UniProt/SwissProt
Match: sp|Q54MH0|FHKD_DICDI (Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum OX=44689 GN=fhkD PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.148e-45
Identity = 98/300 (32.67%), Postives = 160/300 (53.33%), Query Frame = 3
Query:  123 DSLDKYYETISIIGSGSFGVV-----------FKAKCLSDGCLWAVKKTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIR-----------GKSYSKQCDIWSMGIVMYTLMLGKKP--FHSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGAD 950
            + ++K Y    I+G+G+F VV           F  K +     W+  KT R     ++ E+ ++  IKH NI+SI +++++D+Y ++V+EL +GG L ++  + G+FSE E K    Q ++A+ YLH+ NI+HRDLK EN+L+ +V + K +          +IK+ DFGL+ ++   +EM    CGTPLY+ PEIIR              Y K+ D+WS+G ++Y L+ G+ P  F    N    ++N  + +  LP      +E + + ++ LLN DP+ R S      H W    D
Sbjct:  193 EEMNKKYSIQGILGTGNFSVVKRCIRRDTGEVFAVKIIDKKKFWSQTKTRR----QMESEVEILQKIKHPNIISIIDIVQSDRYFYIVLELATGGELFEKIKQKGRFSEPEAKDTFKQILEAVSYLHDLNISHRDLKPENILISAVSHGKSS----------VIKVTDFGLA-KIIGEKEMATTLCGTPLYVAPEIIRNCLHGDGGAQVNTGYGKEVDVWSLGCILYILLSGRPPFDFDHTNNFNLKLINQGLYNFSLPV-WDVVTENAKDLIKKLLNVDPTKRISTKGALSHDWFNDDD 476          
BLAST of serine/threonine-protein kinase 33 vs. UniProt/SwissProt
Match: sp|Q869W6|MYLKG_DICDI (Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275057 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.764e-41
Identity = 101/300 (33.67%), Postives = 160/300 (53.33%), Query Frame = 3
Query:   75 ENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKA--KCLSDGCLWAVKKTERTKTNYIQW---ELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFH-SCENLT-ESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQ 953
            E  +D  IS  +     +++ +Y     +G G+F VV +   K  SD       + +  K  +I+    E+ +M  +KH+N++S+KE+ E+D +  +VMEL +GG L  +  + G F+E   ++++ Q    + YLH++ IAHRDLK ENLL           G D       IK+ DFGLS ++    E +   CGTP Y+ PE++ G SY    D+WS+G++ Y L+ G  PF+ S +NL  E IL  + +  P P E    SE +   +R L+  DP  R++A +     WL+G+DQ
Sbjct:   34 EVRADEKISMDQDISQGNVEDFYVVGKELGRGAFSVVREGTRKTTSDKVALKYIEKKFVKKKHIEQLRREIDIMKKVKHENVLSLKEIFESDSHLTLVMELVTGGELFYKIVERGSFTEKGARNVVRQVCAGVEYLHSQGIAHRDLKPENLLCN-------GEGED-----MTIKIADFGLS-KIFGTGEALETSCGTPDYVAPEVLTGGSYDNAVDMWSIGVITYILLCGFPPFYASSQNLLFEKILTADYDF-PEP-EWTHVSEHAKAFIRNLIVKDPDQRHTAKQCLDDLWLSGSDQ 318          
BLAST of serine/threonine-protein kinase 33 vs. TrEMBL
Match: A0A1S3HC64 (serine/threonine-protein kinase 33 OS=Lingula unguis OX=7574 GN=LOC106153985 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.493e-63
Identity = 120/298 (40.27%), Postives = 182/298 (61.07%), Query Frame = 3
Query:  129 LDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKT-----NYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSV-QLKMNQE-MMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN--LTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQK-ESINVLLLMKQ 989
            ++K YE    +G GSFGVV +AK  + G  WA+K   + K        ++ E+ ++  ++H++I+ ++E++ET K  ++V+ELC  G L D   + G+F+E E K IM     A++YLH  +I HRDLK+EN+LL   P        +N      IK+ DFGLSV +  +  E MM ++CGTP+YM PEII  K+YS+QCD+W+MGI+MYTL+ G  PF + E   L E I    I+ S+P+  E+   SE +   + G+L  DP++R +ASE+  H W+TG ++  +  NVL +MKQ
Sbjct:   25 IEKTYELSKKLGQGSFGVVKEAKNRATGVTWAIKAVNKEKAGSSAIQLLEREVAILKKVQHEHIIHLEEVLETAKRMYLVLELCDQGELADVLKEKGKFTEAETKTIMRNLASAIQYLHKNDIVHRDLKLENILLSHNP--------ENPEDKLHIKVTDFGLSVCKGGVGHENMMQDFCGTPIYMSPEIIDNKTYSQQCDVWAMGIIMYTLLCGNPPFRAREEEKLYEMIKKGEIDFSEPVWEEI---SEDAKHVISGMLKVDPAHRTTASEVLAHPWITGEERTCQPANVLEMMKQ 311          
BLAST of serine/threonine-protein kinase 33 vs. TrEMBL
Match: Q5RHZ0 (Serine/threonine kinase 33 OS=Danio rerio OX=7955 GN=stk33 PE=2 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 1.221e-61
Identity = 119/321 (37.07%), Postives = 190/321 (59.19%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSC--ENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESI---NVLLLMKQMANS 1001
            N+++  +   +     S+ K Y     +G GSFGVV +A  +     WA+KK  + K       +++ E+ +M  +KH++I+ ++E+ ET K  ++V ELC GG LKD   K   F+E E +HI+    +A+ YLH ++I HRDLK+EN+L++S      + GNDN   N  IK+ DFGLSVQ     ++ M+   CGTP+YM PE++ G  YS+QCD+WS+G++MY L+ G+ PF S   E L+E I+   +  S P+     + S+ +   +R LL  DP++R +A+EL  + W++G D   ++   NVL +M+Q  N+
Sbjct:   27 NSAEKKVPHTRIEDESSIQKIYSFGRKLGQGSFGVVCEATHIETQRKWAIKKVNKEKAGTSGVKHLEREVSIMKQVKHEHIIHLEEVFETPKRMYLVTELCEGGDLKDLLQKNKHFTEEETRHIIKSLSEAIVYLHKKDIVHRDLKLENILVKSC-----HQGNDNDMVN--IKVTDFGLSVQKGGVGSENMLQATCGTPIYMAPEVVNGHQYSQQCDLWSIGVIMYMLLCGEPPFGSSSKERLSEMIMKGELTFSGPV---WNTISDAAKNVIRCLLKVDPAHRITANELLDNPWISG-DTSTAVTRTNVLEMMRQFRNA 336          
BLAST of serine/threonine-protein kinase 33 vs. TrEMBL
Match: E7F3U5 (Serine/threonine kinase 33 OS=Danio rerio OX=7955 GN=stk33 PE=3 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 1.401e-61
Identity = 119/321 (37.07%), Postives = 190/321 (59.19%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSC--ENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESI---NVLLLMKQMANS 1001
            N+++  +   +     S+ K Y     +G GSFGVV +A  +     WA+KK  + K       +++ E+ +M  +KH++I+ ++E+ ET K  ++V ELC GG LKD   K   F+E E +HI+    +A+ YLH ++I HRDLK+EN+L++S      + GNDN   N  IK+ DFGLSVQ     ++ M+   CGTP+YM PE++ G  YS+QCD+WS+G++MY L+ G+ PF S   E L+E I+   +  S P+     + S+ +   +R LL  DP++R +A+EL  + W++G D   ++   NVL +M+Q  N+
Sbjct:   27 NSAEKKVPHTRIEDESSIQKIYSFGRKLGQGSFGVVCEATHIETQRKWAIKKVNKEKAGTSGVKHLEREVSIMKQVKHEHIIHLEEVFETPKRMYLVTELCEGGDLKDLLQKNKHFTEEETRHIIKSLSEAIVYLHKKDIVHRDLKLENILVKSC-----HQGNDNDMVN--IKVTDFGLSVQKGGVGSENMLQATCGTPIYMAPEVVNGHQYSQQCDLWSIGVIMYMLLCGEPPFGSSSKERLSEMIMKGELTFSGPV---WNTISDAAKNVIRCLLKVDPAHRITANELLDNPWISG-DTSTAVTRTNVLEMMRQFRNA 336          
BLAST of serine/threonine-protein kinase 33 vs. TrEMBL
Match: A0A498MY85 (Serine threonine-kinase 33-like isoform X1 OS=Labeo rohita OX=84645 GN=ROHU_024194 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 9.101e-60
Identity = 118/323 (36.53%), Postives = 191/323 (59.13%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHN--RNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESI---NVLLLMKQMANS 1001
            N+++  +   +      + K Y     +G G+FG+V +A  +     WA+KK  + K       +++ E+ +M  +KH++I+ ++E+ ET K  ++V+ELC GG LKD   K   FSE E +HI+    +A+ YLH   R+I HRDLK+EN+L+++      + GNDN   N  IK+ DFGLSVQ     ++ M+   CGTP+YM PE++ G  YS+QCD+WS+G++MY L+ G+ PF   S E L+E I+   +  S P+     + S+ +   +R LLN DP++R +A+EL  + W++G D   ++   NVL +M+Q  N+
Sbjct:    9 NSAEKKVPHTRIEDESDIQKIYSFGRKLGQGNFGIVCEATHIETQRKWAIKKVNKEKAGTSGVKHLEREVSIMKQVKHEHIIHLEEVFETPKRMYLVIELCEGGDLKDLLQKNKHFSEEETRHIIKSLSEAIVYLHKKVRDIVHRDLKLENILVKNC-----HQGNDNDMVN--IKVTDFGLSVQKGGVGSENMLQATCGTPIYMAPEVVNGHQYSQQCDLWSIGVIMYMLLCGEPPFISSSKERLSEMIMKGELTFSGPV---WHTISDAAKNVIRCLLNVDPAHRITANELLDNPWISG-DTSTTVTRTNVLEMMRQFRNA 320          
BLAST of serine/threonine-protein kinase 33 vs. TrEMBL
Match: A0A401PA39 (Protein kinase domain-containing protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0005589 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.034e-59
Identity = 128/325 (39.38%), Postives = 187/325 (57.54%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYL---IKLIDFGLSVQLK-----MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESI----LNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQ 989
            NN++  +   +      +  YY+    +G GSFGVV  A  +S    WA+KK  + K        ++ E+ ++ ++ H++I+ ++E+ ET K  ++V+E C  G LK    + G  SE+E KHI+     A+ YLH  +I HRDLK+EN+L++S         NDN   N L   IK+ DFGLSV LK      ++ M+ + CGTPLYM PEII    YSKQCD+WS+GI+MY L+ G+ PF   S E L E I    L+F+ +S      L S SE +   L+ LL  DP++R +ASEL +H W+TG  + +K+  NVL +MKQ
Sbjct:   36 NNTEMTVPHQRIEDESVIKLYYQIGRELGKGSFGVVVHATHISTDRTWAIKKLNKEKAGSQAVKMLEREIAILKMVNHEHIIKLEEVYETTKKVYLVIEFCELGELKGILEEKGHLSESETKHIISSLASAIFYLHKNDIIHRDLKLENILVKS---------NDNTDDNELKLNIKVTDFGLSV-LKDGAGVGSESMLQDTCGTPLYMAPEIINNYDYSKQCDLWSIGIIMYILLCGQAPFTATSSEKLYEEIKKGDLDFSHSS------LKSISESARGVLKSLLIVDPAHRMTASELLNHRWITGDTSQKKQPTNVLEMMKQ 344          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Cavefish
Match: stk33 (serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GENE-040724-242])

HSP 1 Score: 196.823 bits (499), Expect = 1.226e-57
Identity = 113/320 (35.31%), Postives = 184/320 (57.50%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSC--ENLTESILNFNIN-SDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQMANS 1001
            N+++  +   +      + + Y   + +G GSFGVV +A  +     WA+KK  + K        ++ E+ ++  + H +I+ ++E+ ET K  ++VMELC GG LK    K  +FSE E +HI+    +A+ YLH ++I HRDLK+EN+L++S       + +DN    +L ++ DFGLSVQ     ++ M+   CGTP YM PE+I G  YS+QCD+WS+G++MYTL+ G+ PF S   E L E I    ++ + P+     + S+ + + L  LL  DP++R +ASEL  + W+ G  +      NVLL+M+Q  ++
Sbjct:   26 NSAEKKVPHTRIEDEAHIQQIYSFGTKLGQGSFGVVCEATHIETQKKWAIKKVNKEKAGSSGVKLLEREVSILKRVNHAHIIHLEEVFETPKKMYLVMELCEGGELKRLLRKNKRFSEEETRHIISSLAEAIVYLHKKDIVHRDLKLENILVKSY-----QSDHDN-CCFFLSQVTDFGLSVQKGGVGSENMLQATCGTPTYMAPEVINGHQYSQQCDVWSIGVIMYTLLCGEPPFISSSEERLFEMIKKGELSFAGPV---WETISDAAKKVLCCLLKVDPAHRITASELLDNPWVRGDTSTNATPTNVLLMMQQFRDA 336          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 153.295 bits (386), Expect = 4.033e-42
Identity = 93/282 (32.98%), Postives = 153/282 (54.26%), Query Frame = 3
Query:  120 IDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            +D + K +E   I+G+G+F  V  A+  S G ++AVK    K  R K + I+ E+ ++  IKH+NIV+++++ E+  + +++M+L SGG L D+  + G ++E +   ++ Q +DA+ YLH+  I HRDLK ENLL  +    K             I + DFGLS       ++M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL  +   D    +    S+ + + +  L+  +P  R++  +   H W+ G
Sbjct:   17 VDDIKKIFELKEILGTGAFSEVVLAQERSTGKMYAVKCIPKKALRGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYYNQDESK-------------IMISDFGLSKMEGAANDIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYD-ENDSKLFEQILKADYEFDSPYWD--DISDSAKDFISNLMLKNPEKRFTCDQALLHPWIAG 282          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 154.451 bits (389), Expect = 5.958e-42
Identity = 91/280 (32.50%), Postives = 152/280 (54.29%), Query Frame = 3
Query:  120 IDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK-KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKM-NQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFH--SCENLTESILNFNINSD-PLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            ++++ + ++ I ++GSG+   VFK K  S G  +A+K   ++ +   ++ E+ ++  IKH NIV++++  ET  + ++VM+L SGG L D+    G FSE +   ++ Q ++ + YLH  NI HRDLK ENLL  S            +  N  I + DFGLS   KM + ++M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  +   L   I+      D P      + SE + + +R ++  +P  R++  +   H W+ G
Sbjct:   32 VENIREIFDFIEVLGSGASSEVFKVKEKSTGKFFAMKCVIKKNRNTTLENEIAVLKRIKHNNIVALEDFYETQSHYYLVMQLVSGGELFDRLLDRGMFSEKDASMVIRQVLEGVHYLHQNNIVHRDLKPENLLYYS------------QDENSKIMISDFGLS---KMEDNDIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKAQYEFDSPF---WDNISESAKDFIRNMMQKNPKLRFTTDQALRHPWIIG 293          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 152.14 bits (383), Expect = 4.594e-41
Identity = 90/279 (32.26%), Postives = 152/279 (54.48%), Query Frame = 3
Query:  120 IDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK-KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFH--SCENLTESILNFNINSD-PLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            ++++ + ++ I ++GSG+   VFK K  S G  +A+K   ++ +   ++ E+ ++  IKH NIV++++  ET  + ++VM+L SGG L D+    G FSE +   ++ Q ++ + YLH  NI HRDLK ENLL  S            +  N  I + DFGLS +++ N  +M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  +   L   I+      D P      + SE + + +R ++  +P  R++  +   H W+ G
Sbjct:   32 VENIREIFDFIEVLGSGASSEVFKVKEKSTGKFFAMKCVIKKNRNTTLENEIAVLKRIKHNNIVALEDFYETQSHYYLVMQLVSGGELFDRLLDRGMFSEKDASMVIRQVLEGVHYLHQNNIVHRDLKPENLLYYS------------QDDNSKIMISDFGLS-KIEDNG-IMSTTCGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKAQYEFDSPF---WDNISESAKDFIRNMMQKNPKLRFTTDQALRHPWIIG 293          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Cavefish
Match: pskh1 (protein serine kinase H1 [Source:NCBI gene;Acc:103031964])

HSP 1 Score: 149.828 bits (377), Expect = 1.946e-40
Identity = 92/274 (33.58%), Postives = 142/274 (51.82%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTE---RTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQE-MMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCE--NLTESIL--NFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            YE  ++IG GSF  V + +  S    +A+K  E   R      + EL ++  ++H NI+ + E+ ET +  +MVMEL +GG L D+    G F+E +   ++   +D ++YLH   I HRDLK ENLL         + G D++     I + DFGL+   K   E MM   CGTP Y+ PEI+  K Y+   D+W++G++ Y L+ G  PF       L   IL   ++ + +P P    S S  + + +  +LN DPS R +A +   H W+
Sbjct:  100 YEIKALIGRGSFSRVVRVEHKSTRQPYAIKMIETRYREGREVCESELCVLRRVRHTNIIQLMEVFETAERVYMVMELATGGELFDRIIARGSFTERDATRVLQMVLDGVKYLHTLGITHRDLKPENLLYY-------HPGADSK-----IMITDFGLASTRKKGDECMMKTTCGTPEYIAPEILVRKPYTNAVDMWALGVISYILLSGTMPFEDDNRMRLYRQILKGKYSFSGEPWP----SVSNLAKDFIDRVLNVDPSERLTAGQALKHPWI 357          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Sea Lamprey
Match: stk33 (serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GENE-040724-242])

HSP 1 Score: 199.904 bits (507), Expect = 2.101e-61
Identity = 109/295 (36.95%), Postives = 172/295 (58.31%), Query Frame = 3
Query:  138 YYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMN--QEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG--ADQKESINVLLLMKQ 989
            YY     +GSGSFG V++A  +  G  WA+K   + +        ++ E+ ++  ++H+NI+ ++E++ET K  ++VMELC  G L+    +  + SE E +H+      A+ YLH  +I HRDLK+EN+L +S    + + G D    +  I++ DFGLS   + N    M+   CGTP+YM  E+I+ + YS+QCD+WS+G+++Y L+ G+ PF  HS E L E I+   ++      E    SE + E LRGLL  DP++R +ASEL H  W+TG  +     +NVL +MK+
Sbjct:    4 YYRLGRQLGSGSFGTVYEATHVETGVKWAIKTVNKERAGSSGVRLLEREVVILKRVQHQNIIHLEEVLETHKRVYLVMELCELGELRAVLEQRKRLSEAEARHVAHSLAGAIAYLHKHDIVHRDLKLENILAKS---SEPHEGID----HLDIRVTDFGLSAVREGNGAASMLQSPCGTPIYMAAEVIQSQDYSQQCDVWSIGVILYMLLCGEPPFMAHSQEKLFELIIKGELSFTQPAWE--EVSESAKELLRGLLKVDPAHRLTASELLHDHWVTGDTSSLGRPLNVLEMMKR 289          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.42 bits (337), Expect = 5.631e-36
Identity = 80/307 (26.06%), Postives = 148/307 (48.21%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVK-----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPC-ELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESINVLLLMKQMANSKRTTNLSLKPTAAL 1043
            Y+    +G G+F VV +   +S G  +A K     K        ++ E  +  ++KH NIV + E I  + + ++V +L +GG L +       +SE +  H + Q ++++ + H   I HRDLK ENLLL S            +     +KL DFGL+++++ +Q+    + GTP Y+ PE++R   Y K  D+W+ G+++Y L++G  PF   E+  +        +   P  E  + + ++   +  +L  +P+ R +A+E   H W+    Q+ ++   +  ++     R  N   K   A+
Sbjct:   14 YQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLAS------------KMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWD-EDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWIC---QRSTVASCMHRQETVECLRKFNARRKLKGAI 304          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 132.109 bits (331), Expect = 6.056e-36
Identity = 75/275 (27.27%), Postives = 143/275 (52.00%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLL-LQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPCELGSF---SEKSIEALRGLLNPDPSYRYSASELFHHSWLT 941
            YE    IG GS+ V  +    +    +AVK    K++R  +  I+    L+   +H N++++K++ +  K  ++V EL  GG L D+  +   FSE E   ++      + YLH++ + HRDLK  N+L +    NP+             +++ DFG + QL+    +++  C T  ++ PE+++ + Y   CDIWS+G+++YT++ G  PF +  + T  ++   I S       G++   SE + + ++ +L+ DP  R++A+++  H W+ 
Sbjct:   12 YELREDIGVGSYSVCKRCIHKTTNMEYAVKVIIDKSKRDPSEEIEI---LLRYGQHPNVITLKDVYDDGKSVYLVTELMKGGELLDKILRQKFFSEREASAVLQTIARTVEYLHSQGVVHRDLKPSNILYVDESGNPES------------LRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLAGHTPFANGPDDTPGVILTRIGSGRFLLSGGNWDTVSEAAKDLVKKMLHVDPHQRFTAAQVLRHPWIA 271          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 133.265 bits (334), Expect = 5.205e-35
Identity = 79/222 (35.59%), Postives = 119/222 (53.60%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTNY-----IQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSY-SKQCDIWSMGIVMYTLMLGKKPFHSCENLTE 788
            Y  +  IG G+F  V  AK    G   AVK  ++T+ N      +  E+ +M ++ H NIV + E+IE +K  ++VME  SGG + D     G+  E E +    Q V A++Y H ++I HRDLK ENLLL +  N               IK+ DFG S +  +  ++   +CG+P Y  PE+ +GK Y   + D+WS+G+++YTL+ G  PF   +NL E
Sbjct:   68 YRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMKVLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMN---------------IKIADFGFSNEFTLGSKLDT-FCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG-QNLKE 272          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 135.961 bits (341), Expect = 7.215e-35
Identity = 80/222 (36.04%), Postives = 120/222 (54.05%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSY-SKQCDIWSMGIVMYTLMLGKKPFHSCENLTE 788
            Y  +  IG G+F  V  A+    G   AVK  ++T+ N      +  E+ +M I+ H NIV + E+IET+K  ++VME  SGG + D     G+  E E +    Q V A++Y H ++I HRDLK ENLLL +  N               IK+ DFG S +  +  ++   +CG+P Y  PE+ +GK Y   + D+WS+G+++YTL+ G  PF   +NL E
Sbjct:   54 YRLLKTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMN---------------IKIADFGFSNEFTLGSKLDT-FCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG-QNLKE 258          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 141.354 bits (355), Expect = 4.682e-38
Identity = 87/291 (29.90%), Postives = 156/291 (53.61%), Query Frame = 3
Query:  159 IGSGSFGVVFKAKCLSDGCLWAVK-------KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNF----NINSDPLPCELGSFSEKSIEALRGLLNP---DPSYRYSASELFHHSWLTGADQKESINVLLLMKQ 989
            +G+GSFGVV +A+ LS     A+K       +    +   +  EL ++  + H NIVS K+  E+    ++V +L +GG L D+    G+F+E +   I++Q + A+ Y+H++N+ HRDLK EN+L              ++  N  + + DFG++ QLK  ++++ +  G+  Y+ PE++    + K CDIWS+G++ YTL+ G  PF     + ES+  F      +  P+   +  +   SI+  R +L     +P+ R +A+EL    W+T + + E+ N+L  +K+
Sbjct:   53 LGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYV------------DKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPF-----IAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWIT-SKRVETSNILPDVKK 325          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 139.813 bits (351), Expect = 1.344e-37
Identity = 85/276 (30.80%), Postives = 147/276 (53.26%), Query Frame = 3
Query:  159 IGSGSFGVVFKAKCLSDGCLWAVK-------KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLL--QSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNF--NINSDPLPCEL-----GSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            +G+G+FGVV +AK    G   AVK       K  + +   +  EL ++  + H NIV+ K+  E+    +++ +L  GG L D+  K G+F+E +   I+++ + A++Y+H++NI HRDLK ENLL   +S  +P              + + DFG++ +LK ++E++ +  G+  Y+ PE++    + K CDIWS+G++ YTL+ G   F +     E + +F     +   P +       S S K+ + +   LN DPS R +A+EL    W+
Sbjct:   43 LGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESP--------------LVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRA-----ERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 134.035 bits (336), Expect = 1.822e-34
Identity = 86/280 (30.71%), Postives = 141/280 (50.36%), Query Frame = 3
Query:  156 IIGSGSFGVVFKAKCLSDGCLWAVKKTERTKT----NYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKS-------------YSKQCDIWSMGIVMYTLMLGKKPFHSC--ENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            ++G G+F  V KA   + G  +AVK   + K     + +  EL ++  + H  IV +K   E  +  +MVME  SGG L D     G   E   + I  Q + A++Y+H+  I+HRDLK +N+L++   +P             L+K+ DFGL+ +++ N   M  +CGT  Y+ PE+IRGK              YS   D+WSMG ++Y ++ G  PF     + L + I   + +  PL  +    SE++ + +  LL  DP+ R +A++  +H W+
Sbjct:  203 VVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQ-DDP------------VLVKITDFGLA-KVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPL--KDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 131.724 bits (330), Expect = 8.914e-34
Identity = 88/298 (29.53%), Postives = 143/298 (47.99%), Query Frame = 3
Query:   99 SFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK-------KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGK--SYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPCELGSF------SEKSIEALRGLLNPDPSYRYSASELFHHSWLTGA 947
            S IK  G D     Y     +G G F   F+ K  S G ++A K       K+E+T+   +  E+ +   + H NIV   +  E D   ++++E+C  GSL +   +    +E E++    Q   A++Y+H+R + HRDLK+ N+                  SNY +K+ DFGL+  L    E     CGTP Y+ PE++ GK   +S + DIWS+G+++Y L++GK PF +         + N   + + C   SF      S++    +R +L+ DP  R S +E+  + W  G 
Sbjct:   73 SLIKTRGKD-----YHRGHFLGEGGFARCFQIKDDS-GEIFAAKTVAKASIKSEKTRKKLLS-EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFD---------------SNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQA--------RDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGT 340          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 120.168 bits (300), Expect = 1.317e-29
Identity = 83/280 (29.64%), Postives = 139/280 (49.64%), Query Frame = 3
Query:  201 LSDGCLWAVKKTERTKTNY--IQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSY-SKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESINVLLLMKQ--MANSKRTTNLSL 1025
            +S   + + + +  ++TN   I+ E+ +M +I H N++++ E+ E     ++V+E   GG L D     G+  E E  H   Q V+ + Y H+ NI HRDLK ENLLL                 N  IK+ DFG++  L++  +++   CG+P Y  PEI+ G+ Y     D+WS GIV++ L+ G  PF+  +N+ + +L        +P  L S   ++ + +  +L  DP  R +  E+  H  +   D      VL  M++  MA  K  ++L L
Sbjct:  140 VSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDK--------------KNRRIKIADFGMAA-LELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND-DNIKKLLLKVQSGKYQMPSNLSS---EARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHL 400          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Nematostella
Match: EDO40703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6E0])

HSP 1 Score: 184.496 bits (467), Expect = 2.603e-55
Identity = 109/291 (37.46%), Postives = 168/291 (57.73%), Query Frame = 3
Query:  105 IKYSGIDS---LDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN-----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLK--MNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHS-CENLTESILNFNINSDPLPC-ELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLT 941
            IK++ I+    ++  YE   ++G GSFGVV +AK +  G  WA+K   + K        ++ E+ +M  I H++++ ++E+ ET K  ++VMELC  G L     +  +F+E E   ++ Q V A+ YLH+ +I HRDLK+EN+LL    +P   TGN+    N  +K+ DFGLS+      +  MM   CGTP+YM PE+I    YS+QCD+WS+G++MYTL  G+ PF +  E     I+   I     PC E+   S K++  L G+L  DP++R +A E+  H W+T
Sbjct:   12 IKHTRIEDEKQIEDVYEFGQVLGRGSFGVVNEAKHIETGTRWAIKAVNKEKAGSSAVKLLEREVMIMKKIYHEHLIHLEEIYETSKRMYLVMELCDAGGLDKMLERKKRFTEKETWTVIKQLVSAVAYLHDLDIVHRDLKLENILLS---HP---TGNE--LLN--VKITDFGLSIVKGGVGSDSMMQSVCGTPMYMAPEVIDDLGYSQQCDVWSIGVIMYTLFTGRPPFMADTEEKLYEIIKKGIVDFSDPCWEVCHESAKNL--LLGMLKVDPAHRRTAKEVLIHPWIT 290          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 152.14 bits (383), Expect = 6.170e-43
Identity = 90/283 (31.80%), Postives = 150/283 (53.00%), Query Frame = 3
Query:  123 DSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFH--SCENLTESILNFNINSD-PLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGAD 950
            D + K Y+   ++G+G+F  V  A+  + G L+AVK    K  + K   ++ E+ ++  ++HKNI+ +K++ +   + ++VM+L  GG L D+  + G ++E +   ++ Q ++A  YLH+  I HRDLK ENLL  S     K            I + DFGLS +++     M   CGTP Y+ PE+++ + Y K  D WS+G++ Y L+ G  PF+  S  NL   I+      D P   E+   SE + + +R L+  DP  RY+  +   H W+ G +
Sbjct:   11 DKITKKYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGKEESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSK------------IMISDFGLS-KIEAQGSFMDTACGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEI---SESAKDFIRHLMELDPKLRYTCRQALSHPWICGGE 277          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Nematostella
Match: EDO33022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC5])

HSP 1 Score: 139.428 bits (350), Expect = 3.395e-38
Identity = 96/280 (34.29%), Postives = 143/280 (51.07%), Query Frame = 3
Query:  129 LDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTN----YIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGAD 950
             +  YE    IG G+FG V K   L    ++AVK+ + + +       Q E  +  ++ H +IV ++++  T +   +V+E   GG L D      QFSE +    + Q + ALRYL  + I HRDLK ENLLL   P       +D+R    +IKL DFG++ QLK N        G+PLY+ PE I  +  +   DIW+ G+++Y L++G  PF     E L  SIL  N    P P    + SE + + +R +L  DP  R +A E   H W++G+D
Sbjct:    3 FEDVYEITDFIGKGAFGQVSKCVNLQTREVFAVKEIDFSGSEEDKKKAQNEAKICGLLDHPSIVHLEDVFFTPRRMLLVLEYLPGGDLFDGVVTRTQFSEKDACACVRQVLKALRYLTRKGIIHRDLKPENLLLSERP-------SDHRPP--IIKLTDFGIAKQLKGN--------GSPLYLAPETILEEGLTYAVDIWACGVILYLLLVGYPPFWNEQTEFLLLSILQSNYTF-PSPY-WDTVSEPAKDLIRKMLVVDPRDRITAVEALKHEWVSGSD 263          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Nematostella
Match: EDO44488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP7])

HSP 1 Score: 137.887 bits (346), Expect = 4.295e-38
Identity = 85/270 (31.48%), Postives = 137/270 (50.74%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKT----NYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            Y    +IG G+F VV + K       +A+K   + K     + I+ E+ ++  +KH +IV + E  ET +  F+VMEL  GG L +   +  +++E    H++     AL YLH  +I HRD+K ENLL+ ++PN +K+           +KL DFGL++++K     M   CGTP Y+ PEI+    Y  + DIW+ G++ Y L+ G  PF S +      L      + L       S  + + +  +L  D + RYSA ++  H W+
Sbjct:    1 YRIGKVIGDGNFAVVRECKHRKTNKEYALKIINKAKVKGKEHMIENEISILRRVKHNHIVELIEEYETPREIFLVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENLLVLNLPNGRKS-----------LKLADFGLAMEVK---SPMFLVCGTPTYVAPEILDESGYGLKVDIWAAGVISYILLCGFPPFRSPDQDELFDLILAGEFEYLSPFWNDISSSAKDLIDHMLVVDANQRYSAKQVLAHPWV 256          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 132.494 bits (332), Expect = 6.318e-36
Identity = 89/272 (32.72%), Postives = 140/272 (51.47%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVKK---TERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMM-VEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPF--HSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            Y+ + +IG GSF  VF+      G  +A K+   T+      I+ E+ +   ++H+NIVS+   I   +   ++ME  +GGSL D+  +   +SE + + +  Q ++AL YLH+R I HRD+K +NLLL       K TGN     N  IKL DFGL+  L  + +++     G P+++ PE +  +   +  DIW+ G++ Y L++G  PF  +S E L  SIL       P P    + S  + + +  L+  DP  R SA E   H  L
Sbjct:    5 YDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRHENIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLL-------KRTGN-----NVTIKLADFGLAQALPNDTDVISCGASGAPMFLAPETVLEEPIGRAVDIWACGVIFYLLLVGYPPFWSNSDEQLLLSILRGQYTM-PSPF-WDNVSNDARDLVHKLIVVDPEARISAKEALSHPAL 262          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Medaka
Match: stk33 (serine/threonine kinase 33 [Source:NCBI gene;Acc:101161960])

HSP 1 Score: 166.777 bits (421), Expect = 2.674e-46
Identity = 100/296 (33.78%), Postives = 158/296 (53.38%), Query Frame = 3
Query:   87 DHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERT-----KTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMN--QEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSC--ENLTESILNFN-INSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            D ++   +    + +  +YE    +G G+FG V++   +     WA+K   R      K   +  E+ +++ + H +I+ ++ +  T K  ++V ELC GG LK    +   F+E E + I+    DA+ YLH RNI HRDLK+EN+LL       KN  N+   S   +K+ DFGLS++ K    + MM   CGT +YM PE++RG  YS+ CD WS+G++M+ ++ G+ PF S   ENL + I + + I S  +     + S+ +   L  LL  +P YR S S+L   SW  G
Sbjct:   14 DGHVPITRLKDNEDIRDFYEIGRQLGRGTFGEVYETTQIKTQSKWAIKMVRRPPPGSPKVEMLDNEIDILSQVNHPHIIRLEAIYSTAKMMYLVTELCEGGDLKQLLQQKKFFTENETRKIINCLADAVTYLHMRNIVHRDLKLENILL-------KNPINEEN-SEMDVKVADFGLSIKKKGTGIERMMSGTCGTLIYMAPEVLRGNDYSQWCDAWSIGVIMFMVLCGEPPFVSTTRENLLKKIESRDLIFSQSI---WATISDAAKYILTKLLEVEPVYRMSPSDLLGSSWFRG 298          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Medaka
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101175563])

HSP 1 Score: 152.14 bits (383), Expect = 2.228e-41
Identity = 95/297 (31.99%), Postives = 159/297 (53.54%), Query Frame = 3
Query:   75 ENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            EN    N S+ K   +D + K ++   ++G+G+F  V  A+  + G + A+K    K  + K   I+ E+ ++  IKH+NIV+++++ E+  + +++M+L SGG L D+  + G ++E +   ++ Q +DA+ YLH+  I HRDLK ENLL  S  +  K            I + DFGLS +++    +M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL  +   D         S+ + + +  L+  DP  R++  +   H W+ G
Sbjct:    4 ENGESSNGSWKKI--VDDVKKIFDFKEVLGTGAFSEVVMAREKATGKMVAIKCIPKKALKGKETSIENEIAVLRKIKHENIVALEDIYESSNHLYLIMQLVSGGELFDRIVEKGFYTEMDASRLIRQVLDAVNYLHSMGIVHRDLKPENLLYFSPHDDSK------------IMISDFGLS-KMEGTGGVMATACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD-ENDSKLFEQILKADYEFDAP--YWDDISDSAKDFISCLMEKDPEKRFTCDQALEHPWIAG 282          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Medaka
Match: camk1da (calcium/calmodulin dependent protein kinase ID [Source:NCBI gene;Acc:101162588])

HSP 1 Score: 150.599 bits (379), Expect = 9.884e-41
Identity = 91/282 (32.27%), Postives = 157/282 (55.67%), Query Frame = 3
Query:  120 IDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            +D + K ++   ++G+G+F  V  A+    G ++AVK    K  + K + I+ E+ ++  IKH+NIV+++++ E+  + +++M+L SGG L D+  + G ++E +   ++ Q +DA+ YLH   I HRDLK ENLL     NP+  +          I + DFGLS +++ + ++M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL  +   D         S+ + + +  L+  DP+ R++  +   H W+ G
Sbjct:   18 VDDIKKIFDFKEVLGTGAFSEVVLAQEKLSGRMFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPDHLYLIMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVNYLHKLGIVHRDLKPENLLYF---NPQDESK---------IMISDFGLS-KMEGSGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD-ENDSKLFEQILKADYEFDAP--YWDDISDSAKDFISCLMEKDPAKRFTCEQALRHPWIAG 283          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Medaka
Match: dclk3 (doublecortin like kinase 3 [Source:NCBI gene;Acc:101156024])

HSP 1 Score: 149.828 bits (377), Expect = 2.566e-40
Identity = 93/280 (33.21%), Postives = 145/280 (51.79%), Query Frame = 3
Query:  120 IDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTK----TNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSD---PLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWL 938
            +  +++ YE   +IG G+F VV + +    G L A+K  ER+K     + +Q EL L+  + H  IV +     T  +S++VMEL SGG L +  +  G+F E E   I+    +AL Y+H ++I HRDLK ENLL++ V             S   +KL DFGL++ +    E +   CGTP Y+ PEI+    Y    D+W++G++++ L+ G  PF S E   E +      +    P P    S SE++   +R LL  DP+ R +A +   H W+
Sbjct:   68 LSDIERVYEFGRVIGDGNFAVVRECRRRDGGELLALKIVERSKLVGREHMMQNELSLLGSLCHPRIVRLFTHHHTRTHSYLVMELVSGGDLFEAISDRGKFPEAEAGLIVSDVSEALEYIHRKSIVHRDLKPENLLVERVAA-----------SVCRLKLGDFGLAMVVT---EPVFTICGTPTYVAPEILHETGYGVAVDVWALGVILFVLLCGFPPFRSRERDQEELFKLIKQAQLHFPSPY-WDSISEEAKSLVRCLLEVDPTLRLTAEQTLQHPWV 332          
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 143.28 bits (360), Expect = 2.025e-38
Identity = 92/275 (33.45%), Postives = 148/275 (53.82%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVK----KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCEN---LTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTG 944
            Y+   I+G+G+F  V  A+      L A+K    K    K N I+ E+ ++  IKH NIVS++++ E+  + +++M+L SGG L D+  + G ++E +   ++ Q +DA++YLH+  I HRDLK ENLL  S+    K            I + DFGLS +++ +  +M   CGTP Y+ PE++  K YSK  D WS+G++ Y L+ G  PF+  EN   L E IL      D    +    S+ + + +  L+  D + RY+  +   H W+ G
Sbjct:   21 YDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKALEGKENSIENEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSK------------IMISDFGLS-KIEGSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYD-ENDAKLFEQILKAEYEFDSPYWD--DISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAG 279          
BLAST of serine/threonine-protein kinase 33 vs. Planmine SMEST
Match: SMESG000068620.1 (SMESG000068620.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 326/327 (99.69%), Postives = 326/327 (99.69%), Query Frame = 3
Query:   72 MENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESINVLLLMKQMANSKRTTNLSLKPTAALTNQ 1052
            MENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSV NPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESINVLLLMKQMANSKRTTNLSLKPTAALTNQ
Sbjct:    1 MENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVQNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESINVLLLMKQMANSKRTTNLSLKPTAALTNQ 327          
BLAST of serine/threonine-protein kinase 33 vs. Planmine SMEST
Match: SMESG000076975.1 (SMESG000076975.1)

HSP 1 Score: 237.654 bits (605), Expect = 5.380e-75
Identity = 136/340 (40.00%), Postives = 198/340 (58.24%), Query Frame = 3
Query:   78 NNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKT-----NYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKN--TGNDN----RFSN-----YLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCE--NLTESILNFNINS--DPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKE-----SINVLLLMKQMANSKRTTNLS 1022
            N  ++  + IK      LD+Y++ +  +G G+FGVV       DG  WA+KK  +++         + E  +++ ++H NI+ +KE+ ET+ ++++V+ELC G +L  Q     +F++ E  H++ Q   AL YLH R+I HRD+KMEN+LL+  PN K +  T +DN    +FS        +KL DFGLSV+LK  +E M+E+CGTP+YM PEII GKSYS QCD+WS+GI+M+ L+ G+ PF S    NL   ILNF++     P P      S+ +IE L  LL+ DP+YR+S  EL  + W   +  K      S NVL LMK      RTT  S
Sbjct:    2 NMKNNKTAVIKIESSKILDQYFKLLKKLGEGTFGVVMSVVDKRDGSNWAIKKVVKSRKFKGIKKSWEREFQILSKVQHPNIILLKEMYETEHFAYLVLELCDGLNLARQLKLHKKFTDFECSHVIFQVSSALSYLHRRHIVHRDVKMENILLRFDPNSKVSVSTQDDNVTMDQFSKNSLFPVTVKLADFGLSVELKKTEETMIEFCGTPMYMAPEIIAGKSYSCQCDVWSLGIIMFQLLTGEVPFKSTRESNLFAEILNFSVQKLCGPYP-----ISKGAIECLNRLLHQDPAYRFSTFELIINKWARQSVNKLDESACSTNVLQLMKDYYALSRTTQTS 336          
BLAST of serine/threonine-protein kinase 33 vs. Planmine SMEST
Match: SMESG000076975.1 (SMESG000076975.1)

HSP 1 Score: 237.654 bits (605), Expect = 6.086e-75
Identity = 138/342 (40.35%), Postives = 199/342 (58.19%), Query Frame = 3
Query:   72 MENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLWAVKKTERTKT-----NYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKN--TGNDN----RFSN-----YLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCE--NLTESILNFNINS--DPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKE-----SINVLLLMKQMANSKRTTNLS 1022
            M+NN     + IK      LD+Y++ +  +G G+FGVV       DG  WA+KK  +++         + E  +++ ++H NI+ +KE+ ET+ ++++V+ELC G +L  Q     +F++ E  H++ Q   AL YLH R+I HRD+KMEN+LL+  PN K +  T +DN    +FS        +KL DFGLSV+LK  +E M+E+CGTP+YM PEII GKSYS QCD+WS+GI+M+ L+ G+ PF S    NL   ILNF++     P P      S+ +IE L  LL+ DP+YR+S  EL  + W   +  K      S NVL LMK      RTT  S
Sbjct:    1 MKNN---KTAVIKIESSKILDQYFKLLKKLGEGTFGVVMSVVDKRDGSNWAIKKVVKSRKFKGIKKSWEREFQILSKVQHPNIILLKEMYETEHFAYLVLELCDGLNLARQLKLHKKFTDFECSHVIFQVSSALSYLHRRHIVHRDVKMENILLRFDPNSKVSVSTQDDNVTMDQFSKNSLFPVTVKLADFGLSVELKKTEETMIEFCGTPMYMAPEIIAGKSYSCQCDVWSLGIIMFQLLTGEVPFKSTRESNLFAEILNFSVQKLCGPYP-----ISKGAIECLNRLLHQDPAYRFSTFELIINKWARQSVNKLDESACSTNVLQLMKDYYALSRTTQTS 334          
BLAST of serine/threonine-protein kinase 33 vs. Planmine SMEST
Match: SMESG000076986.1 (SMESG000076986.1)

HSP 1 Score: 196.052 bits (497), Expect = 6.396e-60
Identity = 112/254 (44.09%), Postives = 153/254 (60.24%), Query Frame = 3
Query:  321 LIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKN--TGNDN----RFSN-----YLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCE--NLTESILNFNINS--DPLPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKE-----SINVLLLMKQMANSKRTTNLS 1022
            + ET+ ++++V+ELC G +L  Q     +F++ E  H++ Q   AL YLH R+I HRD+KMEN+LL+  PN K +  T +DN    +FS        +KL DFGLSV+LK  +E M+E+CGTP+YM PEII GKSYS QCD+WS+GI+M+ L+ G+ PF S    NL   ILNF++     P P      S+ +IE L  LL+ DP+YR+S  EL  + W   +  K      S NVL LMK      RTT  S
Sbjct:    1 MYETEHFAYLVLELCDGLNLARQLKLHKKFTDFECSHVIFQVSSALSYLHRRHIVHRDVKMENILLRFDPNSKVSVSTQDDNVTMDQFSKNSLFPVTVKLADFGLSVELKKTEETMIEFCGTPMYMAPEIIAGKSYSCQCDVWSLGIIMFQLLTGEVPFKSTRESNLFAEILNFSVQKLCGPYP-----ISKGAIECLNRLLHQDPAYRFSTFELIINKWARQSVNKLDESACSTNVLQLMKDYYALSRTTQTS 249          
BLAST of serine/threonine-protein kinase 33 vs. Planmine SMEST
Match: SMESG000002981.1 (SMESG000002981.1)

HSP 1 Score: 141.739 bits (356), Expect = 1.967e-37
Identity = 97/312 (31.09%), Postives = 151/312 (48.40%), Query Frame = 3
Query:  141 YETISIIGSGSFGVVFKAKCLSDGCLWAVK-------KTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSGGSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQSVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPPEIIRG---KSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSD--PLP-CELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESINVLLLMKQMANSKRTTNLSLKPTA 1037
            Y     +G G+ G V  A     G   A+K       K   TK+  ++ E+ ++  + H  IV +++ I+TD+  F+VMEL  GG L D+     QF E + + ++ Q V A++YLH+ NI+HRDLK EN+LL +  N              LIK+ DFGLS +      MM   CGTP Y+ PE+I G   + YS  CDIWS+G++++  + G  PF   E  T+  L+  I       P       S  +I  ++ +L  DP  R +  ++  H W+   D K     + +M  ++   +     L P +
Sbjct:  140 YTISRTLGKGACGEVKLAYVNGTGEKVAIKIIDKKALKLASTKSQGVEREVEILRQLNHPCIVKLRDAIDTDERLFIVMELVEGGELFDRVISIKQFEEVDAQVLLYQMVMAIKYLHDNNISHRDLKPENILLATDQNVT------------LIKVTDFGLS-KFVDGATMMKTLCGTPNYLAPEVILGNGTQEYSFACDIWSLGVILFICLAGYPPF--TEERTDLPLSKQITEGQYSFPEVHWSGVSRPAIHLIKQMLQVDPKKRITLIKILQHPWMN--DDKVKTTAMKIMYPLSEVTKLCQEDLGPCS 434          
The following BLAST results are available for this feature:
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK332.175e-5935.65serine/threonine kinase 33 [Source:HGNC Symbol;Acc... [more]
STK335.687e-5935.65serine/threonine kinase 33 [Source:HGNC Symbol;Acc... [more]
STK335.687e-5935.65serine/threonine kinase 33 [Source:HGNC Symbol;Acc... [more]
STK335.687e-5935.65serine/threonine kinase 33 [Source:HGNC Symbol;Acc... [more]
STK336.660e-4639.65serine/threonine kinase 33 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F32D8.11.613e-4233.10pep chromosome:WBcel235:V:10880837:10883399:1 gene... [more]
cmk-16.627e-3830.18Calcium/calmodulin-dependent protein kinase type 1... [more]
rskn-25.170e-3732.08Putative ribosomal protein S6 kinase alpha-2 [Sou... [more]
R06A10.44.226e-3631.11pep chromosome:WBcel235:I:1089666:1095796:-1 gene:... [more]
rskn-26.629e-3631.23Putative ribosomal protein S6 kinase alpha-2 [Sou... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG175281.303e-3630.04gene:FBgn0261387 transcript:FBtr0111274[more]
CG175281.303e-3630.04gene:FBgn0261387 transcript:FBtr0111277[more]
CaMKI1.249e-3531.91gene:FBgn0016126 transcript:FBtr0333670[more]
SAK1.475e-3430.29gene:FBgn0026371 transcript:FBtr0078387[more]
par-17.077e-3431.58gene:FBgn0260934 transcript:FBtr0301503[more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk335.459e-6537.07serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GE... [more]
stk336.261e-6537.07serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GE... [more]
camk1db4.839e-4432.55calcium/calmodulin-dependent protein kinase 1Db [S... [more]
camk1db9.429e-4432.55calcium/calmodulin-dependent protein kinase 1Db [S... [more]
camk1a5.042e-4234.31calcium/calmodulin-dependent protein kinase Ia [So... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbln14.245e-5434.38fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765][more]
fbln14.997e-5434.38fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765][more]
fbln12.889e-5333.99fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765][more]
fbln17.279e-5334.69fibulin 1 [Source:Xenbase;Acc:XB-GENE-5761765][more]
anapc161.037e-4033.82anaphase promoting complex subunit 16 [Source:Xenb... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk331.841e-5936.10serine/threonine kinase 33 [Source:MGI Symbol;Acc:... [more]
Stk331.841e-5936.10serine/threonine kinase 33 [Source:MGI Symbol;Acc:... [more]
Stk331.841e-5936.10serine/threonine kinase 33 [Source:MGI Symbol;Acc:... [more]
Stk333.014e-5436.36serine/threonine kinase 33 [Source:MGI Symbol;Acc:... [more]
Camk1d3.158e-4233.81calcium/calmodulin-dependent protein kinase ID [So... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q924X7|STK33_MOUSE1.288e-5836.10Serine/threonine-protein kinase 33 OS=Mus musculus... [more]
sp|Q9BYT3|STK33_HUMAN2.731e-5835.65Serine/threonine-protein kinase 33 OS=Homo sapiens... [more]
sp|Q0VD22|STK33_BOVIN5.442e-5636.76Serine/threonine-protein kinase 33 OS=Bos taurus O... [more]
sp|Q54MH0|FHKD_DICDI4.148e-4532.67Probable serine/threonine-protein kinase fhkD OS=D... [more]
sp|Q869W6|MYLKG_DICDI1.764e-4133.67Probable myosin light chain kinase DDB_G0275057 OS... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HC641.493e-6340.27serine/threonine-protein kinase 33 OS=Lingula ungu... [more]
Q5RHZ01.221e-6137.07Serine/threonine kinase 33 OS=Danio rerio OX=7955 ... [more]
E7F3U51.401e-6137.07Serine/threonine kinase 33 OS=Danio rerio OX=7955 ... [more]
A0A498MY859.101e-6036.53Serine threonine-kinase 33-like isoform X1 OS=Labe... [more]
A0A401PA391.034e-5939.38Protein kinase domain-containing protein OS=Scylio... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk331.226e-5735.31serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GE... [more]
camk1db4.033e-4232.98calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb5.958e-4232.50calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb4.594e-4132.26calcium/calmodulin-dependent protein kinase type 1... [more]
pskh11.946e-4033.58protein serine kinase H1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk332.101e-6136.95serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000008748.15.631e-3626.06pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
RPS6KA36.056e-3627.27ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
MARK35.205e-3535.59microtubule affinity regulating kinase 3 [Source:H... [more]
MARK37.215e-3536.04microtubule affinity regulating kinase 3 [Source:H... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK24.682e-3829.90Calmodulin-dependent protein kinase; may play a ro... [more]
CMK11.344e-3730.80Calmodulin-dependent protein kinase; may play a ro... [more]
RAD531.822e-3430.71DNA damage response protein kinase; required for c... [more]
CDC58.914e-3429.53Polo-like kinase; controls targeting and activatio... [more]
HSL11.317e-2929.64Nim1p-related protein kinase; septin-binding kinas... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407032.603e-5537.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362536.170e-4331.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330223.395e-3834.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444884.295e-3831.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412426.318e-3632.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk332.674e-4633.78serine/threonine kinase 33 [Source:NCBI gene;Acc:1... [more]
camk1db2.228e-4131.99calcium/calmodulin-dependent protein kinase type 1... [more]
camk1da9.884e-4132.27calcium/calmodulin dependent protein kinase ID [So... [more]
dclk32.566e-4033.21doublecortin like kinase 3 [Source:NCBI gene;Acc:1... [more]
camk1b2.025e-3833.45calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of serine/threonine-protein kinase 33 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068620.10.000e+099.69SMESG000068620.1[more]
SMESG000076975.15.380e-7540.00SMESG000076975.1[more]
SMESG000076975.16.086e-7540.35SMESG000076975.1[more]
SMESG000076986.16.396e-6044.09SMESG000076986.1[more]
SMESG000002981.11.967e-3731.09SMESG000002981.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000483 ID=SMED30000483|Name=serine/threonine-protein kinase 33|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
TTTGAAATTAAAATTAAATTCTAATTGAAGTTTCATATTGATGAAAATTA
TTGTTTTCTGTATTATTTCCAATGGAGAATAATTCTGATCACAATATATC
TTTTATAAAATATTCTGGAATCGATAGCTTAGATAAATACTATGAAACTA
TTAGTATAATCGGTTCAGGTTCATTTGGAGTCGTTTTTAAAGCAAAATGC
TTATCTGACGGATGCTTATGGGCAGTGAAAAAAACAGAACGTACTAAAAC
CAATTATATCCAATGGGAGCTTCATCTAATGACGATCATAAAGCATAAAA
ATATTGTATCTATCAAAGAATTAATTGAAACTGATAAATATTCATTCATG
GTGATGGAACTCTGCAGCGGTGGATCTTTAAAAGACCAATTCAATAAATG
CGGCCAATTTTCTGAAACCGAATTAAAACACATCATGATGCAATTTGTCG
ACGCATTGCGCTACTTACACAATCGTAACATAGCTCATCGAGATTTAAAA
ATGGAAAATCTACTTTTACAAAGTGTGCCAAATCCGAAAAAGAATACCGG
AAATGATAATCGATTCTCGAACTATCTGATCAAATTAATTGATTTCGGAT
TGTCGGTCCAGTTAAAAATGAATCAGGAAATGATGGTGGAATATTGCGGA
ACACCGCTGTACATGCCACCGGAAATCATCCGAGGCAAAAGCTACAGTAA
ACAGTGTGACATTTGGAGCATGGGAATCGTCATGTACACCCTGATGCTGG
GAAAGAAACCGTTTCATAGTTGCGAAAATCTCACCGAAAGCATTCTCAAT
TTCAACATCAATTCCGATCCGTTGCCCTGTGAGCTTGGCTCATTTTCCGA
GAAATCTATCGAAGCTTTGCGAGGCCTACTAAATCCGGATCCGAGTTATC
GATATTCGGCATCGGAGCTTTTCCATCATTCCTGGCTGACGGGCGCTGAC
CAGAAGGAATCGATCAATGTTTTGCTGTTGATGAAACAAATGGCCAATTC
AAAGAGAACAACAAATCTTTCTTTAAAACCGACAGCTGCATTGACCAATC
AATAAACGACAGAAATCGCCGCCGTTTCCGCATACAAATAAAACTCACCC
GATTTTATGTGATAAAATTGGTTTTTGTATATATAAATTTATAACTGCGC
TCAATGTTCTGCCTGGAAAATTTTGTCTTTGCTGTGTTCCGTTTGTGACA
GATCGGTTGGAATTCTGTTACTTATCTGTGATAATCCTTTGCATTTTTAT
AATACAAGC
back to top

protein sequence of SMED30000483-orf-1

>SMED30000483-orf-1 ID=SMED30000483-orf-1|Name=SMED30000483-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=328bp
MENNSDHNISFIKYSGIDSLDKYYETISIIGSGSFGVVFKAKCLSDGCLW
AVKKTERTKTNYIQWELHLMTIIKHKNIVSIKELIETDKYSFMVMELCSG
GSLKDQFNKCGQFSETELKHIMMQFVDALRYLHNRNIAHRDLKMENLLLQ
SVPNPKKNTGNDNRFSNYLIKLIDFGLSVQLKMNQEMMVEYCGTPLYMPP
EIIRGKSYSKQCDIWSMGIVMYTLMLGKKPFHSCENLTESILNFNINSDP
LPCELGSFSEKSIEALRGLLNPDPSYRYSASELFHHSWLTGADQKESINV
LLLMKQMANSKRTTNLSLKPTAALTNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0035556intracellular signal transduction
GO:0046777protein autophosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 24..289
e-value: 4.3E-79
score: 278.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 24..289
e-value: 3.3E-66
score: 223.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 24..289
score: 46.605
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 15..325
e-value: 1.4E-79
score: 269.8
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 31..245
e-value: 7.0E-19
score: 65.4
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 3..315
NoneNo IPR availablePANTHERPTHR24347:SF354coord: 3..315
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 137..149
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 30..54
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 10..313