Bestrophin homolog

Overview
NameBestrophin homolog
Smed IDSMED30000475
Length (bp)1408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bestrophin homolog (SMED30000475) t-SNE clustered cells

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30000475) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bestrophin homolog (SMED30000475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bestrophin homolog (SMED30000475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000475SMESG000016298.1 SmedASXL_006320SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30000475SMESG000016298.1 dd_Smed_v4_10097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000475SMESG000016298.1 dd_Smed_v4_10097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000475SMESG000016298.1 dd_Smed_v4_10097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000475SMESG000016298.1 dd_Smed_v4_10097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30000475SMESG000016298.1 dd_Smed_v4_10097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 140.969 bits (354), Expect = 9.254e-37
Identity = 104/368 (28.26%), Postives = 165/368 (44.84%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDR 1104
            +KLL+ +F+ F   Y  I+L+YRL L    V K  FE +  Y ++ A  +P++F+LGF+V+ V+ RWW   +++PW  +  F   + + G D +  + +R T++RY+NL  +L   ++S  V  RF                                   D +V+  F T    +E K+F + +    K  Y VP +W   L  K+   G I        +   +  +R     L  Y+   +PLVYTQV+ + VYTF  + +  +Q +D             T       LD Y+P+F + +F  Y GW KV    INPFG +  D   +  +D NL+VS        +  P+   D + D S  R
Sbjct:   29 YKLLYREFIVFAVLYTAISLVYRLLLTG--VQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEHG-RLLRRTLMRYVNLTSLLIFRSVSTAVYKRF--------------------------------PTMDHVVEAGFMT---TDERKLFNHLKSPHLK--YWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLD------------PTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAAR 344          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST4 (bestrophin 4 [Source:HGNC Symbol;Acc:HGNC:17106])

HSP 1 Score: 142.124 bits (357), Expect = 1.379e-36
Identity = 100/345 (28.99%), Postives = 163/345 (47.25%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNL---IHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL F   Y  +++ YRL L  +   +  +  +  Y N+ A L+PLSF+LGF+V+ V+ RWW    SIP   +      A + G D+   + +R T++RY NLA +L L ++S +V  RF               ++H                   +V   F   + +EE K FE+ +    K  Y VP +W T L  ++ + G I  +     +   + ++R     L  Y+  ++PLVYTQV+ I VY+F    +  +Q ++        +K L             D Y+P+  + +F  Y GW KV    INPFG +  D   ++++D NL+VS
Sbjct:   29 YKLLYKEFLLFGALYAVLSITYRLLLTQE--QRYVYAQVARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQRG-RLLRRTLIRYANLASVLVLRSVSTRVLKRF-------------PTMEH-------------------VVDAGF---MSQEERKKFESLKSDFNK--YWVPCVWFTNLAAQARRDGRIRDDIALCLLLEELNKYRAKCSMLFHYDWISIPLVYTQVVTIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDMYVPLTTLLQFFFYAGWLKVAEQIINPFGEDDDDFETNQLIDRNLQVS 333          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 139.813 bits (351), Expect = 1.433e-35
Identity = 101/342 (29.53%), Postives = 158/342 (46.20%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L      K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P            + G D +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FRG  G L  Y+  +VPLVYTQV+ I +Y++ ++ +  +Q +D    +K               LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGFYMALSAAYRFVLTEG--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRD-DRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDH------------DLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 139.813 bits (351), Expect = 1.433e-35
Identity = 101/342 (29.53%), Postives = 158/342 (46.20%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L      K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P            + G D +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FRG  G L  Y+  +VPLVYTQV+ I +Y++ ++ +  +Q +D    +K               LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGFYMALSAAYRFVLTEG--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRD-DRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDH------------DLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Human
Match: BEST2 (bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107])

HSP 1 Score: 139.813 bits (351), Expect = 1.433e-35
Identity = 101/342 (29.53%), Postives = 158/342 (46.20%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L      K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P            + G D +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FRG  G L  Y+  +VPLVYTQV+ I +Y++ ++ +  +Q +D    +K               LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGFYMALSAAYRFVLTEG--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRD-DRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDH------------DLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-5 (Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:P34319])

HSP 1 Score: 130.183 bits (326), Expect = 6.598e-33
Identity = 97/367 (26.43%), Postives = 163/367 (44.41%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTFEDGS 1095
            W+ ++ + + +IC+Y  ++++YR  L      K  FE    Y +     +PL+F+LGFF + ++ RW ++  S+  +   A    A + G D +  + IR  I+RY  ++  L   ++   V+ RF  P  E      + ML HE  K  +I+ +  K                                  Y V   WA +L+  +     I+ +     I   + +FR +L T+S+Y+   +PL+Y Q++ + V+T+    IFT+Q       H KT             +D Y+P   I +F+ YMGW KV +  +NPFG +  D   + ++D NL +  +    DD Y   PE   D F  GS
Sbjct:   72 WQAVYKELIVWICAYSLVSVIYRFALTRS--QKDIFERFGEYCDARMGYLPLNFVLGFFCNIIIRRWLKLYTSLGNIDNIALFVSAYVRGTD-DRARQIRRNIIRYCVISQCLVFRDIHVGVRRRF--PTLEAVAQAGI-MLPHELEKFNSIKSRYQK----------------------------------YWVSFNWALELLNVAKTEKSIDGDNARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQFFISADAHNKT------------EVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAIGLTSV--DDAYDQLPEVKPDVFTGGS 384          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-3 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O17206])

HSP 1 Score: 131.724 bits (330), Expect = 8.933e-33
Identity = 95/375 (25.33%), Postives = 170/375 (45.33%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTF-EDGSGDRFKIFES 1122
            WK +WA+ + ++C Y  ++++YR  L      +  FE +  + +  +  +P++F+LGF+VS V  RWW+I  +I W+  P       I  G+    K +R   +RY  L   +   +++  V+ RF                 H                   LV      L+ E+EM  FE+      K  Y  P+ W   +I  +   G I S+ +++ +   +++FR ++ +L++++   VPLVYTQV+ + V ++ +  +F +Q +     H ++   N         +D Y+P+  + +F+ ++GW KV    +NP G +  D   + ILD NL+V   V       +P    D F ED   +     ES
Sbjct:   29 WKSVWAELVVWLCLYAVLSVIYRCLLTMK--QRATFEDLCIFFDTYSNFIPITFMLGFYVSAVFTRWWQIFDNIGWIDTPCLWITQYI-KGETERAKCVRRNCIRYSILTQAMVYRDVAASVRKRF-------------PTFNH-------------------LVT---AGLMTEKEMAEFESIPSPHAK--YWQPMHWLFSMITLARDEGMISSDIIYVDLMEKMRQFRVNILSLTLFDWVPVPLVYTQVVHLAVRSYFLIALFGRQYL-----HPESNRLND----FKQTIDLYVPIMSLLQFIFFIGWMKVAEVLLNPLGEDDDDFECNWILDRNLQVGLMVVDTAYNRYPTLEKDQFWEDAIAEPLYTAES 354          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-13 (Bestrophin homolog 13 [Source:UniProtKB/Swiss-Prot;Acc:O45435])

HSP 1 Score: 125.561 bits (314), Expect = 1.534e-31
Identity = 95/359 (26.46%), Postives = 158/359 (44.01%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLY-------------RLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVA 1038
            W+  W + L ++  Y  + + Y             RL +      +  FE+     +    L+PL+FLLGF+VS V+ RWW    ++ W  +   +    +        K  R TI RY+NLA  L+  ++S K++LRF                    P   ++ +                 L+ E+E ++ E    +++   +I PL W  +LI +  +  +  +  +F      ++ FR SL  L  Y+   VPLVYTQV  +  Y+F    +F +Q           L+ +   I     LD  +PVF I +FL ++GWFKVG   + PFG +  D+ L+ ILD N+ +S ++ 
Sbjct:   21 WRTAWKELLIYLILYYSVRVFYLKGIDLIDDDEDDRLKM------RRMFETFCRQCDSYTRLIPLTFLLGFYVSNVVARWWRQFETLYW-PEDILSVLCTVLHQHDEKSKRRRHTIARYLNLANALAWRDISSKIRLRF--------------------PSVHSLIE---------------SGLLTEKEYQILEAMHAENESSRWITPLHW-IQLIMRQVEEEHKPTASLFNQFVGELRIFRQSLRKLYSYDWVCVPLVYTQVAALATYSFFFFTLFGRQ----------PLFPD---IETGKELDLVVPVFTIVQFLFFVGWFKVGQDLMRPFGLDDDDIELNYILDRNVRISFAIV 323          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-8 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O62095])

HSP 1 Score: 125.176 bits (313), Expect = 8.080e-31
Identity = 85/366 (23.22%), Postives = 167/366 (45.63%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNK-VAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGS 1095
            WK +W++ + ++  Y  + + YR+ L  +   K      + ++++ +   VPL+F+L FFV+ ++ RW  +  +I ++   A     L+ G + +     R TI+RY+ L  +L   ++S KV+ RF                                 N D ++K  F   + + E  +       + +  Y +P+ W++ +++K ++ G I +  +F  ++  V+ FR ++ TL  Y+   +P+ Y QV+   V  +  + +FT+Q +D               +  T  +D Y P+  +F+F  +MGW KV  + +NP G +  D   + ++D N+    ++        PE L+D F D S
Sbjct:   29 WKSIWSELVLWLLGYYLVMVTYRVALTTE--QKAGVRKYIDHLDQNLDKCVPLTFMLAFFVTIIVDRWKNMFANIGFIENTAIAIATLVKGTEGDVLLAKR-TIIRYLVLTQVLVFRDISLKVRRRF--------------------------------PNHDAIIKAGF---LQDHESIILGG---DNGRTNYWMPVNWSSAILQKLFEDGNIPAAPLFNSVWQEVKTFRSNMATLCNYDWVPIPIAYPQVVFFAVRVYFFTCLFTRQHLD---------------MEDTKTIDYYFPILTVFQFTFFMGWMKVAEALLNPLGEDDDDFECNYLIDRNIATGMAIVNSKYSDVPEMLADKFNDPS 338          
BLAST of Bestrophin homolog vs. Ensembl Celegans
Match: best-8 (Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O62095])

HSP 1 Score: 125.176 bits (313), Expect = 8.080e-31
Identity = 85/366 (23.22%), Postives = 167/366 (45.63%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNK-VAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGS 1095
            WK +W++ + ++  Y  + + YR+ L  +   K      + ++++ +   VPL+F+L FFV+ ++ RW  +  +I ++   A     L+ G + +     R TI+RY+ L  +L   ++S KV+ RF                                 N D ++K  F   + + E  +       + +  Y +P+ W++ +++K ++ G I +  +F  ++  V+ FR ++ TL  Y+   +P+ Y QV+   V  +  + +FT+Q +D               +  T  +D Y P+  +F+F  +MGW KV  + +NP G +  D   + ++D N+    ++        PE L+D F D S
Sbjct:   29 WKSIWSELVLWLLGYYLVMVTYRVALTTE--QKAGVRKYIDHLDQNLDKCVPLTFMLAFFVTIIVDRWKNMFANIGFIENTAIAIATLVKGTEGDVLLAKR-TIIRYLVLTQVLVFRDISLKVRRRF--------------------------------PNHDAIIKAGF---LQDHESIILGG---DNGRTNYWMPVNWSSAILQKLFEDGNIPAAPLFNSVWQEVKTFRSNMATLCNYDWVPIPIAYPQVVFFAVRVYFFTCLFTRQHLD---------------MEDTKTIDYYFPILTVFQFTFFMGWMKVAEALLNPLGEDDDDFECNYLIDRNIATGMAIVNSKYSDVPEMLADKFNDPS 338          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0082183)

HSP 1 Score: 178.333 bits (451), Expect = 1.253e-48
Identity = 119/366 (32.51%), Postives = 186/366 (50.82%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPT-YIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTFED 1089
            +KL+W D L F+  Y  I ++YR  L  +P  K  FE+IV Y +    L+PLSF+LGF+VS V+ RWW    SIPW    A    + + G D    + +R TI+RY+ L   + L N+S +VK RF                                +N+  LV+     L+ + E  + E   K   +P+ + +P++WA  +I ++ K G I  +     I + + +FRG  G L  Y+  +VPLVYTQV+ + VY++ ++    QQ  D  ++       N+T+++    +D Y PVF   +F  YMGW KV  S INPFG +  D  ++ ++D NL+VS  +   D+++   PE L D + D
Sbjct:   30 YKLVWLDLLAFLTIYYAINMVYRFGL--NPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERG-RMMRRTIMRYVCLCLTMVLANVSPRVKKRF------------------------------PGLNN--LVE---AGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVG------NTTYLN---KVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIV--DEMHHDHPELLKDQYWD 346          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0337020)

HSP 1 Score: 177.948 bits (450), Expect = 1.596e-48
Identity = 119/366 (32.51%), Postives = 186/366 (50.82%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPT-YIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTFED 1089
            +KL+W D L F+  Y  I ++YR  L  +P  K  FE+IV Y +    L+PLSF+LGF+VS V+ RWW    SIPW    A    + + G D    + +R TI+RY+ L   + L N+S +VK RF                                +N+  LV+     L+ + E  + E   K   +P+ + +P++WA  +I ++ K G I  +     I + + +FRG  G L  Y+  +VPLVYTQV+ + VY++ ++    QQ  D  ++       N+T+++    +D Y PVF   +F  YMGW KV  S INPFG +  D  ++ ++D NL+VS  +   D+++   PE L D + D
Sbjct:   30 YKLVWLDLLAFLTIYYAINMVYRFGL--NPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERG-RMMRRTIMRYVCLCLTMVLANVSPRVKKRF------------------------------PGLNN--LVE---AGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVG------NTTYLN---KVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIV--DEMHHDHPELLKDQYWD 346          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0114590)

HSP 1 Score: 177.948 bits (450), Expect = 2.500e-48
Identity = 119/366 (32.51%), Postives = 186/366 (50.82%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPT-YIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTFED 1089
            +KL+W D L F+  Y  I ++YR  L  +P  K  FE+IV Y +    L+PLSF+LGF+VS V+ RWW    SIPW    A    + + G D    + +R TI+RY+ L   + L N+S +VK RF                                +N+  LV+     L+ + E  + E   K   +P+ + +P++WA  +I ++ K G I  +     I + + +FRG  G L  Y+  +VPLVYTQV+ + VY++ ++    QQ  D  ++       N+T+++    +D Y PVF   +F  YMGW KV  S INPFG +  D  ++ ++D NL+VS  +   D+++   PE L D + D
Sbjct:   30 YKLVWLDLLAFLTIYYAINMVYRFGL--NPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDERG-RMMRRTIMRYVCLCLTMVLANVSPRVKKRF------------------------------PGLNN--LVE---AGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVG------NTTYLN---KVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIV--DEMHHDHPELLKDQYWD 346          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best1 (gene:FBgn0040238 transcript:FBtr0306023)

HSP 1 Score: 177.948 bits (450), Expect = 2.752e-48
Identity = 119/366 (32.51%), Postives = 186/366 (50.82%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPT-YIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTFED 1089
            +KL+W D L F+  Y  I ++YR  L  +P  K  FE+IV Y +    L+PLSF+LGF+VS V+ RWW    SIPW    A    + + G D    + +R TI+RY+ L   + L N+S +VK RF                                +N+  LV+     L+ + E  + E   K   +P+ + +P++WA  +I ++ K G I  +     I + + +FRG  G L  Y+  +VPLVYTQV+ + VY++ ++    QQ  D  ++       N+T+++    +D Y PVF   +F  YMGW KV  S INPFG +  D  ++ ++D NL+VS  +   D+++   PE L D + D
Sbjct:   30 YKLVWLDLLAFLTIYYAINMVYRFGL--NPAQKETFEAIVQYCDSYRELIPLSFVLGFYVSIVMTRWWNQYTSIPWPDPIAVFVSSNVHGQDER-GRMMRRTIMRYVCLCLTMVLANVSPRVKKRF------------------------------PGLNN--LVE---AGLLNDNEKTIIETMNKAFPRPSKHWLPIVWAASIITRARKEGRIRDDFAVKTIIDELNKFRGQCGLLISYDTISVPLVYTQVVTLAVYSYFLTCCMGQQWTDGKVVG------NTTYLN---KVDLYFPVFTTLQFFFYMGWLKVAESLINPFGEDDDDFEVNWMVDRNLQVSYLIV--DEMHHDHPELLKDQYWD 346          
BLAST of Bestrophin homolog vs. Ensembl Fly
Match: Best2 (gene:FBgn0035696 transcript:FBtr0077010)

HSP 1 Score: 162.925 bits (411), Expect = 5.242e-43
Identity = 112/367 (30.52%), Postives = 187/367 (50.95%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALIC---GGDRN-TCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTF 1083
            +KL+W + + ++C Y  I ++YR  L      +  F+ I  Y  + +  +P+SF+LGF+V+ V+ RWWE    +PW    A    A I    GG  N T + +R  I+RYM LA++++L  +S +VK RF  P T+                               LV      L+ E EMK+FE   ++S    Y +PL+WAT +I ++ K G I S+ +   I   + + R  LG L  Y+   VPLVYTQV+ +V+YT+ I+ +  +Q++  N++ +          S     D + P+F + +F+ Y+GW KV    INPFG +  D+ L+ ++D +++ +  +   D+++   PE L D +
Sbjct:   30 YKLIWRELVAYLCLYYTINVIYRFGLTES--QQAIFKKIRLYFGQQSESIPMSFVLGFYVNLVVKRWWEQYRLLPWPDTLALFISAAIPNSNGGVNNETGRLMRRNIMRYMVLAYVITLQRISLRVKRRF--PTTQH------------------------------LVD---AGLMHESEMKIFEALNQKSPMSKYWMPLVWATNIINRARKDGLIASDHIVQTILVELSDIRRRLGGLIGYDTVCVPLVYTQVVTLVLYTYFIAALLGRQMLP-NVLDR----------SGREDPDLFFPLFTVLQFVFYVGWLKVAEVLINPFGEDDDDIELNWLIDRHIKAAYMIV--DEMHEEHPELLRDQY 346          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 135.961 bits (341), Expect = 6.869e-35
Identity = 107/372 (28.76%), Postives = 169/372 (45.43%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLG--FFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTFEDGSGDR 1104
            +K+L+ +FL F   Y  I++ YR +L+     K  FE +  Y +  A+L+P+SF+LG  F+V+ V+ RWW    SIP   +        + G D    + +R T++RY +L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FE+      K  Y +P +W T L   +   G I+ +  +  +   +  FRG    L  Y+  +VPLVYTQV+ + VY+F +  +  +Q +D    +                LD Y+P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS      D++Y   P    D + + S  R
Sbjct:   29 YKVLYKEFLAFFAMYTAISITYRFFLVDG--QKRYFEKLSIYCDNYASLIPMSFVLGMRFYVTLVVNRWWSQYTSIPLPDRVMCVLSGGVQGSDERG-RLLRRTLMRYSSLSALLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFESLHSPYNK--YWIPCVWFTNLAAAARCEGRIKDDNTYKLLLEELNNFRGKCSMLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPGQGYPG------------HDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVSMMAV--DEMYGDLPMMERDRYWNDSNPR 346          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 138.658 bits (348), Expect = 8.512e-35
Identity = 100/349 (28.65%), Postives = 158/349 (45.27%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLID-------HNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ + L F   Y  I++ YR  L  +   +  FE +  Y ++ A L+P+SF+LGF+V+ V+ RWW    S+PW  + +      + G D    + IR +++RY NL+ IL   ++S  V  RF               + H                   LV+     L+  EE++  +       K  + VP MW   L  ++   G I ++     I N +   R     L  Y+  ++PLVYTQV+ + VY+F ++ +  +Q +D       HNL                   D YLPVF + +F  Y+GW KV    INPFG +  D   + ++D NL+VS
Sbjct:   29 YKLLYRELLIFTVMYCIISITYRCVLTEE--QRRMFEKLSLYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLSALVSGHVRGADEG-ARLIRRSLMRYANLSGILIYRSVSTAVYKRF-------------PTMSH-------------------LVQ---AGLMTAEELRQLQELPSPHNK--FWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLDPAQGYPGHNL-------------------DFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 132.109 bits (331), Expect = 4.218e-34
Identity = 95/342 (27.78%), Postives = 161/342 (47.08%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL F   Y  I++LYR  L ++   +  F  +  + NK A L+P+SF+LGF+V+    RWW    S P            + G D    + +R T++RY NL+ +L L ++S +V+ RF         T++                       D++   F  T  + +   ++ +F K      Y +PL W   L  ++ K G ++ +     + + +  +R     L  Y+  ++PLVYTQV+ + VY+F     FT  LI    +   +  ++         LD Y+P+F + +F  Y GW KVG   INPFG +  D   ++++D N++VS
Sbjct:   29 YKLLYREFLVFCLLYTFISILYRCVLNNN--QQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTDERG-RLLRRTLMRYANLSSVLILRSISTRVRKRF--------TTLE-----------------------DIVEAGFMTTDELRKLNHLYSDFNK------YWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSF-----FTFSLIGRQFVKPASSEEH---------LDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVS 316          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 129.798 bits (325), Expect = 2.009e-33
Identity = 94/341 (27.57%), Postives = 160/341 (46.92%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEV 1023
            +KLL+ +FL F   Y  I++LYR  L ++   +  F  +  + NK A L+P+SF+LGF+V+    RWW    S P            + G D    + +R T++RY NL+ +L L ++S +V+ RF         T++                       D++   F  T  + +   ++ +F K      Y +PL W   L  ++ K G ++ +     + + +  +R     L  Y+  ++PLVYTQV+ + VY+F     FT  LI    +   +  ++         LD Y+P+F + +F  Y GW KVG   INPFG +  D   ++++D N++V
Sbjct:   29 YKLLYREFLVFCLLYTFISILYRCVLNNN--QQEIFARLARHCNKFAKLIPMSFVLGFYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGTDERG-RLLRRTLMRYANLSSVLILRSISTRVRKRF--------TTLE-----------------------DIVEAGFMTTDELRKLNHLYSDFNK------YWMPLAWFANLASQARKEGRVKDDIALRLLMDELNNYRSKCSMLFHYDWISIPLVYTQVVTVAVYSF-----FTFSLIGRQFVKPASSEEH---------LDLYIPIFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQV 315          
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 82.8037 bits (203), Expect = 5.177e-17
Identity = 53/171 (30.99%), Postives = 82/171 (47.95%), Query Frame = 1
Query:  514 LIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            L+  EE++  +       K  + VP MW   L  ++   G I ++     I N +   R     L  Y+  ++PLVYTQV+ + VY+F ++ +  +Q +D         Y           LD YLPVF + +F  Y+GW KV    INPFG +  D   + ++D NL+VS
Sbjct:    2 LMTAEELRQLQELPSPHNK--FWVPCMWFVSLAMRARSEGRINNDVAMTAILNELNTLRSQCMRLYGYDWISLPLVYTQVVTVAVYSFFLTCLIGRQFLD-----PAQGYPGHN-------LDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVS 158          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: ifitm3 (interferon induced transmembrane protein 3 [Source:Xenbase;Acc:XB-GENE-5852510])

HSP 1 Score: 141.739 bits (356), Expect = 1.087e-35
Identity = 102/342 (29.82%), Postives = 160/342 (46.78%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL F   Y  ++++YR +L      K  FE +  Y +K A  +P++F+LGF+V+ V+ RWW   +++PW  +  F   + + G D    + +R T++RY+NL  +L   ++S  V  RF                                   D +V+  F T    +E K+F++ +    K  Y VP++W   L  K+   G I        + N + +FR     L  Y+   +PLVYTQV+ + VYTF  + I  +Q +D      K  Y           LD Y+PVF + +F  Y GW KV    INPFG +  D   +  +D NL+VS
Sbjct:   29 YKLLYREFLLFTSLYTTLSVIYRFFLTDS--QKRYFEKVSMYCDKYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSNVHGRD-EYGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRF--------------------------------PTMDHVVEAGFMT---SDERKLFDSLKSPHLK--YWVPVIWFGNLASKARSEGRIRDSIDLQMMMNEMNKFRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLD-----PKQAYPGHD-------LDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: cyp2b6 (cytochrome P450 family 2 subfamily B member 6 [Source:Xenbase;Acc:XB-GENE-5779150])

HSP 1 Score: 137.117 bits (344), Expect = 1.052e-34
Identity = 98/352 (27.84%), Postives = 164/352 (46.59%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY 1056
            +KLL+ +F+ F C Y  +++ YR  L  +   K  F  +  Y N+   L+P+SF+LGF+V+ ++ RWW    +IP   +      + + GGD    + +R T++RY NL+ +L L ++S +V  RF               ++H                   +V+  F T    EE+K +E       K  Y +P +W T L  ++ + G +  +     + + + ++R     L  Y+  +VPLVYTQV+ I VY+F    I  +Q            +           +D Y+P+F + +F  Y GW KV    INPFG +  D   + ++D NL+V  S+   DD+Y
Sbjct:   29 YKLLYKEFIVFCCLYAMLSVTYRCLL--NEKQKSEFAQLARYCNQYTDLIPVSFVLGFYVTLIVNRWWAQYTNIPLPDQLMCVVSSNVHGGDERG-RLLRRTMMRYANLSSVLILRSVSTRVLKRF-------------PTMEH-------------------IVEAGFMT---REELKKYECLFSDYNK--YWIPCVWFTNLAAQARRDGRVRDDVALKLLMDELNKYRAKCSMLFHYDWISVPLVYTQVVTIAVYSFFGVCIIGRQ------------FLEPELEEEKPNIDLYVPIFTLLQFFFYSGWLKVAQQIINPFGEDDDDFETNRLIDRNLQV--SLLSVDDMY 326          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 134.42 bits (337), Expect = 1.704e-34
Identity = 100/342 (29.24%), Postives = 155/342 (45.32%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL FI  Y  I++ YR  L  +   +  FE +  Y +  A L+P+SF+LGF+V+ V+ RWW    S+PW  +      + + G D    + +R T++RY NL  +L L ++S  V +RF               L+H                   +V   F T     E   F+       K  + VP +W   L   +   G I    V   I   +   R   G L  Y+  +VPLVYTQV+ + VY+F ++ +  +Q +D    +                +D Y+PVF + +F  Y GW KV    INPFG++  D   + ++D NL+VS
Sbjct:   29 YKLLYREFLIFISCYFIISVTYRFLL--NEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERG-RMLRRTLMRYANLTGLLILRSVSTAVYMRF-------------PTLQH-------------------VVNAGFMT---PTERSKFDGLVSSHNK--FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPG------------HDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 134.035 bits (336), Expect = 2.095e-34
Identity = 100/342 (29.24%), Postives = 155/342 (45.32%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL FI  Y  I++ YR  L  +   +  FE +  Y +  A L+P+SF+LGF+V+ V+ RWW    S+PW  +      + + G D    + +R T++RY NL  +L L ++S  V +RF               L+H                   +V   F T     E   F+       K  + VP +W   L   +   G I    V   I   +   R   G L  Y+  +VPLVYTQV+ + VY+F ++ +  +Q +D    +                +D Y+PVF + +F  Y GW KV    INPFG++  D   + ++D NL+VS
Sbjct:   29 YKLLYREFLIFISCYFIISVTYRFLL--NEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERG-RMLRRTLMRYANLTGLLILRSVSTAVYMRF-------------PTLQH-------------------VVNAGFMT---PTERSKFDGLVSSHNK--FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPG------------HDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Match: best1 (bestrophin 1 [Source:NCBI gene;Acc:100302038])

HSP 1 Score: 134.035 bits (336), Expect = 3.654e-34
Identity = 100/342 (29.24%), Postives = 155/342 (45.32%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL FI  Y  I++ YR  L  +   +  FE +  Y +  A L+P+SF+LGF+V+ V+ RWW    S+PW  +      + + G D    + +R T++RY NL  +L L ++S  V +RF               L+H                   +V   F T     E   F+       K  + VP +W   L   +   G I    V   I   +   R   G L  Y+  +VPLVYTQV+ + VY+F ++ +  +Q +D    +                +D Y+PVF + +F  Y GW KV    INPFG++  D   + ++D NL+VS
Sbjct:   29 YKLLYREFLIFISCYFIISVTYRFLL--NEQQRIYFEKLALYCDNYAELIPVSFVLGFYVTLVVSRWWGQYESVPWPDRLMCLVSSNVHGTDERG-RMLRRTLMRYANLTGLLILRSVSTAVYMRF-------------PTLQH-------------------VVNAGFMT---PTERSKFDGLVSSHNK--FWVPCVWFANLAVTARSEGRIRDNVVLQLILKELNSLRTQCGRLYGYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPQKGYPG------------HDMDLYVPVFTLLQFFFYAGWLKVAEQLINPFGQDDDDFETNWLIDRNLQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 138.272 bits (347), Expect = 3.666e-35
Identity = 103/345 (29.86%), Postives = 163/345 (47.25%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICG---GDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L  +   K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P     A  C  ++ G   G  +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FR   G L  Y+  ++PLVYTQV+ I VY++ ++ +  +Q +D         Y++ T       LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGLYMALSAAYRFLLAEE--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMP--LPDALMC--IVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLD-----PAQGYKDHT-------LDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 138.272 bits (347), Expect = 3.666e-35
Identity = 103/345 (29.86%), Postives = 163/345 (47.25%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICG---GDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L  +   K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P     A  C  ++ G   G  +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FR   G L  Y+  ++PLVYTQV+ I VY++ ++ +  +Q +D         Y++ T       LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGLYMALSAAYRFLLAEE--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMP--LPDALMC--IVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLD-----PAQGYKDHT-------LDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best2 (bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588])

HSP 1 Score: 138.272 bits (347), Expect = 3.666e-35
Identity = 103/345 (29.86%), Postives = 163/345 (47.25%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICG---GDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L  +   K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P     A  C  ++ G   G  +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FR   G L  Y+  ++PLVYTQV+ I VY++ ++ +  +Q +D         Y++ T       LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGLYMALSAAYRFLLAEE--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMP--LPDALMC--IVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLD-----PAQGYKDHT-------LDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best1 (bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332])

HSP 1 Score: 136.346 bits (342), Expect = 4.968e-35
Identity = 103/361 (28.53%), Postives = 162/361 (44.88%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTF 1083
            +KLL+ +FL FI  Y  I  LYR+ L  D   +  FE +  Y +    L+P+SF+LGF+V+ V+ RWW    ++PW  +      + + G D    + +R T++RY  L  +L L ++S  V  RF  P       +    + H + K +                         +++ +  N        T+ VP +W   L  K+Y  G I    +   + N V   R   G L  Y+  ++PLVYTQV+ + VY+F ++ +  +Q ++ N  +                +D  +PVF I +FL YMGW KV    INPFG +  D   + I+D NL+VS     G     P    D +
Sbjct:   29 YKLLYGEFLVFIFLYYSIRGLYRMVLSSD--QQLLFEKLALYCDSYIQLIPISFVLGFYVTLVVSRWWSQYENLPWPDRLMIQVSSFVEGKDEEG-RLLRRTLIRYAILGQVLILRSISTSVYKRF--PTLH--HLVLAGFMTHGEHKQL-------------------------QKLGLPHN--------TFWVPWVWFANLSMKAYLGGRIRDTVLLQSLMNEVCTLRTQCGQLYAYDWISIPLVYTQVVTVAVYSFFLACLIGRQFLNPNKDYPG------------HEMDLVVPVFTILQFLFYMGWLKVAEQLINPFGEDDDDFETNWIIDRNLQVSLLSVDGMHQNLPPMERDMY 337          
BLAST of Bestrophin homolog vs. Ensembl Mouse
Match: Best3 (bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298])

HSP 1 Score: 139.043 bits (349), Expect = 7.005e-35
Identity = 102/368 (27.72%), Postives = 166/368 (45.11%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDR 1104
            +KLL+ +F+ F   Y  I+L+YRL L      K  FE +  Y ++ A  +P++F+LGF+V+ V+ RWW   +++PW  +      + + G D++  + +R T++RY+NL  +L   ++S  V  RF                                   D +V+  F T    +E K+F++ +    K  Y VP +W   L  K+   G I        +   +  +R     L  Y+   +PLVYTQV+ + VYTF  + +  +Q +D             T   +   LD Y+P+F + +F  Y GW KV    INPFG +  D   +  +D NL+VS        +  P+   D + D S  R
Sbjct:   29 YKLLYREFIVFAVLYTAISLVYRLLLTG--AQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQH-GRLLRRTLMRYVNLTSLLIFRSVSTAVYKRF--------------------------------PTMDHVVEAGFMT---ADERKLFDHLKSPHLK--YWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLD------------PTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAAR 344          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8NFU0|BEST4_HUMAN (Bestrophin-4 OS=Homo sapiens OX=9606 GN=BEST4 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 6.622e-36
Identity = 100/345 (28.99%), Postives = 163/345 (47.25%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNL---IHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL F   Y  +++ YRL L  +   +  +  +  Y N+ A L+PLSF+LGF+V+ V+ RWW    SIP   +      A + G D+   + +R T++RY NLA +L L ++S +V  RF               ++H                   +V   F   + +EE K FE+ +    K  Y VP +W T L  ++ + G I  +     +   + ++R     L  Y+  ++PLVYTQV+ I VY+F    +  +Q ++        +K L             D Y+P+  + +F  Y GW KV    INPFG +  D   ++++D NL+VS
Sbjct:   29 YKLLYKEFLLFGALYAVLSITYRLLLTQE--QRYVYAQVARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQRG-RLLRRTLIRYANLASVLVLRSVSTRVLKRF-------------PTMEH-------------------VVDAGF---MSQEERKKFESLKSDFNK--YWVPCVWFTNLAAQARRDGRIRDDIALCLLLEELNKYRAKCSMLFHYDWISIPLVYTQVVTIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDMYVPLTTLLQFFFYAGWLKVAEQIINPFGEDDDDFETNQLIDRNLQVS 333          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8NFU1|BEST2_HUMAN (Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 6.880e-35
Identity = 101/342 (29.53%), Postives = 158/342 (46.20%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L      K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P            + G D +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FRG  G L  Y+  +VPLVYTQV+ I +Y++ ++ +  +Q +D    +K               LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGFYMALSAAYRFVLTEG--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRD-DRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDH------------DLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8N1M1|BEST3_HUMAN (Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.831e-34
Identity = 104/368 (28.26%), Postives = 165/368 (44.84%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDR 1104
            +KLL+ +F+ F   Y  I+L+YRL L    V K  FE +  Y ++ A  +P++F+LGF+V+ V+ RWW   +++PW  +  F   + + G D +  + +R T++RY+NL  +L   ++S  V  RF                                   D +V+  F T    +E K+F + +    K  Y VP +W   L  K+   G I        +   +  +R     L  Y+   +PLVYTQV+ + VYTF  + +  +Q +D             T       LD Y+P+F + +F  Y GW KV    INPFG +  D   +  +D NL+VS        +  P+   D + D S  R
Sbjct:   29 YKLLYREFIVFAVLYTAISLVYRLLLTG--VQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMFLISSSVHGSDEH-GRLLRRTLMRYVNLTSLLIFRSVSTAVYKRF--------------------------------PTMDHVVEAGFMTT---DERKLFNHLKSPHLK--YWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLD------------PTKGYAGHDLDLYIPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAAR 344          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q8BGM5|BEST2_MOUSE (Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.149e-34
Identity = 103/345 (29.86%), Postives = 163/345 (47.25%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICG---GDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLLW + L F+  Y+ ++  YR  L  +   K  FE +V Y ++ A+L+P+SF+LGF+V+ V+ RWW   + +P     A  C  ++ G   G  +  +  R T++RY  L+ +L L ++S  V  RF         TI                        D +V+  F T    EE K FEN      K  Y VP +W + L  ++ + G I        +   +  FR   G L  Y+  ++PLVYTQV+ I VY++ ++ +  +Q +D         Y++ T       LD  +P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKLLWRELLCFLGLYMALSAAYRFLLAEE--QKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMP--LPDALMC--IVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRF--------PTI------------------------DHVVEAGFMT---REERKKFENLNSSYNK--YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVVTIAVYSYFLACLIGRQFLD-----PAQGYKDHT-------LDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Match: sp|Q6H1V1|BEST3_MOUSE (Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.900e-34
Identity = 102/368 (27.72%), Postives = 166/368 (45.11%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDR 1104
            +KLL+ +F+ F   Y  I+L+YRL L      K  FE +  Y ++ A  +P++F+LGF+V+ V+ RWW   +++PW  +      + + G D++  + +R T++RY+NL  +L   ++S  V  RF                                   D +V+  F T    +E K+F++ +    K  Y VP +W   L  K+   G I        +   +  +R     L  Y+   +PLVYTQV+ + VYTF  + +  +Q +D             T   +   LD Y+P+F + +F  Y GW KV    INPFG +  D   +  +D NL+VS        +  P+   D + D S  R
Sbjct:   29 YKLLYREFIVFAVLYTAISLVYRLLLTG--AQKRYFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQH-GRLLRRTLMRYVNLTSLLIFRSVSTAVYKRF--------------------------------PTMDHVVEAGFMT---ADERKLFDHLKSPHLK--YWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLD------------PTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAAR 344          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267GVI2 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001426g2 PE=3 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 5.612e-85
Identity = 153/415 (36.87%), Postives = 239/415 (57.59%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICG---GDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVF------ENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALD--NYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISG--GNDKAGNEKAVEMQI 1206
            W+LLW D+L F   Y+G+ +LY   L      K  FE  V ++  +   VPLSF+LGFFVS V GRWW +  SIPW+   +F CQAL+        +  + +R+T++RY+NLAWIL +  +S  +K RF      G    K +  +      +T ++++  INSD  V+K+FG L+ E+EM+ F       N    S  P Y +PLMWAT+LI ++   G I  ER +L + N++  FRG LGT+ +Y EFN+PLVYTQV +  VY FL S + + QL+D +++  +     +  ++ T  L+  +YLPV G  +F+ Y+GWFK+G+  +NP G++++D+P+ +IL+ NL+ S  +   +D  FP  L+D+   G  +  ++ E  RS        +G   +DK G+ +  E Q+
Sbjct:   29 WQLLWIDYLIFTLMYVGLAVLYFNLLYTHAELKATFEVTVAWLKAIRTSVPLSFMLGFFVSAVFGRWWSVCTSIPWLHSSSFYCQALVDSPKTSRSDLARKLRITVLRYLNLAWILMMAGVSLHIKERF------GYWQPKWRKFQ------LTWQRRLQLINSDSKVQKYFGQLVTEKEMQAFAKSAELSNDNDHSYDPEYWLPLMWATRLIRRAKNLGCIADERQYLFLVNIINNFRGDLGTVWMYTEFNIPLVYTQVAVTAVYLFLASTLISTQLVDSDILLLENFPSRNGTVTRTLGLNLLSYLPVIGSLEFIFYLGWFKIGMCLLNPMGKDKADIPMSDILNSNLKASVKIGGAEDSIFPGGLTDS---GEAEEAQVAEFLRSF-----DFTGVHAHDKFGSAEQTERQL 423          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FSL4 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030079g1 PE=3 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 1.134e-84
Identity = 151/415 (36.39%), Postives = 237/415 (57.11%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICG---GDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVF------ENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALD--NYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISG--GNDKAGNEKAVEMQI 1206
            W+LLW D+L F   Y+G+ +LY   L      K  FE  V ++  +   VPLSF+LGFFVS V GRWW +  SIPW+   +F CQAL+        +  + +R+T++RY+NLAWIL +  +S  +K RF      G    K +  +      +T ++++  INSD  V+K+FG L+ ++EM+ F       N    S  P Y +PLMWAT+LI ++   G I  ER +L + N++  FRG+LGT+ +Y EFN+PLVYTQV +  VY FL S + + QL+D +++  +     +  ++ T  L+  +YLPV G  +F+ Y+GWFK+G+  +NP G++++D+P+ +IL+ NL+ S  +   +D  FP  L+D+ E       +   SF          +G   +DK G+ +  E Q+
Sbjct:   29 WQLLWIDYLIFTLMYVGLAVLYFNLLYTHAELKATFEVTVAWLKAIRTSVPLSFMLGFFVSAVFGRWWSVCTSIPWLHSSSFYCQALVDSPKTSRSDLARKLRITVLRYLNLAWILMMAGVSLHIKERF------GYWQPKWRKFQ------LTWQRRLQLINSDSKVQKYFGQLVTDKEMQAFAKSAELSNDNDHSYDPEYWLPLMWATRLIRRAKNLGCIADERQYLFLVNIINNFRGNLGTVWMYTEFNIPLVYTQVAVTAVYLFLASTLISTQLVDSDILLLENFPSRNGTVTRTLGLNLLSYLPVIGSLEFIFYLGWFKIGMCLLNPMGKDKADIPMSDILNSNLKASVKIGGAEDSIFPGGLTDSGEAEEAQVAEFLRSFD--------FTGVHAHDKFGSAEQTERQL 423          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FBA9 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028808g1 PE=3 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 4.508e-84
Identity = 149/391 (38.11%), Postives = 226/391 (57.80%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALI--CGGDR-NTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKK------PTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLID-------HNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESF 1125
            W+LLW DF +F  +Y+G+ ++Y   L   P  +  FE+++     +   VPLSF+LGFFVS+VL RWW + M+IPWM  PAF  Q LI  C   + +  + +R+T++RY NLAWIL +  +S  +K RF       K T + K+         T RQ++  INSD  V+K+FG LI EEEM+VF    + SK       P Y +PL WA +++ ++   G I  ER FL +  + Q FR  LG +  Y+EFN+PLVYTQV +  VY FL S + + QLI+       H+L++   + +  +   +     +++P+ G  +F+ Y+GWFK+G+  +NP G++++DLPL EIL+ NL+VS  +   +D  FP  L+D  E        +F +F
Sbjct:   29 WQLLWVDFFFFALAYVGLAVMYHQLL--SPTRRITFEAVIRSTGSIRTSVPLSFMLGFFVSSVLSRWWSMCMAIPWMHAPAFYAQGLIESCHKSKSDIARKVRITVLRYFNLAWILMMATISLHIKHRF--GFMRPKNTREFKL---------TWRQRLELINSDAKVQKYFGKLITEEEMQVFARSAELSKDTDWTYTPEYWLPLGWANRIMRRAKNIGCIADERQFLWMVTIAQNFRNDLGIVWTYSEFNIPLVYTQVAVTAVYIFLFSTLLSTQLIESEVGLDRHSLVNGSRVDEPGSTTGVEVL--SHIPILGSLEFIFYLGWFKIGMCLMNPLGKDKADLPLSEILNSNLKVSVKLGGAEDSLFPPGLTDNGEPEEQQLVDLFRTF 404          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267FRV1 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021055g1 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 7.463e-84
Identity = 145/374 (38.77%), Postives = 228/374 (60.96%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGD---RNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVF------ENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKT--LYQNSTFISITA-ALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFE 1086
            W+LLW DFL FI  Y+ +  LY L L +DP  K  FE  V+++  V+  VPLSF+LGFFVS+V+ RWW + MSIPW+  P+F CQAL+        +  + +R+T++RY+NLAWIL +  +S  ++ RF      G    K K  K++    +T R+++  +NSD  V+K+FG L+ + E+  F       N  K +  P Y +PL+WAT+LI ++     I  ER  L + + VQ+FR  LGT+ ++ EFN+PLVY QV +  VY +L+S I + QL+D +++   T  L  N T+   T   +  ++PV G  +F+ Y+GWFK+G+  +NP G++++D+P+ +IL+ NL+ +  +   +D  FP  L+D+ E
Sbjct:   29 WQLLWLDFLVFILIYVSLAALYHLVLYNDPKMKATFEITVSWLKTVSTAVPLSFMLGFFVSSVVERWWSVCMSIPWLQTPSFYCQALLDSPKTYRSDLARKLRITVLRYLNLAWILMMAGVSLHIRERF------GYWQPKWKTKKYK----LTWRRRLKMVNSDEKVQKYFGQLVTDNEIAAFGRSAELSNDNKHTYDPEYWLPLVWATRLIRRARNLDCIADERHCLWLIDTVQKFRYDLGTIWMFTEFNIPLVYVQVAVTAVYLYLVSTIISTQLMDSDIVQSSTAILNVNGTYQRNTGQQVLGFIPVLGGLEFIFYLGWFKIGMCLLNPMGKDEADIPMSDILNSNLKAAIKMGGAEDSIFPRGLTDSGE 392          
BLAST of Bestrophin homolog vs. TrEMBL
Match: A0A267GWW3 (Bestrophin homolog OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018113g1 PE=3 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 1.278e-83
Identity = 149/391 (38.11%), Postives = 227/391 (58.06%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALI--CGGDR-NTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKK------PTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLID-------HNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESF 1125
            W+LLW DFL+F+ +Y+ + +LY   L      +  FE+++  +  +   VPLSF+LGFFVS+VL RWW + M+IPWM  PAF  Q LI  C   + +  + +R+T++RY NLAWIL +  +S  +K RF       K T + K+         T RQ++  INSD  V+K+FG LI EEEM+VF    + SK       P Y +PL WA +++ ++   G I  ER FL +  + Q FR  LG +  Y+EFN+PLVYTQV +  VY FL S + + QLI+       H+L++   + +  +   +     +++P+ G  +F+ Y+GWFK+G+  +NP G++++DLPL EIL+ NL+VS  +   +D  FP  L+D  E        +F +F
Sbjct:   29 WQLLWVDFLFFVLAYVSLAVLYHQLL--SSTRRITFEAVIRSIGSIRTSVPLSFMLGFFVSSVLSRWWSMCMAIPWMHAPAFYAQGLIESCHKSKSDIARKVRITVLRYFNLAWILMMATISLHIKHRF--GFMRPKNTREFKL---------TWRQRLELINSDAKVQKYFGKLITEEEMQVFARSAELSKDTDWTYTPEYWLPLGWANRIMRRAKNIGCIADERQFLWMVTIAQNFRNDLGIVWTYSEFNIPLVYTQVAVTAVYIFLFSTLLSTQLIESEVGLDRHSLVNGSRVDEPGSTTGVEVL--SHIPILGSLEFIFYLGWFKIGMCLMNPLGKDKADLPLSEILNSNLKVSVKLGGAEDSLFPAGLTDNGEPEEQQLADLFRTF 404          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 142.895 bits (359), Expect = 2.297e-36
Identity = 100/342 (29.24%), Postives = 159/342 (46.49%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +K+L+ + L F   Y  I++ YR +L+ +   K  FE +  Y N  A+L+P+SF+LGF+V+ ++ RWW    SIP            + GGD    + +R T++RY +LA +L L ++S  V  RF                                   D +V+  F T    EE K FE+      K  Y +P +W T L   +   G I+ +  +  +   + +FRG    L  Y+  +VPLVYTQV+ + VY+F +  +  +Q +D +  +                LD Y+P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKVLYKEVLAFFILYTAISITYRFFLLDE--QKRYFEKLSIYCNHYASLIPMSFVLGFYVTLIVNRWWSQYTSIPLPDSIMCVLSGGLQGGDERG-RLLRRTLMRYASLASLLILRSVSTAVFKRF--------------------------------PTMDHVVEAGFMT---REERKKFESLHSPYNK--YWIPCVWFTNLAAVARSEGRIKDDNTYKLLLEELNKFRGKCSLLFHYDMISVPLVYTQVVTLAVYSFFLVCLIGRQFLDPSQAYPG------------HDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 142.895 bits (359), Expect = 3.003e-36
Identity = 102/342 (29.82%), Postives = 160/342 (46.78%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ + L F   Y  I++LYR  L  D   +  FE +  Y ++ A L+P+SF+LGF+V+ V+ RWW    S+PW  + A    A + G D    + IR ++VRY NL+ +L   ++S  V  RF               ++H                   LV+     L+  EE +  ++      K  + VP MW   L  ++   G I ++     I N +   R     L  Y+  ++PLVYTQV+ + VY+F ++ +  +Q +D    +                LD YLPVF + +F  Y+GW KV    INPFG +  D   + ++D NL+VS
Sbjct:   29 YKLLYRELLIFTVLYCTISVLYRFLL--DNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEG-ARLIRRSLVRYANLSGVLIYRSISTAVYKRF-------------PTIEH-------------------LVQ---AGLMTVEERRQLDDLPSPHNK--FWVPCMWFVNLALRARTEGRINNDVALSAILNELNTLRSQCMKLYSYDWISLPLVYTQVVTVAVYSFFLACLIGRQFLDPTQGYSG------------HDLDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best4 (bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6])

HSP 1 Score: 123.635 bits (309), Expect = 4.642e-31
Identity = 94/342 (27.49%), Postives = 153/342 (44.74%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +FL F   Y   +L+YR  L      +  FE    + NK A L+P+SF+L F+V+    RWW    S P            + G D    + +R T++RY NL+ +L L ++S +V  RF               L+H                   +V  F    + EEEM+  ++      K  Y +PL W   L  K+ + G ++ +     + + +  +RG    L  Y+  ++PLVYTQ ++    T  +   F   LI    +  +   +      +   +D Y+PVF + +F  Y GW KVG   INPFG +  D   ++++D N++VS
Sbjct:   29 YKLLYKEFLLFCFLYSLFSLIYRCVLTDG--QQELFERAARHCNKFAKLIPMSFVL-FYVTQAFQRWWGQYTSFPLPDNLMMVVSGNVHGSDERG-RLLRRTLMRYANLSSVLILRSISTRVHKRF-------------PTLQH-------------------IVDAF----MTEEEMRTLDHLYSDFNK--YWMPLTWFANLASKAREEGRVKDDIALRLLMDELNNYRGKCSMLFHYDWISIPLVYTQQVV----TLAVYSFFAFCLIGRQFVKPERADE------LKVHVDLYVPVFTLLEFFFYAGWLKVGELIINPFGEDDDDFETNQLIDRNIQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:103045999])

HSP 1 Score: 119.783 bits (299), Expect = 1.571e-28
Identity = 99/342 (28.95%), Postives = 150/342 (43.86%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ + L F   Y  I++LYR  L  D   +  FE +  Y ++ A L+P+SF+LGF+V+ V+ RWW    S+PW  + A    A + G D    + IR ++VRY NL+ +L   ++S  V  RF               ++H                   LV+     L+  EE +  ++      K  + VP MW   L  ++   G I ++     I N+V        T++VY+ F   L+  Q        FL     TQ    H+                   LD YLPVF + +F  Y+GW KV    INPFG +  D   + ++D NL+VS
Sbjct:   29 YKLLYRELLIFTVLYCTISVLYRFLL--DNEQRRLFEKLAIYCDQYAQLIPVSFVLGFYVTLVVSRWWGQFESVPWPDRLAALVGAYVRGADEG-ARLIRRSLVRYANLSGVLIYRSISTAVYKRF-------------PTIEH-------------------LVQ---AGLMTVEERRQLDDLPSPHNK--FWVPCMWFVNLALRARTEGRINNDVALSAILNVV--------TVAVYSFFLACLIGRQ--------FLDP---TQGYSGHD-------------------LDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWLVDRNLQVS 292          
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Match: BEST3 (bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105])

HSP 1 Score: 92.4337 bits (228), Expect = 7.106e-20
Identity = 59/170 (34.71%), Postives = 82/170 (48.24%), Query Frame = 1
Query:  517 IMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +  EE K+FEN +    K  Y +P +W T L  K+ K G I+       I   +  FR    TL  Y+   +PLVYTQV+ + VYTF  + I  +Q +D    +                LD Y+PVF + +F  Y GW KV    INPFG +  D   +  +D NL+VS
Sbjct:   85 MTPEEKKIFENLKSPHLK--YWIPTVWFTNLASKARKDGRIQDSVDLQTILTEMNRFRTWCSTLFGYDWVGIPLVYTQVVTLAVYTFFSASIIGRQFLDPAQGYPG------------HDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWCIDRNLQVS 240          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best1 (bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214])

HSP 1 Score: 129.028 bits (323), Expect = 1.169e-33
Identity = 96/342 (28.07%), Postives = 151/342 (44.15%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ +F  F+  +  ++ +YR  L  +   K  FE +  Y NK A L+P+SF+LGF+V+ V+ RWW    S+PW  +        + G D    + +R T++RY NL+ +L L ++S  V  RF                                   D +V+  F T     E + F+       K  + VP +W   L  ++   G I        I N +  FR     L  Y+  ++PLVYTQV+ + VY+F ++ +  +Q +                      +D Y+PVF + +F  Y GW KV    INPFG +  D   +  +D NL+VS
Sbjct:   29 YKLLYKEFCIFLVLFFTLSSVYRYMLQEN--QKRYFEKLAMYCNKYAELIPVSFVLGFYVTLVVSRWWSQYESLPWPDRLMHLVACNVHGADERG-RLLRRTLMRYANLSALLILRSVSTAVYKRF--------------------------------PTMDHVVEAGFMT---PAERRKFDGLRSPHNK--FWVPCVWFANLAAQAKAEGRILDNVSLQLILNDLNNFRSCCSMLYSYDWVSIPLVYTQVVTVAVYSFFLACLIGRQFLGPQGYPGHD-------------MDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFEANWCVDRNLQVS 317          
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Match: best2 (bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127])

HSP 1 Score: 129.798 bits (325), Expect = 5.592e-33
Identity = 106/403 (26.30%), Postives = 175/403 (43.42%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLY--FPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQ 1203
            +KLL+ +F  +   Y  ++L  R  L  D   K  FE +  Y N  A L+P+    GF+V+ V+ RWW    SIP   +        + G D    + +R T++RY NL+ +L L ++S  V  RF                                   D +V+  F T    +E K F+       K  Y VP +W + L  ++   G +  +     + + +  +RG+ G L  Y+  +VPLVYTQV+ + VY+F ++ +  +Q +D    +                +D Y+PVF + +F  Y GW KV    INPFG +  D   + ++D NL+VS      D++Y   P    D + + S  R     +  S L + + +    D + ++  +E Q
Sbjct:   29 YKLLYREFSIYFMMYAALSLTSRFALSED--QKRLFEKLSLYCNNYANLIPVRSCSGFYVALVVSRWWSQYTSIPTPDRLMCAVAGTVHGVDERG-RLLRRTLMRYANLSALLILRSVSTAVYKRF--------------------------------PTMDHVVEAGFMT---RDERKRFDGLRCSYNK--YWVPCVWLSSLAAQARAEGRVRDDVALKLLLDEMNVYRGNCGMLFHYDWISVPLVYTQVVTVAVYSFFLACLIGRQFLDPAQGYPGH------------DMDLYIPVFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNLQVSMLAV--DEMYQNLPLLQRDMYWNASDPRPPYTAATMSTLHKPSFLGSAFDMSMHKDDMEFQ 377          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: BEST3 (bestrophin 3 [Source:NCBI gene;Acc:101172121])

HSP 1 Score: 155.221 bits (391), Expect = 8.732e-41
Identity = 114/368 (30.98%), Postives = 172/368 (46.74%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDR 1104
            +KLL+ +FL F   Y  ++L+YRL L      K  FE +  Y ++ A  +P++F+LGF+V+ V+ RWW   +++PW  +  F   + + G D    + +R T+VRY+NL  +L   ++S  V  RF         TI                        D +V+  F T    EE KVFEN      K  Y +P++W + L  ++ + G I+      +I N +  FR    TL  Y+   +PLVYTQV+ + VYTF  + I  +Q +D    H                LD Y+PVF + +F  Y GW KV    INPFG +  D   + I+D NL+VS        +  P    D + + S  R
Sbjct:   29 YKLLYREFLLFALLYTILSLIYRLALSEQ--QKRLFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFLNLPWPDRLMFHISSCVQGKD-EYGRLLRRTLVRYINLTSLLIFRSVSTAVCKRF--------PTI------------------------DHVVEAGFMT---PEERKVFENIRSPHLK--YWIPVVWFSNLASRARQEGRIQDAIDLQNILNEMNTFRTWCATLFGYDWVGIPLVYTQVVTLAVYTFFFACIIGRQFLDPAQGHPG------------HDLDLYVPVFTLLQFFFYSGWLKVAEQLINPFGEDDDDFEANWIIDRNLQVSLLAVDEMHMNLPHMTKDIYWNDSDAR 344          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best2 (bestrophin 2 [Source:NCBI gene;Acc:110015962])

HSP 1 Score: 140.969 bits (354), Expect = 6.689e-36
Identity = 101/342 (29.53%), Postives = 155/342 (45.32%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +K+L+ +FL F   Y  I++ YR +L  D   K  FE +  Y N  A+L+P+SF+LGF+V+ ++ RWW    SIP   +        + G D    + +R +++RY +L+ +L L ++S  V  RF                                   D +V+  F T    EE K FE       K  Y +P +W T L   +   G I  +     +   +  FRG    L  Y+  +VPLVYTQV+ + VY+F +  +  +Q +D         YQ          LD Y+P+F + +F  Y GW KV    INPFG +  D   + ++D N +VS
Sbjct:   29 YKVLYKEFLAFFVLYAAISITYRFFLYED--QKRYFEKLAIYCNHYASLIPMSFVLGFYVTLIVNRWWNQYTSIPLPDRIMCVLSGGLQGNDERG-RLLRRSMMRYASLSALLILRSVSTAVFKRF--------------------------------PTMDHVVEAGFMT---REERKKFEGLHSPYNK--YWIPCVWFTNLAAVARCEGRIRDDHALKLLLEELNAFRGKCSLLFHYDMVSVPLVYTQVVTLAVYSFFLVCLIGRQFLD-----PSQGYQGHD-------LDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNFQVS 318          
BLAST of Bestrophin homolog vs. Ensembl Medaka
Match: best1 (bestrophin-2 [Source:NCBI gene;Acc:101167866])

HSP 1 Score: 126.716 bits (317), Expect = 7.424e-31
Identity = 100/345 (28.99%), Postives = 159/345 (46.09%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLT---IVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVS 1026
            +KLL+ + + F   Y  ++L+Y  Y++ D   +  FE +  Y ++ A L+P+SF+L F+V+ V+ RWW    +IPW  + A    AL+ G  R T +  RLT   ++RY+NL+ +L   ++S  V  RF  P TE                                       L+  EE++ FE       K  + VP MW   L  ++   G I ++     I   +   R     L  Y+  ++PLVYTQV  + VY+F ++ +  +Q +D    +                +D YLPVF + +F  Y+GW KV    INPFG +  D   + ++D NL+VS
Sbjct:   29 YKLLYRELIIFTLLYYFLSLVY--YML-DNDQRRLFERLSIYCDRYAELIPVSFVL-FYVTLVVSRWWGQFENIPWPDRLA----ALVGGHVRGTDEASRLTRRALMRYVNLSGVLIYRSVSTAVYKRF--PTTE----------------------------------HLVQALMTSEELRHFEELPSPHNK--FWVPCMWFVNLALRARTEGRINNDVALTAILTELNSLRAKCMKLYGYDWISLPLVYTQVATVAVYSFFLACLIGRQFLDPAQGYPG------------HDVDFYLPVFTLLQFFFYVGWLKVAEQLINPFGEDDDDFETNWVVDRNLQVS 315          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000016298.1 (SMESG000016298.1)

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 419/419 (100.00%), Postives = 419/419 (100.00%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQIFNSSDEAVDIESKPMMA 1257
            WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQVIIIVVYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQIFNSSDEAVDIESKPMMA
Sbjct:   32 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQVIIIVVYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQIFNSSDEAVDIESKPMMA 450          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000016290.1 (SMESG000016290.1)

HSP 1 Score: 452.595 bits (1163), Expect = 3.044e-157
Identity = 235/413 (56.90%), Postives = 297/413 (71.91%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGK--KTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQIFNSSDEAVD 1233
            WKLLW DF+WF   Y  IT+LYR+YLIHDP  K  FESIV Y+NKVA +VPLSFLLGFFVSTVLGRWW+IV SIPWMTKPAFTCQALI       CK+IRLTIVRYMNLAWILS+M LS KVK RF+I  T  K    +K     +   K   +R+KM KINSD +VKK FG LIME+E++VFEN E  S KP++I PLMW T+LIEK+++ G+I+S+ V  ++FN+VQ+F+ +L  L+V+NEFNVPLVYTQVIIIVVYTFLISE+ ++Q+I +  I                 + +Y P+F IFKF+IYMGWFK+GLSFINPFG + SDLPLDEILDYNLE+S+++A G+D Y+PEYL+ TF+D     +K  E FR  +P  +      +K  ++  V+  +F + DE  D
Sbjct:   26 WKLLWVDFIWFSVFYSAITMLYRMYLIHDPNKKEAFESIVIYLNKVAGIVPLSFLLGFFVSTVLGRWWKIVNSIPWMTKPAFTCQALITEDTEPLCKDIRLTIVRYMNLAWILSVMYLSTKVKQRFIITSTTNKIISCLKDSPNLNTISKGKNVRKKMEKINSDEIVKKHFGKLIMEDEIRVFENVEHMSNKPSFITPLMWTTRLIEKAHRDGFIKSQGVCFNLFNMVQDFKSNLSNLAVHNEFNVPLVYTQVIIIVVYTFLISELLSEQIISNENI----------------LIGSYFPIFAIFKFIIYMGWFKMGLSFINPFGSDPSDLPLDEILDYNLEISSTIASGEDFYYPEYLTKTFKDPEDSPWKQLEKFRLLVPE-SFNVKKEEKCCSKTYVDGHMFATHDEPDD 421          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000016290.1 (SMESG000016290.1)

HSP 1 Score: 426.787 bits (1096), Expect = 1.167e-147
Identity = 223/394 (56.60%), Postives = 284/394 (72.08%), Query Frame = 1
Query:   58 LLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGK--KTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQIFNSSDEAVD 1233
            +LYR+YLIHDP  K  FESIV Y+NKVA +VPLSFLLGFFVSTVLGRWW+IV SIPWMTKPAFTCQALI       CK+IRLTIVRYMNLAWILS+M LS KVK RF+I  T  K    +K     +   K   +R+KM KINSD +VKK FG LIME+E++VFEN E  S KP++I PLMW T+LIEK+++ G+I+S+ V  ++FN+VQ+F+ +L  L+V+NEFNVPLVYTQVIIIVVYTFLISE+ ++Q+I +  I                 + +Y P+F IFKF+IYMGWFK+GLSFINPFG + SDLPLDEILDYNLE+S+++A G+D Y+PEYL+ TF+D     +K  E FR  +P  +      +K  ++  V+  +F + DE  D
Sbjct:    1 MLYRMYLIHDPNKKEAFESIVIYLNKVAGIVPLSFLLGFFVSTVLGRWWKIVNSIPWMTKPAFTCQALITEDTEPLCKDIRLTIVRYMNLAWILSVMYLSTKVKQRFIITSTTNKIISCLKDSPNLNTISKGKNVRKKMEKINSDEIVKKHFGKLIMEDEIRVFENVEHMSNKPSFITPLMWTTRLIEKAHRDGFIKSQGVCFNLFNMVQDFKSNLSNLAVHNEFNVPLVYTQVIIIVVYTFLISELLSEQIISNENI----------------LIGSYFPIFAIFKFIIYMGWFKMGLSFINPFGSDPSDLPLDEILDYNLEISSTIASGEDFYYPEYLTKTFKDPEDSPWKQLEKFRLLVPE-SFNVKKEEKCCSKTYVDGHMFATHDEPDD 377          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000016290.1 (SMESG000016290.1)

HSP 1 Score: 419.083 bits (1076), Expect = 9.734e-145
Identity = 220/390 (56.41%), Postives = 280/390 (71.79%), Query Frame = 1
Query:   70 LYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGK--KTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQIFNSSDEAVD 1233
            +YLIHDP  K  FESIV Y+NKVA +VPLSFLLGFFVSTVLGRWW+IV SIPWMTKPAFTCQALI       CK+IRLTIVRYMNLAWILS+M LS KVK RF+I  T  K    +K     +   K   +R+KM KINSD +VKK FG LIME+E++VFEN E  S KP++I PLMW T+LIEK+++ G+I+S+ V  ++FN+VQ+F+ +L  L+V+NEFNVPLVYTQVIIIVVYTFLISE+ ++Q+I +  I                 + +Y P+F IFKF+IYMGWFK+GLSFINPFG + SDLPLDEILDYNLE+S+++A G+D Y+PEYL+ TF+D     +K  E FR  +P  +      +K  ++  V+  +F + DE  D
Sbjct:    1 MYLIHDPNKKEAFESIVIYLNKVAGIVPLSFLLGFFVSTVLGRWWKIVNSIPWMTKPAFTCQALITEDTEPLCKDIRLTIVRYMNLAWILSVMYLSTKVKQRFIITSTTNKIISCLKDSPNLNTISKGKNVRKKMEKINSDEIVKKHFGKLIMEDEIRVFENVEHMSNKPSFITPLMWTTRLIEKAHRDGFIKSQGVCFNLFNMVQDFKSNLSNLAVHNEFNVPLVYTQVIIIVVYTFLISELLSEQIISNENI----------------LIGSYFPIFAIFKFIIYMGWFKMGLSFINPFGSDPSDLPLDEILDYNLEISSTIASGEDFYYPEYLTKTFKDPEDSPWKQLEKFRLLVPE-SFNVKKEEKCCSKTYVDGHMFATHDEPDD 373          
BLAST of Bestrophin homolog vs. Planmine SMEST
Match: SMESG000016291.1 (SMESG000016291.1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.663e-141
Identity = 212/402 (52.74%), Postives = 278/402 (69.15%), Query Frame = 1
Query:    1 WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALVPLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIRLTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPITIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWATKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQXXXXXXYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVFGIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDDLYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEMQI 1206
            WKLLWADFLWF   Y GITLLYRLYLI D   K  FESIV YMNK AALVPLSFLLGFFVSTVLGR+W IV SIPWM+KPAF CQA++ G +    + +RLTI+RY+NL+W+L++M LS KV+ RF I     K+    ++L    PK I+IR+++ K+NSD +VK++FG LIMEEEM V E  + +   P + +PLMWATKL+EK+ KA YI+S+     + N++Q+ + +L  L+V+N FNVPLVYTQVIIIVVYTFLISEIF+QQ I +  I                 +++Y P+F IFKF IYMGWFKVGL+FINPFG + +DLPLDE+LDYNL++SA +A   D  FPEYL+ + E+   ++ ++ E F +    +        + GN+   +M I
Sbjct:   32 WKLLWADFLWFFLIYTGITLLYRLYLIKDIQKKVVFESIVAYMNKAAALVPLSFLLGFFVSTVLGRFWTIVNSIPWMSKPAFLCQAVLNGDNEVKSRQLRLTIIRYLNLSWVLTMMKLSDKVRKRFWI----KKENKSFELLNKNLPK-ISIRERLNKVNSDEMVKRYFGKLIMEEEMTVLEGLDDKPTTPQFFIPLMWATKLVEKARKADYIKSDSTCSSMVNMIQDMKNNLDNLAVFNTFNVPLVYTQVIIIVVYTFLISEIFSQQTITNPNID----------------IESYFPIFSIFKFFIYMGWFKVGLTFINPFGSDDTDLPLDEMLDYNLQISAVIARASDSCFPEYLNSSLENSVVNKLEVLEKFEAERSEIQTNYRDQQRFGNKCYDDMFI 412          
The following BLAST results are available for this feature:
BLAST of Bestrophin homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BEST39.254e-3728.26bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
BEST41.379e-3628.99bestrophin 4 [Source:HGNC Symbol;Acc:HGNC:17106][more]
BEST21.433e-3529.53bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST21.433e-3529.53bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
BEST21.433e-3529.53bestrophin 2 [Source:HGNC Symbol;Acc:HGNC:17107][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best-56.598e-3326.43Bestrophin homolog 5 [Source:UniProtKB/Swiss-Prot... [more]
best-38.933e-3325.33Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-131.534e-3126.46Bestrophin homolog 13 [Source:UniProtKB/Swiss-Pro... [more]
best-88.080e-3123.22Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
best-88.080e-3123.22Bestrophin homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best11.253e-4832.51gene:FBgn0040238 transcript:FBtr0082183[more]
Best11.596e-4832.51gene:FBgn0040238 transcript:FBtr0337020[more]
Best12.500e-4832.51gene:FBgn0040238 transcript:FBtr0114590[more]
Best12.752e-4832.51gene:FBgn0040238 transcript:FBtr0306023[more]
Best25.242e-4330.52gene:FBgn0035696 transcript:FBtr0077010[more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best26.869e-3528.76bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best18.512e-3528.65bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best44.218e-3427.78bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best42.009e-3327.57bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best15.177e-1730.99bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifitm31.087e-3529.82interferon induced transmembrane protein 3 [Source... [more]
cyp2b61.052e-3427.84cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
best11.704e-3429.24bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best12.095e-3429.24bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
best13.654e-3429.24bestrophin 1 [Source:NCBI gene;Acc:100302038][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Best23.666e-3529.86bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best23.666e-3529.86bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best23.666e-3529.86bestrophin 2 [Source:MGI Symbol;Acc:MGI:2387588][more]
Best14.968e-3528.53bestrophin 1 [Source:MGI Symbol;Acc:MGI:1346332][more]
Best37.005e-3527.72bestrophin 3 [Source:MGI Symbol;Acc:MGI:3580298][more]
back to top
BLAST of Bestrophin homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NFU0|BEST4_HUMAN6.622e-3628.99Bestrophin-4 OS=Homo sapiens OX=9606 GN=BEST4 PE=2... [more]
sp|Q8NFU1|BEST2_HUMAN6.880e-3529.53Bestrophin-2 OS=Homo sapiens OX=9606 GN=BEST2 PE=1... [more]
sp|Q8N1M1|BEST3_HUMAN1.831e-3428.26Bestrophin-3 OS=Homo sapiens OX=9606 GN=BEST3 PE=1... [more]
sp|Q8BGM5|BEST2_MOUSE2.149e-3429.86Bestrophin-2 OS=Mus musculus OX=10090 GN=Best2 PE=... [more]
sp|Q6H1V1|BEST3_MOUSE4.900e-3427.72Bestrophin-3 OS=Mus musculus OX=10090 GN=Best3 PE=... [more]
back to top
BLAST of Bestrophin homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GVI25.612e-8536.87Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FSL41.134e-8436.39Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FBA94.508e-8438.11Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267FRV17.463e-8438.77Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
A0A267GWW31.278e-8338.11Bestrophin homolog OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
best22.297e-3629.24bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
best13.003e-3629.82bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
best44.642e-3127.49bestrophin 4 [Source:ZFIN;Acc:ZDB-GENE-070912-6][more]
best11.571e-2828.95bestrophin-2 [Source:NCBI gene;Acc:103045999][more]
BEST37.106e-2034.71bestrophin 3 [Source:HGNC Symbol;Acc:HGNC:17105][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
best11.169e-3328.07bestrophin 1 [Source:ZFIN;Acc:ZDB-GENE-110411-214][more]
best25.592e-3326.30bestrophin 2 [Source:ZFIN;Acc:ZDB-GENE-090312-127][more]
back to top
BLAST of Bestrophin homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bestrophin homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BEST38.732e-4130.98bestrophin 3 [Source:NCBI gene;Acc:101172121][more]
best26.689e-3629.53bestrophin 2 [Source:NCBI gene;Acc:110015962][more]
best17.424e-3128.99bestrophin-2 [Source:NCBI gene;Acc:101167866][more]
back to top
BLAST of Bestrophin homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016298.10.000e+0100.00SMESG000016298.1[more]
SMESG000016290.13.044e-15756.90SMESG000016290.1[more]
SMESG000016290.11.167e-14756.60SMESG000016290.1[more]
SMESG000016290.19.734e-14556.41SMESG000016290.1[more]
SMESG000016291.11.663e-14152.74SMESG000016291.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000475 ID=SMED30000475|Name=Bestrophin homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1408bp
TGGAAATTATTGTGGGCGGATTTTCTGTGGTTTATTTGCTCATACATTGG
AATCACTTTACTTTACCGGTTGTATTTAATTCATGATCCAGTTAATAAAG
GCCGATTCGAATCAATTGTTACATACATGAACAAAGTTGCTGCTCTTGTT
CCATTATCTTTTCTCTTGGGTTTCTTTGTGTCAACAGTTCTCGGACGATG
GTGGGAAATTGTCATGTCGATTCCTTGGATGACAAAACCGGCATTCACGT
GTCAGGCTTTGATATGTGGAGGAGATCGAAACACCTGCAAAAATATTCGC
CTGACAATCGTTCGTTACATGAATCTAGCCTGGATTCTTTCTCTAATGAA
TCTCAGCCAAAAGGTGAAACTGCGGTTTCTGATTCCGATCACAGAAGGAA
AGAAAACGATAAAAATGAAAATGCTCAAACACGAGAAACCTAAACCTATA
ACGATCCGACAGAAAATGATGAAAATCAATTCCGATGTCTTAGTTAAGAA
ATTCTTTGGAACTCTCATTATGGAGGAAGAAATGAAAGTGTTTGAAAATT
TCGAGAAGCAATCGAAAAAACCGACTTACATCGTTCCATTAATGTGGGCA
ACTAAACTGATTGAAAAGTCTTATAAGGCTGGTTATATAGAATCGGAACG
AGTGTTTCTGCACATCTTTAACTTAGTACAGGAGTTCCGTGGAAGCCTGG
GAACGTTGTCAGTGTACAACGAATTCAATGTACCATTAGTGTACACACAG
GTGATCATAATTGTCGTTTACACCTTCCTGATCAGCGAGATATTCACCCA
ACAGCTCATTGACCACAACCTCATCCACAAGAAAACCCTCTACCAAAATT
CAACATTTATCAGCATCACCGCGGCATTGGACAATTATCTGCCTGTATTC
GGAATATTCAAATTTCTCATCTATATGGGCTGGTTCAAGGTTGGGCTGAG
TTTTATCAACCCCTTTGGCCGTGAACAGAGTGATTTACCATTGGATGAAA
TACTCGATTACAATCTCGAAGTTTCCGCTTCGGTTGCTCCAGGCGATGAT
TTGTATTTCCCGGAATATTTGTCTGACACTTTTGAAGACGGCAGTGGGGA
CCGGTTCAAGATTTTCGAGAGTTTCCGATCAGCATTGCCACGCTTGAACA
TGATCAGTGGAGGGAACGACAAAGCTGGGAACGAGAAAGCGGTCGAAATG
CAAATATTTAACTCGTCTGATGAAGCTGTTGATATCGAATCAAAGCCAAT
GATGGCGTGATGTTATCGAATTACTTTACGTCAAGGGTAAGGGTAGCCCT
TTGAAAAATTCACCCTTTTTTGTATTTGTTATTGACTATTGATGTTTTTT
ATGTATTGCATGCTATTAGCGCAATCGTATTGATTGGAATTTATGTTGTA
ATTCTTTA
back to top

protein sequence of SMED30000475-orf-1

>SMED30000475-orf-1 ID=SMED30000475-orf-1|Name=SMED30000475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
WKLLWADFLWFICSYIGITLLYRLYLIHDPVNKGRFESIVTYMNKVAALV
PLSFLLGFFVSTVLGRWWEIVMSIPWMTKPAFTCQALICGGDRNTCKNIR
LTIVRYMNLAWILSLMNLSQKVKLRFLIPITEGKKTIKMKMLKHEKPKPI
TIRQKMMKINSDVLVKKFFGTLIMEEEMKVFENFEKQSKKPTYIVPLMWA
TKLIEKSYKAGYIESERVFLHIFNLVQEFRGSLGTLSVYNEFNVPLVYTQ
VIIIVVYTFLISEIFTQQLIDHNLIHKKTLYQNSTFISITAALDNYLPVF
GIFKFLIYMGWFKVGLSFINPFGREQSDLPLDEILDYNLEVSASVAPGDD
LYFPEYLSDTFEDGSGDRFKIFESFRSALPRLNMISGGNDKAGNEKAVEM
QIFNSSDEAVDIESKPMMA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000615Bestrophin
IPR021134Bestrophin/UPF0187
Vocabulary: molecular function
TermDefinition
GO:0005254chloride channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034707chloride channel complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021134Bestrophin/UPF0187PFAMPF01062Bestrophincoord: 1..339
e-value: 1.6E-58
score: 198.5
IPR000615BestrophinPANTHERPTHR10736BESTROPHINcoord: 1..368
NoneNo IPR availableTMHMMTMhelixcoord: 246..265
NoneNo IPR availableTMHMMTMhelixcoord: 46..68
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 286..308