ATP-dependent RNA helicase DHX8

Overview
NameATP-dependent RNA helicase DHX8
Smed IDSMED30000473
Length (bp)3625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DHX8 (SMED30000473) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DHX8 (SMED30000473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase DHX8 (SMED30000473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DHX8 (SMED30000473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30000473h1SMcG0007920 SmedASXL_015487SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30000473h1SMcG0007920 dd_Smed_v4_8181_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 1203.73 bits (3113), Expect = 0.000e+0
Identity = 631/971 (64.98%), Postives = 778/971 (80.12%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK V+Q+TG+DL          E  ++   RNP++P     V + +++++ ++   ++++ R++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK+T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  262 PTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLE---RKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAE-MDSIPMG--LNKHWVDP----LPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1219          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 1203.73 bits (3113), Expect = 0.000e+0
Identity = 631/971 (64.98%), Postives = 778/971 (80.12%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK V+Q+TG+DL          E  ++   RNP++P     V + +++++ ++   ++++ R++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK+T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  262 PTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLE---RKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAE-MDSIPMG--LNKHWVDP----LPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1219          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 577/899 (64.18%), Postives = 713/899 (79.31%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPD 3355
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK V+Q+TG+DL          E  ++   RNP++P     V + +++++ ++   ++++ R++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK+T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+
Sbjct:  262 PTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLE---RKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAE-MDSIPMG--LNKHWVDP----LPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE 1147          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 359/651 (55.15%), Postives = 481/651 (73.89%), Query Frame = 2
Query: 1562 STQMLNK-SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLI-KNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK---FSDPTKLSQAKK 3496
            STQ   K SI   R+SLP+F  + ELL AI ++QVL++ GETGSGKTTQ+ QY+ E G   K  KIACTQPRRVAA SVA RVA+E G  LG EVGY+IRFED T+  T ++YMTDGMLLRE L +P+L  YSV+M+DEAHERT+HTD+LFGL+K  A  R +LK++V SAT+++ +FS +F G+P+FRIPGR F V++ Y+  P+ DYLEA + +V+ IH+T+PPGD+L+FLTGQEEI+  CE++ +R + LG    ELL+LP+Y+ +PSD Q+RIF P PP ARK+V+ATNIAETSLTI GI YV+DPGF KQK YN ++GM+ L VTP S+A A+QR GRAGR   GKC+RLYT  A++ E+    VPEIQRT++ + VL LK++GI+DL+ FDF+D PP +TL+ A+ +L+AL AL+  G LT  GRKMAE P++PML+KM++ S    CSEEILT+ +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S +S+ WCY+NF+Q RS++ A+DVR+QL G+++R  + + SC  +   ++KAI +G+F + AR   + GYRT+  QQ V IHP+S+LF +QP W+++HELVLTTKE+MR+V  I+S WL+E AP ++K     DP      KK
Sbjct:  383 STQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDGAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLT-RSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKK 1032          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 358/651 (54.99%), Postives = 480/651 (73.73%), Query Frame = 2
Query: 1562 STQMLNK-SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLI-KNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK---FSDPTKLSQAKK 3496
            STQ   K SI   R+SLP+F  + ELL AI ++QVL++ GETGSGKTTQ+ QY+ E G   K  KIACTQPRRVAA SVA RVA+E G  LG EVGY+IRFED T+  T ++YMTDGMLLRE L +P+L  YSV+M+DEAHERT+HTD+LFGL+K  A  R +LK++V SAT+++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYLEA + +V+ IH+T+PPGD+L+FLTGQEEI+  CE++ +R + LG    ELL+LP+Y+ +PSD Q+RIF P PP ARK+V+ATNIAETSLTI GI YV+DPGF KQK YN ++GM+ L VTP S+A A+QR GRAGR   GKC+RLYT  A++ E+    VPEIQRT++ + VL LK++GI+DL+ FDF+D PP +TL+ A+ +L+AL AL+  G LT  GRKMAE P++PML+KM++ S    CSEEILT+ +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S +S+ WCY+NF+Q RS++ A+DVR+QL G+++R  + + SC  +   ++KAI +G+F + AR   + GYRT+  QQ V IHP+S+LF +QP W+++HELVLTTKE+MR+V  I+S WL+E AP ++K     DP      KK
Sbjct:  383 STQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLT-RSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKK 1032          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: mog-5 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 [Source:UniProtKB/Swiss-Prot;Acc:Q09530])

HSP 1 Score: 1118.61 bits (2892), Expect = 0.000e+0
Identity = 595/974 (61.09%), Postives = 742/974 (76.18%), Query Frame = 2
Query:  722 ETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTYHXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---LEEFQQDKF----RNPEKPDVYSNQLDEEY--------IQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFN-AXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRI------NRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFH 3577
            E GKIY G V S++     + L  F    EG+VHIS +    V+ V DVL   + V  KV  IEN +I LSMK V+Q +G+DL     +   D      R P  P   S+ ++ E           +   +   R+++PERWELRQM+ AGVL  TD PD+ E+ GV+ N  D+   EDIEIE+VE++P FL+G       + PV++VKNPDGSL  AA+MQ AL K+R+ETK Q +    M    TQK  G   +  ++   + N  +        +RN K  ++PEW K+VT G  G+    +  N S++EQR+SLPIF LK  L++A+ DNQ+LVV+GETGSGKTTQMTQY  EAGL +  KI CTQPRRVAA SVAKRVA+E+GC LG +VGYTIRFED T+ +T IKYMTDGMLLRECL+DP+L+ YS+IMLDEAHERTIHTDVLFGLLK AA +R +LKLI+TSATL+SVKFSEYF  +PIF IPGRTF VE+LY+ EP+ DYLEA+  TVM IHLTEPPGD+L+FLTGQEEIDT CE++Y R+K++G D PEL+ILPVY A+PS+ Q+RIFDPAP   RK+VIATNIAETSLTI+GI+YV+DPGFVKQK+YN KSGMD L+VTPISQA A QR GRAGRTGPGKCYRLYTERAF++EMLP  VPEIQRTN+AST+L LKAMGIN+L+ FDFMDAPP  +++ A++ LH LSALD +GLLTKLGR+MAEFPLEP L+K+LIMSV LGCSEE+LTIV+ML+V+  FYRPK+K D ADQKKAKF+QPEGDH+TLLAV+N+WKN  FS PWC++NFIQ RS+K AQD+RKQLLGIMDR+ L + SCG++   +QKAI SGFFRNAA++DPQEGYRTL D Q V+IHPSSA F +QP+WV++HELV+TTKEYMREVT ID KWLVEFAP FFK  D TKLS  K++Q+I+PL++++ + ++WRI+R +K+ +
Sbjct:  232 EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTP--PASTSSWMNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYDDESDGEDIEIELVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMD---TQK--GFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAG--GKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRVKKRIY 1196          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: mog-4 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 [Source:UniProtKB/Swiss-Prot;Acc:O45244])

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 344/629 (54.69%), Postives = 473/629 (75.20%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKN-KKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEP-PGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
            SI E R+SLP++  ++  ++A+ ++QVL++ GETGSGKTTQ+ QY+ EAG  +  K+I CTQPRRVAA SVA RVA E GC LG +VGY+IRFED T+ +T +KYMTDGMLLRE L +P+L  YSV+M+DEAHERT+HTD+LFGL+K  A  R DLKL+++SATL++ KFS +F  +PIFRIPGR F V++ Y+  P+ DY++A++ T+M IHLT+P PGD+L+FLTGQEEI+T  E +  R KALG    EL+ LPVY+ +PSD Q++IF+P P +ARK+V+ATNIAETS+TI+GI YVIDPGF KQ  ++++SG++ L V  IS+A A+QR GRAGRTGPGKC+RLYT  A+K E+    +PEIQRTN+ + VL LK++GI+DL+ FDF+D PP +TLV A+ +L+AL AL+  G LTKLGR+MAEFP +P ++KM+I S    CSEEI+TI +MLS   A FYRPK +   AD  +  F  P GDHITL+ V+N W+ S FS  WC +N++Q R++K A+DVR QL+G+++R  ++ +S   +T  I+KAI +G+F N ++ D    Y+T+  +   H HP+S LF   P WV++ ELV T+KE+MRE++ I+S WL+E AP ++K
Sbjct:  356 SIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKS-STDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPRWVVYFELVFTSKEFMREMSEIESGWLLEVAPHYYK 983          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 338/651 (51.92%), Postives = 464/651 (71.27%), Query Frame = 2
Query: 1574 LNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGS-PIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHR--QPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPL 3517
            + KSI +QR+ LP+F  + +++  I +N V++++GETGSGKTTQ+ QY+ E G   +  I CTQPRRVAA SVA+RVA E G  LGQ+VGY IRFED T+ +T IKYMTDG+LLRECL D  L+QYS I++DEAHER+++TDVLFGLL++   +R DLKLIVTSAT+++ KF+++F G+ P F IPGRTF VE+ ++  P +DY++A++   + IHL    GD+L+F+ GQE+I+  CE+I  ++  L  + P L +LP+YS +PSD Q++IF  AP   RK ++ATNIAETSLT++GI +VIDPGF K KVYN + GMD L + P+SQA A+QR GRAGRTGPG+CYRLYTER FK+E+L + VPEIQRTN+A+ VL LK++G++DLL F FMDAPP   ++ +M +L  L ALD+ G LT +GRKM EFPL+P L+KMLIMS  +GCS+E+LTIVSMLSV   F+RPK + + AD KK KF  PE DH+T L V+  W+  K+S  WC DN++  ++LK  ++VR QL  IM    L + S G    +++K I S +F NAAR      Y  +       +HP+SALF     PD+V++HEL++T KEYM+ VT +D+ WL E  P F+   +     Q++K  ++E +
Sbjct:  430 MEKSIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGEL-DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFYSIKES---KQSRKELKMESV 1076          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 338/651 (51.92%), Postives = 464/651 (71.27%), Query Frame = 2
Query: 1574 LNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGS-PIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHR--QPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPL 3517
            + KSI +QR+ LP+F  + +++  I +N V++++GETGSGKTTQ+ QY+ E G   +  I CTQPRRVAA SVA+RVA E G  LGQ+VGY IRFED T+ +T IKYMTDG+LLRECL D  L+QYS I++DEAHER+++TDVLFGLL++   +R DLKLIVTSAT+++ KF+++F G+ P F IPGRTF VE+ ++  P +DY++A++   + IHL    GD+L+F+ GQE+I+  CE+I  ++  L  + P L +LP+YS +PSD Q++IF  AP   RK ++ATNIAETSLT++GI +VIDPGF K KVYN + GMD L + P+SQA A+QR GRAGRTGPG+CYRLYTER FK+E+L + VPEIQRTN+A+ VL LK++G++DLL F FMDAPP   ++ +M +L  L ALD+ G LT +GRKM EFPL+P L+KMLIMS  +GCS+E+LTIVSMLSV   F+RPK + + AD KK KF  PE DH+T L V+  W+  K+S  WC DN++  ++LK  ++VR QL  IM    L + S G    +++K I S +F NAAR      Y  +       +HP+SALF     PD+V++HEL++T KEYM+ VT +D+ WL E  P F+   +     Q++K  ++E +
Sbjct:  430 MEKSIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGEL-DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFYSIKES---KQSRKELKMESV 1076          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 318/648 (49.07%), Postives = 447/648 (68.98%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAE--------AGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEP-PGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPN------ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSC---GKNTGL-IQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSD 3469
            +I E+R  LP+++ K + ++ + +NQ + ++GETGSGKTTQ+ Q+  E            + + +ACTQPRRVAA SVA RVA+E   +LGQEVGY+IRFED  +  T +KY TDGMLLRE +  P L++Y V++LDEAHERT+ TD+L GL+K+    R D+K+++ SATL++ KF  YF   P+  +PGRTF VE+ ++   ++DYLEA++ TV+ IH+ E   GD+LLFLTGQEEI+  C+ I   I+ALG D   L  +P+YS +P   Q RIF+PAPPN      +RK VI+TNIAETSLTI+G+ +VIDPGF KQKVYN +  ++ L+V PIS+A A QR GRAGRT PGKC+RLYTE A+  EM     PEI R+N+ S VL LK +G  DL+ FDFMD P  +TL++A+  L+ L A++D+G LT+LG  MAEFPL+P LAKMLI S  L CS EIL+I +MLSV   + RP +    AD+ KA+F   +GDH+TLL V++++K ++    WCYDNFI  R++K A  VR QL  +MD+Y+L+  S     ++  L I+KA+V+GFF   A  +    Y T+ D Q+V++HPS+ L H+ P+W +++E VLTTK ++R VT +  +WL++ AP+++   +
Sbjct:   68 AIWEKRSQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTVLDHK-PEWALYNEFVLTTKNFIRTVTDVRPEWLLQIAPQYYDLDN 714          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: pea (gene:FBgn0086895 transcript:FBtr0087518)

HSP 1 Score: 1149.81 bits (2973), Expect = 0.000e+0
Identity = 616/960 (64.17%), Postives = 754/960 (78.54%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNL-CTYHXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL------LEEFQQDKFRNPEKPDVYSNQLDEEYIQVN--------TKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRI-NRNEKFSDVPEWKKYVTGGTGGR-GASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSW 3547
            PE GKIY G + ++    C V L       EG+VHIS L     V DV +V+     V  KVM+I   ++ LSMK V+Q +GKDL       E+ +  + RNP+ P  +S+      +Q N        +++++ R++SPERWE++QM ++GVL  ++ PD+ E+TG++   D++ E DIEIEIVEE+P FL G       LSPVRIVKNPDGSL  AAMMQSAL K+RRE K  ++  E  +  ++     K+W DP+ ++ + +  + +        +VPEWKK+V GG     G  T +   +++EQRQSLPI+KL+++L++A+ DNQ+L+VIGETGSGKTTQ+TQY+ E G     KI CTQPRRVAA SVAKRVA+E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL++ EL  YSVIMLDEAHERTIHTDVLFGLLK A  +R +LKLIVTSATL++VKFS+YFF +PIF IPGRTF VEVLY+ EP+ DYL+ASL TVM IHL EPPGD+LLFLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAP  +RK+VIATNIAETSLTI+GI+YV+DPGFVKQKVYNSK+GMD L+VTPISQA A QR GRAGRTGPGK YRLYTERA+++EMLP  VPEIQRTN+A+TVL LK MGINDLL FDFMDAPP ++LV A+ +LH+LSALDDEGLLT+LGR+MAEFPLEP L+KMLIMSV L CS+EILTIVSMLSV+  FYRPKDK   ADQKKAKFNQ EGDH+TLLAV+N+WKN+KFS  WCY+NF+Q R+LK +QDVRKQLLGIMDR+ L + S GKN+  IQKAI SGFFRNAA+KDPQEGYRTLVD QVV+IHPSSALF+RQP+WVI+HELV TTKEYMREVTTID KWLVEFAP FF+FSDPTKLS+ KK+Q++EPLYN++EE ++W
Sbjct:  282 PEAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDESLRDRNPDGP--FSSSTSMLNLQGNGMEGDEHESRKRVTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLL-PKDEDDEADIEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEIEAMPTS---LNKNWIDPLPEDESRSLAANMRGMAAAPPEVPEWKKHVIGGKKSSFGKKTDL---TLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAW 1232          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: l(2)37Cb (gene:FBgn0086444 transcript:FBtr0081163)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 352/625 (56.32%), Postives = 475/625 (76.00%), Query Frame = 2
Query: 1592 EQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKK-IACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
            E R+SLP++  K +L+ A+ ++QVL++ GETGSGKTTQ+ QY+ EAG  K+KK I CTQPRRVAA SVA RVA+E G  LG EVGY+IRFED T+  T +KYMTDG L RE L +P+L  YSV+++DEAHERT+HTD+LFGL+K  A  R +LKL+++SATL++ KFS +F  +PIFRIPGR + V++ Y+  P+ DY++A   +V+ IH T+P GD+L+FLTGQ+EI+TC E++++R+K LG    EL+++PVY+ +PSD Q++IF+P PPNARK+++ATNIAETSLTI+ I YVIDPGF KQ  +NS++GM+ L+V PIS+A A+QR GRAGRT PGKC+RLYT  A+K E+  N VPEIQR N+ + VL LKA+GINDL+ FDF+D PP +TLV A+ +L+AL AL+  G LTKLGR+MAEFP++PM+ KML+ S    CSEE++TI +MLSV  A FYRPKDK   AD  +  FN   GDH++LL V+N W  + +ST WCY+NFIQ RS+K A+DVR+QL+G+M R  + + SC   T  ++KA  +G+F + AR      Y+T+   Q V IHP+S+LF   P WV++HELV T+KEYMR+V  I+SKWL+E AP ++K
Sbjct:  247 ETRRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVEAGFTKDKKMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFRPELKLLISSATLDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVLQIHATQPLGDILVFLTGQDEIETCQEVLHDRVKRLGSKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAETSLTIDNIIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKIIHADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVEIDMVSCLPETVNVRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSLFEELPRWVLYHELVFTSKEYMRQVIEIESKWLLEVAPHYYK 871          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: l(1)G0007 (gene:FBgn0026713 transcript:FBtr0073900)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 378/846 (44.68%), Postives = 533/846 (63.00%), Query Frame = 2
Query: 1022 YSNQLDEEYIQVNTKR----KIQRMTSPERWELRQMENAGVLK-ITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTG-------KDWHDPVMKEFNNNTGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALF--HRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPL 3517
            Y  + +E+  Q  TKR    + Q     E WE  +M  +GV+  I+ + D+ E+            E + + +    P FL G+        PV  VK+P   +   A   SAL +  RE K++ K  ++  ++S  K+         +D  D  M+       +   +++KF+D           TGG+   ++   K+I EQR+ LP+F  + ELL  I +N V++++GETGSGKTTQ+TQY+ E G  K   I CTQPRRVAA SVAKRV+ E    LG++VGY IRFED T+  T IKYMTDG+LLRE L DPEL+ YS I++DEAHER++ TDVLFGLL++   +R DLKLIVTSAT++S KF+ +F   P F IPGRTF V+V++S    +DY+E+++   + +HLT   GDML+F+ GQE+I+  CE++  R+  +  + P L ILP+YS +PSD Q++IF  +    RK V+ATNIAETSLT++GI YVID G+ K KVYN + GMD L + PISQA A+QR GRAGRTGPG+ YRLYT+R +K+E+L   VPEIQRTN+A+TVL LK++G+ DLL F FMD PP   ++ ++ +L  L ALD  G LT LGR+MAEFPL+P   +MLI++  +GCS E+L IVSMLSV   FYRPK + D AD  + KF +PE DH+T L V+  W+ + +S+ WC ++FI  ++++  ++VR+QL  IM + +L + SCG +  +++K I S +F  AAR      Y  L      H+HP+SAL+     PD+V++HEL++T KEYM+  T +D  WL E  P FF   +  +  + KK Q  E L
Sbjct:  346 YFRKREEQLEQKRTKRISAQQRQNNRDNELWERNRMLTSGVVTLISVNDDFDEEA----------LERVHLLVHHIIPPFLDGRIVFTKQPEPVVPVKDPTSDMALLARKGSALVRNYREQKERRKAQKKHWELSGTKLGNIMGVQRPQDEDD--MRFDKEKDKADYRKDQKFAD-----HMRDQDTGGKSDFSR--KKTISEQRRFLPVFASRQELLNVIRENSVIIIVGETGSGKTTQLTQYLHEDGYSKRGMIGCTQPRRVAAMSVAKRVSDEMDTQLGEDVGYAIRFEDCTSERTVIKYMTDGILLRESLRDPELDSYSAIIMDEAHERSLSTDVLFGLLREIVARRHDLKLIVTSATMDSSKFATFFGNVPTFTIPGRTFPVDVMFSKNTCEDYVESAVKQALQVHLTPNEGDMLIFMPGQEDIEVTCEVLEERLAEI-DNAPALSILPIYSQLPSDLQAKIFQKSSDGLRKCVVATNIAETSLTVDGIIYVIDSGYCKLKVYNPRIGMDALQIYPISQANANQRSGRAGRTGPGQAYRLYTQRQYKDELLALTVPEIQRTNLANTVLLLKSLGVVDLLQFHFMDPPPQDNILNSLYQLWILGALDHTGALTTLGRQMAEFPLDPPQCQMLIVACRMGCSAEVLIIVSMLSVPSIFYRPKGREDEADGVREKFQRPESDHLTYLNVYQQWRQNNYSSTWCNEHFIHIKAMRKVREVRQQLKDIMTQQNLSVISCGIDWDIVRKCICSAYFYQAARLKGIGEYVNLRTGMPCHLHPTSALYGLGTTPDYVVYHELIMTAKEYMQCATAVDGYWLAELGPMFFSVKESGRSGREKKKQAAEHL 1171          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0336909)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 343/666 (51.50%), Postives = 475/666 (71.32%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKK-IACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEP-PGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPP-NA-----RKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGL-----IQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEK 3538
            +++ ++R +LP+F+ + + ++ ++ +Q +V++GETGSGKTTQ+ Q+  +  + K +K ++CTQPRRVAA SVA+RV++E    LG+EVGY+IRFED +T++T +KYMTDGMLLRE + DP L+QY VI+LDEAHERT+ TD+L G+LK+   QR DLKL+V SATL++ KF +YF  +P+ ++PGRT  VE+ Y+ EP++DYLEA++ TV+ IH+ E   GD+L+FLTGQEEI+  C+ I   I  LG +  EL  +P+YS +P + Q RIF+PAPP NA     RK+V++TNIAETSLTI+G+ +VIDPGF KQKVYN +  ++ L+V+PIS+A A QR GRAGRT PGKC+RLYTE+AFK EM  N  PEI R+N+ + VL LK +GI+DL+ FDFMD P  +TL++A+  L+ L+ALDD+G LT LG  M+EFPL+P LAKMLI S    CS EIL+I +MLSV   F RP +   AAD+ K +F   +GDH+TLL V++A+K S     WCY+NFI  RSLK A +VR+QL  IMDR++L+ R+  + T       I+KA+V GFF   A  +    Y T+ D Q V +HPS+ L H+ PDWVI++E VLTTK Y+R VT +  +WL   AP+++   D     Q +  +Q+E L  R E K
Sbjct:   63 QNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLR-RTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCLDHK-PDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYY---DLNNFPQCEAKRQLELLQQRLETK 723          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0088966)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 343/666 (51.50%), Postives = 475/666 (71.32%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKK-IACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEP-PGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPP-NA-----RKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGL-----IQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEK 3538
            +++ ++R +LP+F+ + + ++ ++ +Q +V++GETGSGKTTQ+ Q+  +  + K +K ++CTQPRRVAA SVA+RV++E    LG+EVGY+IRFED +T++T +KYMTDGMLLRE + DP L+QY VI+LDEAHERT+ TD+L G+LK+   QR DLKL+V SATL++ KF +YF  +P+ ++PGRT  VE+ Y+ EP++DYLEA++ TV+ IH+ E   GD+L+FLTGQEEI+  C+ I   I  LG +  EL  +P+YS +P + Q RIF+PAPP NA     RK+V++TNIAETSLTI+G+ +VIDPGF KQKVYN +  ++ L+V+PIS+A A QR GRAGRT PGKC+RLYTE+AFK EM  N  PEI R+N+ + VL LK +GI+DL+ FDFMD P  +TL++A+  L+ L+ALDD+G LT LG  M+EFPL+P LAKMLI S    CS EIL+I +MLSV   F RP +   AAD+ K +F   +GDH+TLL V++A+K S     WCY+NFI  RSLK A +VR+QL  IMDR++L+ R+  + T       I+KA+V GFF   A  +    Y T+ D Q V +HPS+ L H+ PDWVI++E VLTTK Y+R VT +  +WL   AP+++   D     Q +  +Q+E L  R E K
Sbjct:   63 QNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLR-RTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCLDHK-PDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYY---DLNNFPQCEAKRQLELLQQRLETK 723          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: AL833789.3 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:NCBI gene;Acc:606595])

HSP 1 Score: 1197.19 bits (3096), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 778/971 (80.12%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P    IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++   ++  LSMK V+Q TG+DL          E  ++   RNP++P      ++ +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SPV+IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQ+   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VEVLY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+QPEGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPT+LS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  199 PSVADIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVGGEGQEESAMRNPDRPTNLNLGHAPEVEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAE-MDSIPMG--LNKHWVDPL----PDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQL---SILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1156          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 1197.19 bits (3096), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 778/971 (80.12%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P    IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++   ++  LSMK V+Q TG+DL          E  ++   RNP++P      ++ +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SPV+IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQ+   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VEVLY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+QPEGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPT+LS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  252 PSVADIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVGGEGQEESAMRNPDRPTNLNLGHAPEVEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAE-MDSIPMG--LNKHWVDPL----PDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQL---SILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1209          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 1182.55 bits (3058), Expect = 0.000e+0
Identity = 628/999 (62.86%), Postives = 778/999 (77.88%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPG----------------------------DMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P    IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++   ++  LSMK V+Q TG+DL          E  ++   RNP++P      ++ +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SPV+IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQ+   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VEVLY+ EP+ DYL+ASL TVM IHLTEPPG                            D+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+QPEGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPT+LS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  252 PSVADIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVGGEGQEESAMRNPDRPTNLNLGHAPEVEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAE-MDSIPMG--LNKHWVDPL----PDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQL---SILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGKLSNTILQNKIIKFEKQFQLIKIINCAGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1237          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 365/630 (57.94%), Postives = 476/630 (75.56%), Query Frame = 2
Query: 1577 NKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNK-KIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
             +SI E R+SLPIF  + +LL AI D+Q+LV+ GETGSGKTTQ+ QY+ E G  K   KI CTQPRRVAA SVA RVAQE    LG EVGY+IRFED T+  T +KYMTDGMLLRE L +P+L  YSVI++DEAHERT+HTD+LFGL+K  A  R DLK++V SATL++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYLEA + +V+ IH+T+ PGD+L+FLTGQEEI+ CCE++  R + LG    ELL+LP+Y+ +PSD Q++IF+P PP ARK+V+ATNIAETSLTI+GI YVIDPGF KQK YN+K+GM+ LIVTP S+A A+QR GRAGR   GKC+RLYT  AFK EM    VPEIQRTN+ + VL LK++GINDL+ FDFMD PP +TLV A+ +L+AL AL+  G LTKLGR+MAE P++PML+KM++ S    CSEE+LTI +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S +ST WC++NFIQ RS+K A+DVR QL G+MDR  +++ S   ++  I+KA+ +G+F + AR   + GY+T+  QQ V++HP+S+LF  QP W+I+HELV TTKE+MR+V  I+S WL+E AP ++K
Sbjct:  402 KQSIQEVRRSLPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSMPIRKAVTAGYFYHTARLS-KGGYKTVKHQQTVYVHPNSSLFEEQPRWMIYHELVFTTKEFMRQVIEIESGWLLEVAPHYYK 1030          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 365/630 (57.94%), Postives = 476/630 (75.56%), Query Frame = 2
Query: 1577 NKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNK-KIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
             +SI E R+SLPIF  + +LL AI D+Q+LV+ GETGSGKTTQ+ QY+ E G  K   KI CTQPRRVAA SVA RVAQE    LG EVGY+IRFED T+  T +KYMTDGMLLRE L +P+L  YSVI++DEAHERT+HTD+LFGL+K  A  R DLK++V SATL++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYLEA + +V+ IH+T+ PGD+L+FLTGQEEI+ CCE++  R + LG    ELL+LP+Y+ +PSD Q++IF+P PP ARK+V+ATNIAETSLTI+GI YVIDPGF KQK YN+K+GM+ LIVTP S+A A+QR GRAGR   GKC+RLYT  AFK EM    VPEIQRTN+ + VL LK++GINDL+ FDFMD PP +TLV A+ +L+AL AL+  G LTKLGR+MAE P++PML+KM++ S    CSEE+LTI +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S +ST WC++NFIQ RS+K A+DVR QL G+MDR  +++ S   ++  I+KA+ +G+F + AR   + GY+T+  QQ V++HP+S+LF  QP W+I+HELV TTKE+MR+V  I+S WL+E AP ++K
Sbjct:  402 KQSIQEVRRSLPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSMPIRKAVTAGYFYHTARLS-KGGYKTVKHQQTVYVHPNSSLFEEQPRWMIYHELVFTTKEFMRQVIEIESGWLLEVAPHYYK 1030          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 1199.11 bits (3101), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 777/971 (80.02%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK VNQ TG+DL          +  ++   RNP++P     V + +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQM   SI+EQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  223 PAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGCKTSLSMKDVNQDTGEDLNPNRRRNLIGDSNEEASMRNPDRPSHLSLVNAPEIEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERREMKQAQREAE-MDSIPMG--LNKHWVDPL----PDADGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1180          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 1198.34 bits (3099), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 777/971 (80.02%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK VNQ TG+DL          +  ++   RNP++P     V + +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQM   SI+EQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  255 PAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGCKTSLSMKDVNQDTGEDLNPNRRRNLIGDSNEEASMRNPDRPSHLSLVNAPEIEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERREMKQAQREAE-MDSIPMG--LNKHWVDPL----PDADGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1212          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 776/971 (79.92%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK VNQ TG+DL          +  ++   RNP++P     V + +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SI+EQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  239 PAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGCKTSLSMKDVNQDTGEDLNPNRRRNLIGDSNEEASMRNPDRPSHLSLVNAPEIEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERREMKQAQREAE-MDSIPMG--LNKHWVDP----LPDADGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1196          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 777/971 (80.02%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK VNQ TG+DL          +  ++   RNP++P     V + +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQM   SI+EQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  202 PAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGCKTSLSMKDVNQDTGEDLNPNRRRNLIGDSNEEASMRNPDRPSHLSLVNAPEIEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERREMKQAQREAE-MDSIPMG--LNKHWVDPL----PDADGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1159          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 1083.94 bits (2802), Expect = 0.000e+0
Identity = 521/690 (75.51%), Postives = 613/690 (88.84%), Query Frame = 2
Query: 1505 SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            +D+PEWKK+  GG     G  TQM   SI+EQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRP  K    DQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:    9 NDIPEWKKHAFGGNKASYGKKTQM---SIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRP--KVRIPDQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 693          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 631/971 (64.98%), Postives = 778/971 (80.12%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK V+Q+TG+DL          E  ++   RNP++P     V + +++++ ++   ++++ R++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK+T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  286 PAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLE---RKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAE-MDSIPMG--LNKHWVDP----LPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1243          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 1180.62 bits (3053), Expect = 0.000e+0
Identity = 622/955 (65.13%), Postives = 764/955 (80.00%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYN 3523
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK V+Q+TG+DL          E  ++   RNP++P     V + +++++ ++   ++++ R++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK+T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYN
Sbjct:  233 PAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLE---RKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAE-MDSIPMG--LNKHWVDP----LPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYN 1174          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:MGI Symbol;Acc:MGI:1916442])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 356/645 (55.19%), Postives = 477/645 (73.95%), Query Frame = 2
Query: 1577 NKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNK-KIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK---FSDPTKLSQAKK 3496
             +SI   R+SLP+F  + ELL AI ++QVL++ GETGSGKTTQ+ QY+ E G  K   KIACTQPRRVAA SVA RVA+E G  LG EVGY+IRFED T+  T ++YMTDGMLLRE L +P+L  YSV+M+DEAHERT+HTD+LFGL+K  A  R +LK++V SATL++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYLEA + +V+ IH+T+PPGD+L+FLTGQEEI+  CE++ +R + LG    ELL+LP+Y+ +PSD Q+RIF P PP ARK+V+ATNIAETSLTI GI YV+DPGF KQK YN ++GM+ L VTP S+A A+QR GRAGR   GKC+RLYT  A++ E+    VPEIQRT++ + VL LK++GI+DL+ FDF+D PP +TL+ A+ +L+AL AL+  G LT  GRKMAE P++PML+KM++ S    CSEEILT+ +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S +S+ WCY+NF+Q RS++ A+DVR+QL G+++R  + + SC  +   ++KAI SG+F + AR   + GYRT+  QQ V IHP+S+LF +QP W+++HELVLTTKE+MR+V  I+S WL+E AP ++K     DP      KK
Sbjct:  392 KESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGDYVRVRKAITSGYFYHTARLT-RSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKK 1035          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx38 (DEAH (Asp-Glu-Ala-His) box polypeptide 38 [Source:MGI Symbol;Acc:MGI:1927617])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 337/644 (52.33%), Postives = 461/644 (71.58%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALF--HRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQ 3505
            KSILEQRQ LPIF ++ ELL  I DN +++V+GETGSGKTTQ+TQY+ E G      I CTQPRRVAA SVAKRV++E G  LG+EVGY IRFED T+  T IKYMTDG+LLRE L + +L+ YS +++DEAHER+++TDVLFGLL++   +R DLKLIVTSAT+++ KF+ +F   PIF IPGRTF V++L+S  PQ+DY+EA++   + +HL+  PGD+L+F+ GQE+I+   + I   ++ L ++ P L +LP+YS +PSD Q++IF  AP   RK ++ATNIAETSLT++GI +VID G+ K KV+N + GMD L + PISQA A+QR GRAGRTGPG+C+RLYT+ A+K E+L   VPEIQRTN+A+ VL LK++G+ DLL F FMD PP   ++ +M +L  L ALD+ G LT  GR M EFPL+P L+KMLI+S  +GCS EIL IVSMLSV   FYRPK + + +DQ + KF  PE DH+T L V+  WKN+ +ST WC D+FI A++++  ++VR QL  IM +  + + SCG +  +++K I + +F  AA+      Y  +      H+HP+S+LF     PD++++HELV+TTKEYM+ VT +D +WL E  P F+       + QA KS+Q
Sbjct:  524 KSILEQRQYLPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSEEMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAVIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFY------SVKQAGKSRQ 1160          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx15 (DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:MGI Symbol;Acc:MGI:1099786])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 338/666 (50.75%), Postives = 464/666 (69.67%), Query Frame = 2
Query: 1586 ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAE--AGLIKNKK-IACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPP-GDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPN------ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTG----LIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKD 3541
            IL++R  LP+++ K+     +  +Q  V++GETGSGKTTQ+ Q+  E    L   K+ +ACTQPRRVAA SVA+RVA E   +LGQEVGY+IRFED ++++T +KYMTDGMLLRE + DP L +Y VI+LDEAHERT+ TD+L G+LK+   QR DLK+IV SATL++ KF  YF   P+  IPGRT  VE+ Y+ EP++DYLEA++ TV+ IH+ E   GD+LLFLTGQEEID  C+ I   +  LG +  ++ I+P+YS +P   Q RIF+P PP        RK+V++TNIAETSLTI+G+ +VIDPGF KQKVYN +  ++ L+VT IS+A A QR GRAGRT PGKC+RLYTE+A+K EM  N  PEI R+N+ S VL LK +GI+DL+ FDFMD P  +TL++A+  L+ L+AL+D+G LT+LG  MAEFPL+P LAKM+I S    CS E+L+I +MLSV   F RP +   AAD+ K +F   +GDH+TLL V++A+K +  S  WCYDNFI  RSL  A +VR+QL  IMDR++L  RS    +      I+KA+V+G+F   A  +    Y T+ D QVV +HPS+ L H+ P+WV+++E VLTTK Y+R  T I  +WLV+ AP+++  S+     Q +  +Q++ +  + + K+
Sbjct:  130 ILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHK-PEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSN---FPQCEAKRQLDRIIAKLQSKE 791          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|Q14562|DHX8_HUMAN (ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1)

HSP 1 Score: 1203.73 bits (3113), Expect = 0.000e+0
Identity = 631/971 (64.98%), Postives = 778/971 (80.12%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK V+Q+TG+DL          E  ++   RNP++P     V + +++++ ++   ++++ R++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK+T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  262 PTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLE---RKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAE-MDSIPMG--LNKHWVDP----LPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1219          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|A2A4P0|DHX8_MOUSE (ATP-dependent RNA helicase DHX8 OS=Mus musculus OX=10090 GN=Dhx8 PE=2 SV=1)

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 631/971 (64.98%), Postives = 778/971 (80.12%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++    +  LSMK V+Q+TG+DL          E  ++   RNP++P     V + +++++ ++   ++++ R++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SP++IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP      +  G +I  N +      +D+PEWKK+  GG     G  TQM   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+Q EGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK+T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPTKLS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  286 PAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLE---RKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAE-MDSIPMG--LNKHWVDP----LPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQM---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1243          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|A1Z9L3|DHX8_DROME (ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1)

HSP 1 Score: 1149.81 bits (2973), Expect = 0.000e+0
Identity = 616/960 (64.17%), Postives = 754/960 (78.54%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNL-CTYHXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL------LEEFQQDKFRNPEKPDVYSNQLDEEYIQVN--------TKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRI-NRNEKFSDVPEWKKYVTGGTGGR-GASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSW 3547
            PE GKIY G + ++    C V L       EG+VHIS L     V DV +V+     V  KVM+I   ++ LSMK V+Q +GKDL       E+ +  + RNP+ P  +S+      +Q N        +++++ R++SPERWE++QM ++GVL  ++ PD+ E+TG++   D++ E DIEIEIVEE+P FL G       LSPVRIVKNPDGSL  AAMMQSAL K+RRE K  ++  E  +  ++     K+W DP+ ++ + +  + +        +VPEWKK+V GG     G  T +   +++EQRQSLPI+KL+++L++A+ DNQ+L+VIGETGSGKTTQ+TQY+ E G     KI CTQPRRVAA SVAKRVA+E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL++ EL  YSVIMLDEAHERTIHTDVLFGLLK A  +R +LKLIVTSATL++VKFS+YFF +PIF IPGRTF VEVLY+ EP+ DYL+ASL TVM IHL EPPGD+LLFLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAP  +RK+VIATNIAETSLTI+GI+YV+DPGFVKQKVYNSK+GMD L+VTPISQA A QR GRAGRTGPGK YRLYTERA+++EMLP  VPEIQRTN+A+TVL LK MGINDLL FDFMDAPP ++LV A+ +LH+LSALDDEGLLT+LGR+MAEFPLEP L+KMLIMSV L CS+EILTIVSMLSV+  FYRPKDK   ADQKKAKFNQ EGDH+TLLAV+N+WKN+KFS  WCY+NF+Q R+LK +QDVRKQLLGIMDR+ L + S GKN+  IQKAI SGFFRNAA+KDPQEGYRTLVD QVV+IHPSSALF+RQP+WVI+HELV TTKEYMREVTTID KWLVEFAP FF+FSDPTKLS+ KK+Q++EPLYN++EE ++W
Sbjct:  282 PEAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDESLRDRNPDGP--FSSSTSMLNLQGNGMEGDEHESRKRVTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLL-PKDEDDEADIEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEIEAMPTS---LNKNWIDPLPEDESRSLAANMRGMAAAPPEVPEWKKHVIGGKKSSFGKKTDL---TLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAW 1232          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|Q09530|MOG5_CAEEL (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1)

HSP 1 Score: 1118.61 bits (2892), Expect = 0.000e+0
Identity = 595/974 (61.09%), Postives = 742/974 (76.18%), Query Frame = 2
Query:  722 ETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTYHXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---LEEFQQDKF----RNPEKPDVYSNQLDEEY--------IQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFN-AXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRI------NRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFH 3577
            E GKIY G V S++     + L  F    EG+VHIS +    V+ V DVL   + V  KV  IEN +I LSMK V+Q +G+DL     +   D      R P  P   S+ ++ E           +   +   R+++PERWELRQM+ AGVL  TD PD+ E+ GV+ N  D+   EDIEIE+VE++P FL+G       + PV++VKNPDGSL  AA+MQ AL K+R+ETK Q +    M    TQK  G   +  ++   + N  +        +RN K  ++PEW K+VT G  G+    +  N S++EQR+SLPIF LK  L++A+ DNQ+LVV+GETGSGKTTQMTQY  EAGL +  KI CTQPRRVAA SVAKRVA+E+GC LG +VGYTIRFED T+ +T IKYMTDGMLLRECL+DP+L+ YS+IMLDEAHERTIHTDVLFGLLK AA +R +LKLI+TSATL+SVKFSEYF  +PIF IPGRTF VE+LY+ EP+ DYLEA+  TVM IHLTEPPGD+L+FLTGQEEIDT CE++Y R+K++G D PEL+ILPVY A+PS+ Q+RIFDPAP   RK+VIATNIAETSLTI+GI+YV+DPGFVKQK+YN KSGMD L+VTPISQA A QR GRAGRTGPGKCYRLYTERAF++EMLP  VPEIQRTN+AST+L LKAMGIN+L+ FDFMDAPP  +++ A++ LH LSALD +GLLTKLGR+MAEFPLEP L+K+LIMSV LGCSEE+LTIV+ML+V+  FYRPK+K D ADQKKAKF+QPEGDH+TLLAV+N+WKN  FS PWC++NFIQ RS+K AQD+RKQLLGIMDR+ L + SCG++   +QKAI SGFFRNAA++DPQEGYRTL D Q V+IHPSSA F +QP+WV++HELV+TTKEYMREVT ID KWLVEFAP FFK  D TKLS  K++Q+I+PL++++ + ++WRI+R +K+ +
Sbjct:  232 EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTP--PASTSSWMNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYDDESDGEDIEIELVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMD---TQK--GFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAG--GKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRVKKRIY 1196          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|Q38953|DEAH5_ARATH (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana OX=3702 GN=At3g26560 PE=1 SV=2)

HSP 1 Score: 1070.07 bits (2766), Expect = 0.000e+0
Identity = 569/966 (58.90%), Postives = 719/966 (74.43%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTYHXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDLLE----EFQQDKFR-NPE---------KPDVYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKV---STQKVTGKDWHDPVMKEFNNNTGSRINRNEKFS--DVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISR 3559
            PE  ++YKG VT +    C V   +F G  EG+VH+S + T  V   K+ +    +VY KV++I +++  LSM+ V+Q TG+DL+       + D  R NP          K  +   ++ EE     ++R +++M+SPERWE +Q+  +GVL++ + P Y ED   M   ++ +EE++EIE+ E++PAFL+GQ    + +SPV+I KNP+GSL  AA +QSAL K+RRE      M EQ  +    S  K   + W DP M E      ++  R    S  D+PEWKK   G T   G  +++   SI EQR+SLPI+KLK EL+QA++DNQVLVVIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRVA+EFGC LG+EVGY IRFED T  +T IKYMTDGMLLRE L+D  L+QYSVIMLDEAHERTIHTDVLFGLLKK   +R DL+LIVTSATL++ KFS YFF   IF IPGRTF VE+LY+ +P+ DYL+A+L TV+ IHLTEP GD+L+FLTGQEEID+ C+ +Y R+K LG++ PEL+ILPVYSA+PS+ QSRIFDP PP  RK+V+ATNIAE SLTI+GIYYV+DPGF KQ VYN K G++ L++TPISQA A QR GRAGRTGPGKCYRLYTE A++ EM P ++PEIQR N+  T L +KAMGINDLL+FDFMD P  Q L+ AM +L++L ALD+EGLLTKLGRKMAEFPLEP L+KML+ SV LGCS+EILT+++M+     FYRP++K   ADQK+AKF QPEGDH+TLLAV+ AWK   FS PWC++NFIQ+RSL+ AQDVRKQLL IMD+Y L + + GKN   I+KAI +GFF + ARKDPQEGYRTLV+ Q V+IHPSSALF RQPDWVI+H+LV+TTKEYMREVT ID KWLVE AP+FFK SDPTK+S+ K+ ++IEPLY+R+ E +SWR+S+
Sbjct:  211 PELYQVYKGRVTRVMDAGCFVQFDKFRGK-EGLVHVSQMATRRVDKAKEFVKRDMEVYVKVISISSDKYSLSMRDVDQNTGRDLIPLRKPSDEDDSSRSNPSYRTKDGQVTKTGISGIRIVEENDVAPSRRPLKKMSSPERWEAKQLIASGVLRVDEFPMYDEDGDGMLYQEEGAEEELEIEMNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALTKERRE------MREQQQRTMLDSIPKDLNRPWEDP-MPETGERHLAQELRGVGLSAYDMPEWKKDAFGKTPTFGQRSKL---SIQEQRESLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKKLMKRRLDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDAALITVLQIHLTEPEGDILVFLTGQEEIDSACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPPPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPPTSIPEIQRINLGMTTLTMKAMGINDLLSFDFMDPPQPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDEILTMIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFIQSRSLRRAQDVRKQLLSIMDKYKLDVVTAGKNFTKIRKAITAGFFFHGARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHDLVMTTKEYMREVTVIDPKWLVELAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSWRLSK 1165          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A4S2LBH4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008385 PE=4 SV=1)

HSP 1 Score: 1301.96 bits (3368), Expect = 0.000e+0
Identity = 686/996 (68.88%), Postives = 806/996 (80.92%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL-----------------------LEEFQQDKFRNPEKPDVY----------SNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMS-KVSTQKVTGKDWHDPVMKEFNNN---TGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF 3592
            P  G IY G VT++     +V L       EG+VHIS L     V +V DV+    KVY KV++    R  LSMK VNQ+TG+DL                       ++E   D  RNP++PD               + EE +    KRK+QR++SPERWEL+QM +AGV++ T+ PD+ E+TG++   D+ES+ED+EIE+VEE+P FLKG     + LSPVRIVKNPDGSLQ AAMM+ ALQK+RRE KQQE+ ++ M+ + +  +  GKDWHDP+    +      G+R   +E+F DVPEWK+ V GGT   GA  + + +SILEQRQSLPIFKLK+ELL A+NDN+VL+VIGETGSGKTTQ+TQY+AEAG     +I CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T  ETKIKYMTDGMLLRECL+DP+L QYSVIMLDEAHERTIHTDVLFGLLKKA  +RDD+KLIVTSATL+SVKFS+YFF +PIF IPGRT+ VE+LYS+EP+ DYL+A+LNTVM IHLTEPPGD+L+FLTGQEEID+ CEI+Y R+KALG D PEL+ILPVY+A+PS+ QSRIFDPAPP +RK+VIATNIAETSLTI+GIYYVIDPGFVKQKVY+SKSGMDQLIVTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL LKAMGINDLL+FDFMD PP QTLV AM  LH LSALDDEGLLT+LGR+MAEFPLEPML+KMLIMSVHL CSEE+LTIVSMLSV+  FYRPK+K + ADQ+KAKF+QPEGDH+TLLAV+NAWKN+KFS PWCYDNFIQAR+LK AQDVRKQLLGIMDR+ L + SCGK T L QKAI+SGFFRNAA+KDPQEGYRTLVDQQVV+IHPSSALF+RQPDWV++HELV+TTKEYMREVTTID +WLVEFAP FFKF DPTKLS+AKKS +IEPLY++FEEKDSWRISRA +KFHVKVTF
Sbjct:  344 PVVGTIYTGRVTNILAFGAVVQLDALRKRWEGLVHISQLRQEGRVANVSDVVQRMQKVYVKVLSFTGTRTSLSMKEVNQETGEDLNPRGRGKSPSGHQTDPAKGKMRNVDEVDMDGVRNPDRPDTGLSASTLLLRPRKDVMEEDLDSGPKRKVQRISSPERWELKQMMSAGVIEKTELPDFDEETGLLPREDEESDEDMEIELVEEEPPFLKGHGRHAMDLSPVRIVKNPDGSLQQAAMMRQALQKERREMKQQERQSQMMAEREAAPERMGKDWHDPMGASLDAKPQFGGTR--SSEQFKDVPEWKRAVQGGTRT-GAVGKKIVRSILEQRQSLPIFKLKDELLHAVNDNKVLIVIGETGSGKTTQITQYLAEAGFTNTGRIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTAPETKIKYMTDGMLLRECLIDPDLRQYSVIMLDEAHERTIHTDVLFGLLKKAIQKRDDMKLIVTSATLDSVKFSQYFFEAPIFTIPGRTYPVEILYSLEPENDYLDAALNTVMQIHLTEPPGDILVFLTGQEEIDSGCEILYERMKALGSDVPELIILPVYAALPSEMQSRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVIDPGFVKQKVYSSKSGMDQLIVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLATNVPEIQRTNLASTVLQLKAMGINDLLSFDFMDPPPLQTLVAAMETLHGLSALDDEGLLTRLGRRMAEFPLEPMLSKMLIMSVHLQCSEEVLTIVSMLSVQNVFYRPKEKTELADQRKAKFHQPEGDHLTLLAVYNAWKNNKFSAPWCYDNFIQARTLKRAQDVRKQLLGIMDRHKLDVVSCGKKTALAQKAILSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPDWVVYHELVMTTKEYMREVTTIDPRWLVEFAPNFFKFGDPTKLSRAKKSMRIEPLYSKFEEKDSWRISRAPRKFHVKVTF 1336          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: G7YW23 (ATP-dependent RNA helicase DHX8/PRP22 OS=Clonorchis sinensis OX=79923 GN=CLF_112251 PE=4 SV=1)

HSP 1 Score: 1300.42 bits (3364), Expect = 0.000e+0
Identity = 686/996 (68.88%), Postives = 809/996 (81.22%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL-----------------------LEEFQQDKFRNPEKPD--------VYSNQLD--EEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMS-KVSTQKVTGKDWHDPVMKEFNNN---TGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF 3592
            P  G IY G VT++     +V L       EG+VHIS +     V +V DV+    KVY KV++    R  LSMK VNQ+TG+DL                       ++E   D  RNP++PD        ++  + D  EE +    KRK+QR++SPERWEL+QM +AGV++ T+ PD+ E+TG++   D+ES+ED+EIE+VEE+P FLKG     + LSPVRIVKNPDGSLQ AAMM+ ALQK+RRE KQQE+ ++ M+ + +  +  GKDWHDP+    +      G+R   +E+F DVPEWK+ V GGT   GA  + + +SILEQRQSLPIFKLK+ELL A+NDN+VL+VIGETGSGKTTQ+TQY+AEAG     +I CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T  ETKIKYMTDGMLLRECL+DP+L QYSVIMLDEAHERTIHTDVLFGLLKKA  +RDD+KLIVTSATL+SVKFS+YFF +PIF IPGRT+ VE+LYS+EP+ DYL+A+LNTVM IHLTEPPGD+L+FLTGQEEID+ CEI+Y R+KALG D PEL+ILPVY+A+PS+ QSRIFDPAPP +RK+VIATNIAETSLTI+GIYYVIDPGFVKQKVY+SKSGMDQLIVTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL LKAMGINDLL+FDFMD PP QTLV AM  LH LSALDDEGLLT+LGR+MAEFPLEPML+KMLIMSVHL CSEE+LTIVSMLSV+  FYRPK+K + ADQ+KAKF+QPEGDH+TLLAV+NAWKN+KFS PWCYDNFIQAR+LK AQDVRKQLLGIMDR+ L + SCGK T L QKAI+SGFFRNAA+KDPQEGYRTLVDQQVV+IHPSSALF+RQPDWV++HELV+TTKEYMREVTTID +WLVEFAP FFKF DPTKLS+AKKS +IEPLY++FEEKDSWRISRA +KFHVKVTF
Sbjct:  154 PVVGTIYTGRVTNILAFGAVVQLDGLRKRWEGLVHISQIRQEGRVANVSDVVQRMQKVYVKVLSFTGTRTSLSMKEVNQETGEDLNPRGRGKSPSSHQTDPAKGKMRNVDEVDMDGVRNPDRPDAGLSASTLLFRPRKDVMEEDLDSGPKRKVQRISSPERWELKQMMSAGVIEKTELPDFDEETGLLPRDDEESDEDMEIELVEEEPPFLKGHGRHAMDLSPVRIVKNPDGSLQQAAMMRQALQKERREMKQQERQSQMMAEREAAPERMGKDWHDPMGASLDTKPQFGGTR--SSEQFKDVPEWKRAVQGGTRT-GAVGKKIVRSILEQRQSLPIFKLKDELLHAVNDNKVLIVIGETGSGKTTQITQYLAEAGFTNTGRIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTAPETKIKYMTDGMLLRECLIDPDLRQYSVIMLDEAHERTIHTDVLFGLLKKAIQKRDDMKLIVTSATLDSVKFSQYFFEAPIFTIPGRTYPVEILYSLEPENDYLDAALNTVMQIHLTEPPGDILVFLTGQEEIDSGCEILYERMKALGSDVPELIILPVYAALPSEMQSRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVIDPGFVKQKVYSSKSGMDQLIVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLATNVPEIQRTNLASTVLQLKAMGINDLLSFDFMDPPPLQTLVAAMETLHGLSALDDEGLLTRLGRRMAEFPLEPMLSKMLIMSVHLQCSEEVLTIVSMLSVQNVFYRPKEKTELADQRKAKFHQPEGDHLTLLAVYNAWKNNKFSAPWCYDNFIQARTLKRAQDVRKQLLGIMDRHKLDVVSCGKKTALAQKAILSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPDWVVYHELVMTTKEYMREVTTIDPRWLVEFAPNFFKFGDPTKLSRAKKSMRIEPLYSKFEEKDSWRISRAPRKFHVKVTF 1146          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A3R7EZH9 (ATP-dependent RNA helicase DHX8 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Dhx8 PE=4 SV=1)

HSP 1 Score: 1292.72 bits (3344), Expect = 0.000e+0
Identity = 683/993 (68.78%), Postives = 806/993 (81.17%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL-----------------------LEEFQQDKFRNPEKPD--------VYSNQLD--EEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMS-KVSTQKVTGKDWHDPVMKEFNNN---TGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVK 3583
            P  G IY G VT++     +V L       EG+VHIS +     V +V DV+    KVY KV++    R  LSMK VNQ+TG+DL                       ++E   D  RNP++PD        ++  + D  EE +    KRK+QR++SPERWEL+QM +AGV++ T+ PD+ E+TG++   D+ES+ED+EIE+VEE+P FLKG     + LSPVRIVKNPDGSLQ AAMM+ ALQK+RRE KQQE+ ++ M+ + +  +  GKDWHDP+    +      G+R   +E+F DVPEWK+ V GGT   GA  + + +SILEQRQSLPIFKLK+ELL A+NDN+VL+VIGETGSGKTTQ+TQY+AEAG     +I CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T  ETKIKYMTDGMLLRECL+DP+L QYSVIMLDEAHERTIHTDVLFGLLKKA  +RDD+KLIVTSATL+SVKFS+YFF +PIF IPGRT+ VE+LYS+EP+ DYL+A+LNTVM IHLTEPPGD+L+FLTGQEEID+ CEI+Y R+KALG D PEL+ILPVY+A+PS+ QSRIFDPAPP +RK+VIATNIAETSLTI+GIYYVIDPGFVKQKVY+SKSGMDQLIVTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL LKAMGINDLL+FDFMD PP QTLV AM  LH LSALDDEGLLT+LGR+MAEFPLEPML+KMLIMSVHL CSEE+LTIVSMLSV+  FYRPK+K + ADQ+KAKF+QPEGDH+TLLAV+NAWKN+KFS PWCYDNFIQAR+LK AQDVRKQLLGIMDR+ L + SCGK T L QKAI+SGFFRNAA+KDPQEGYRTLVDQQVV+IHPSSALF+RQPDWV++HELV+TTKEYMREVTTID +WLVEFAP FFKF DPTKLS+AKKS +IEPLY++FEEKDSWRISRA +KFHVK
Sbjct:  344 PVVGTIYTGRVTNILAFGAVVQLDGLRKRWEGLVHISQIRQEGRVANVSDVVQRMQKVYVKVLSFTGTRTSLSMKEVNQETGEDLNPRGRGKSPSSHQTDPAKGKMRNVDEVDMDGVRNPDRPDAGLSASTLLFRPRKDVMEEDLDSGPKRKVQRISSPERWELKQMMSAGVIEKTELPDFDEETGLLPREDEESDEDMEIELVEEEPPFLKGHGRHAMDLSPVRIVKNPDGSLQQAAMMRQALQKERREMKQQERQSQMMAEREAAPERMGKDWHDPMGASLDTKPQFGGTR--SSEQFKDVPEWKRAVQGGTRT-GAVGKKIVRSILEQRQSLPIFKLKDELLHAVNDNKVLIVIGETGSGKTTQITQYLAEAGFTNTGRIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTAPETKIKYMTDGMLLRECLIDPDLRQYSVIMLDEAHERTIHTDVLFGLLKKAIQKRDDMKLIVTSATLDSVKFSQYFFEAPIFTIPGRTYPVEILYSLEPENDYLDAALNTVMQIHLTEPPGDILVFLTGQEEIDSGCEILYERMKALGSDVPELIILPVYAALPSEMQSRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVIDPGFVKQKVYSSKSGMDQLIVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLATNVPEIQRTNLASTVLQLKAMGINDLLSFDFMDPPPLQTLVAAMETLHGLSALDDEGLLTRLGRRMAEFPLEPMLSKMLIMSVHLQCSEEVLTIVSMLSVQNVFYRPKEKTELADQRKAKFHQPEGDHLTLLAVYNAWKNNKFSAPWCYDNFIQARTLKRAQDVRKQLLGIMDRHKLDVVSCGKKTALAQKAILSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPDWVVYHELVMTTKEYMREVTTIDPRWLVEFAPNFFKFGDPTKLSRAKKSMRIEPLYSKFEEKDSWRISRAPRKFHVK 1333          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A4E0R3M3 (Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Fasciola hepatica OX=6192 GN=D915_007081 PE=4 SV=1)

HSP 1 Score: 1289.63 bits (3336), Expect = 0.000e+0
Identity = 676/1000 (67.60%), Postives = 813/1000 (81.30%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL--------------------LEEFQQDKFRNPEKPDVYS-----------------NQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMS-KVSTQKVTGKDWHDPVMKEFNNNT---GSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF 3592
            P  G+IY+G V+++     +V +       EG+VHIS L     V +V DV+    KVY KV+     R  LSM+ VNQ+TG+DL                    +++   D  RNP++P   S                 + +DE+ ++   KRK+QR++SPERWEL+QM +AGV++ TD PD+ E+TG++   D+ES+EDIEIE+VEE+P FLKG     + LSPVRIVKNPDGSLQ AAMM+ ALQK+RRE KQQE+ ++ M+ + +  +  GKDWHDP+    ++ T   GSR+N  E+F DVPEWK+ V GGT   GA  + + +S+LEQRQSLPI+KLK+ELL A++DN+VL+VIGETGSGKTTQ+TQY+AEAG +   +I CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T  ETKIKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKKA  +RDD+KLIVTSATL+SVKFS+YFF +PIF IPGRT+ VE+LYS+EP+ DYL+A+LNTVM IHLTEPPGD+L+FLTGQEEID+ CE++Y R+KALG D PEL+ILPVY+A+PS+ QSRIFDPAPP +RK+VIATNIAETSLTI+G+YYVIDPGFVKQKVY+SKSGMDQLIV+PISQAQA QR GRAGRTGPGKC+RLYTERA+++EML  NVPEIQRTN+ASTVL LKAMGINDLL+FDFMD PP QTLV AM  LH LSALDDEGLLT+LGR+MAEFPLEPML+KMLIMSVHL CSEE+LTIVSMLSV+  FYRPK+K + ADQ+KAKF+QPEGDH+TLLAV+NAWKN+KFS PWCYDNF+QAR+LK AQDVRKQLLGIMDR+ L + SCGK T L QKAI+SGFFRNAA+KDPQEGYRTLVDQQVV+IHPSSALF+RQPDWV++HELV+TTKEYMREVTTID +WLVEFAP FFKF DPTKLS+AKKS +IEPLY++FEEKDSWRISR  +KFHVKVTF
Sbjct:  329 PVVGEIYQGRVSNILAFGAVVQIEGLRRRCEGLVHISQLRREGRVANVSDVVQRSQKVYVKVLTFTGTRTSLSMREVNQETGEDLNPQNSSPSSRDPADGGKVRNMDDADLDGVRNPDRPTASSTASISRSALFGPRRGDADGVDED-LESGPKRKVQRISSPERWELKQMMSAGVVEKTDLPDFDEETGLLPREDEESDEDIEIELVEEEPPFLKGHGRHAMDLSPVRIVKNPDGSLQQAAMMRQALQKERREIKQQERQSQIMAEREAAPERMGKDWHDPMGGPMDSKTPFSGSRVN--EQFKDVPEWKRAVQGGTRT-GAVGKKIVRSLLEQRQSLPIYKLKDELLSAVHDNKVLIVIGETGSGKTTQITQYLAEAGYVNTGRIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTAPETKIKYMTDGMLLRECLIDPDLRQYAIIMLDEAHERTIHTDVLFGLLKKAIQKRDDMKLIVTSATLDSVKFSQYFFEAPIFTIPGRTYPVEILYSLEPENDYLDAALNTVMQIHLTEPPGDILVFLTGQEEIDSGCELLYERMKALGPDVPELIILPVYAALPSEMQSRIFDPAPPGSRKVVIATNIAETSLTIDGVYYVIDPGFVKQKVYSSKSGMDQLIVSPISQAQAKQRAGRAGRTGPGKCFRLYTERAYRDEMLGTNVPEIQRTNLASTVLQLKAMGINDLLSFDFMDPPPLQTLVAAMETLHGLSALDDEGLLTRLGRRMAEFPLEPMLSKMLIMSVHLQCSEEVLTIVSMLSVQNVFYRPKEKTELADQRKAKFHQPEGDHLTLLAVYNAWKNNKFSAPWCYDNFVQARTLKRAQDVRKQLLGIMDRHKLDVVSCGKKTALAQKAILSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPDWVVYHELVMTTKEYMREVTTIDPRWLVEFAPNFFKFGDPTKLSRAKKSMRIEPLYSKFEEKDSWRISRVPRKFHVKVTF 1324          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A4Z2CM88 (ATP-dependent RNA helicase DHX8 OS=Schistosoma japonicum OX=6182 GN=EWB00_009331 PE=4 SV=1)

HSP 1 Score: 1286.17 bits (3327), Expect = 0.000e+0
Identity = 680/1008 (67.46%), Postives = 813/1008 (80.65%), Query Frame = 2
Query:  689 CDRQGYKY--SRPETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL------------------------LEEFQQDKFRNPEKPDVYS---------NQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQ-KVTGKDWHDPVMKEFNNN---TGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF 3592
             + +G K+  S P  G IY+G VT++     +V L       EG+VHIS L     V  V DV++   KV+ KV++    R  LSM+ VNQ+TG DL                        ++E   D  RNP++P V S             EE I+   KRK+QR++SPERWEL+QM +AGV++ T+ PD+ E+TG++   D+ES+EDIEIE+VE++P FLKG     + LSPVRIVKNPDGSLQ AAMM+ ALQK+RRE KQQE+ N+  ++  T  +  GKDWHDP+    ++    +GSR    ++F DVPEWK+ V GGT   GA  + + +SILEQRQ+LPIF+LK+EL++A+NDN+VL+VIGETGSGKTTQ+TQY+AEAG +   +I CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T  ETKIKYMTDGMLLRECL+DP+L QYSVIMLDEAHERTIHTDVLFGLLKKA  +RDD+KLIVTSATL+SVKFS+YFF +PIF IPGRT+ VE+LYS+EP+ DYL+A+LNTVM IHLTEPPGD+L+FLTGQEEID+ CE++Y R+KALG + PEL+ILPVY+A+PS+ QSRIFDPAPP +RK+VIATNIAETSLTI+GIYYVIDPGFVKQKVY+SKSGMDQLIVTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL LKAMGINDLL+FDFMD PP QTLV AM  LH LSALDDEGLLT+LGR+MAEFPLEPML+KMLIMSVHL CSEE+LT+VSMLSV+  FYRPK+K + ADQ+KAKF+QPEGDH+TLLAV+NAWKN+KFS PWCYDNF+QAR+LK AQDVRKQLLGIMDR+ L + SCGK T L QKAI+SGFFRNAA+KDPQEGYRTLVDQQVV+IHPSSALF+RQPDWV++HELV+TTKEYMREVTTID +WLVEFAP FFKF DPTKLS+ KKS +IEPL+++FEEKDSWRISR  +KFHVKVTF
Sbjct:  272 SENKGLKHLPSEPIIGDIYRGRVTNVLAFGAVVQLDGLRKRWEGLVHISQLRQEGRVASVSDVVSRNQKVWVKVISFTGTRTGLSMREVNQETGADLNPSRLPERKINNPDESSGKDKIRLVDEEDIDGVRNPDRPAVNSAPGIFGRRKETGFEEDIESGPKRKVQRISSPERWELKQMMSAGVIEKTELPDFDEETGLLPREDEESDEDIEIELVEDEPPFLKGHGRHAMDLSPVRIVKNPDGSLQQAAMMRQALQKERREMKQQERQNQVTAERETAPERMGKDWHDPMGFTLDSEPQFSGSR--STDQFKDVPEWKRAVQGGTRT-GAVGKKIVRSILEQRQALPIFRLKDELMKAVNDNKVLIVIGETGSGKTTQITQYLAEAGYVNTGRIGCTQPRRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTAPETKIKYMTDGMLLRECLIDPDLRQYSVIMLDEAHERTIHTDVLFGLLKKAIQKRDDMKLIVTSATLDSVKFSQYFFEAPIFTIPGRTYPVEILYSLEPENDYLDAALNTVMQIHLTEPPGDILVFLTGQEEIDSGCELLYERMKALGSEVPELIILPVYAALPSEMQSRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVIDPGFVKQKVYSSKSGMDQLIVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLATNVPEIQRTNLASTVLQLKAMGINDLLSFDFMDPPPLQTLVAAMETLHGLSALDDEGLLTRLGRRMAEFPLEPMLSKMLIMSVHLQCSEEVLTVVSMLSVQNVFYRPKEKTELADQRKAKFHQPEGDHLTLLAVYNAWKNNKFSAPWCYDNFLQARTLKRAQDVRKQLLGIMDRHKLDVVSCGKKTALAQKAILSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPDWVVYHELVMTTKEYMREVTTIDPRWLVEFAPNFFKFGDPTKLSRTKKSMRIEPLFSKFEEKDSWRISRVPRKFHVKVTF 1276          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 1199.11 bits (3101), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 779/971 (80.23%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++   ++  LSMK V+Q TG+DL          E  ++   RNP++P      ++ +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SPV+IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQ+   SI+EQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VEVLY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+QPEGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPT+LS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  243 PSVGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVGGEGQEESAMRNPDRPTNLNLGHAPEVEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAE-MDSIPMG--LNKHWVDPL----PDTDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQL---SIIEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1200          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 628/971 (64.68%), Postives = 779/971 (80.23%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL---------LEEFQQDKFRNPEKPD----VYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G VTS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++   ++  LSMK V+Q TG+DL          E  ++   RNP++P      ++ +++++ ++   ++++ +++ PE+WE++QM  A VL   + PD+ E+TG++   DDE +ED+EIE+VEE+P FL+G   + + +SPV+IVKNPDGSL  AAMMQSAL K+RRE KQ ++  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQ+   SI+EQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+DP+L QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VEVLY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+QPEGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPT+LS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  282 PSVGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVGGEGQEESAMRNPDRPTNLNLGHAPEVEDDTLE---RKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAE-MDSIPMG--LNKHWVDPL----PDTDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQL---SIIEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1239          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 364/629 (57.87%), Postives = 479/629 (76.15%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNK-KIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
            +SI E R+SLP+F  + +LL AI D+Q+LV+ GETGSGKTTQ+ QY+ E G  K   KI CTQPRRVAA SV+ RVAQE G  LG EVGY+IRFED T+  T +KYMTDGMLLRE L +P+L  YSVI++DEAHERT+HTD+LFGL+K  A  R DLK++V SATL++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYL+A + +V+ IH+T+PPGD+L+FLTGQEEI++CCE +  R + LG    ELL+LP+Y+ +PSD Q++IF+P PP ARK+V+ATNIAETSLTI+GI YVIDPGF KQK YN+++GM+ LIVTP S+A A+QR GRAGR   GKC+RLYT  AFK EM    VPEIQRTN+ + VL LK++GINDL+ FDFMD PP +TLV A+ +L+AL AL+  G LTKLGR+MAE P++PML+KM++ S    CSEE+LTI +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S FST WC++NFIQ RS+K A+DVR+QL G+M+R  +++ S   ++  I+K+I +G+F + AR   + GY+T+  QQ V++HP+S+LF  QP W+I+HELV TTKE+MR+V  IDS WL+E AP ++K
Sbjct:  402 QSIQEVRRSLPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTARLS-KGGYKTVKHQQTVYVHPNSSLFEEQPRWLIYHELVFTTKEFMRQVIEIDSAWLLEVAPHYYK 1029          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 364/629 (57.87%), Postives = 479/629 (76.15%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNK-KIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
            +SI E R+SLP+F  + +LL AI D+Q+LV+ GETGSGKTTQ+ QY+ E G  K   KI CTQPRRVAA SV+ RVAQE G  LG EVGY+IRFED T+  T +KYMTDGMLLRE L +P+L  YSVI++DEAHERT+HTD+LFGL+K  A  R DLK++V SATL++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYL+A + +V+ IH+T+PPGD+L+FLTGQEEI++CCE +  R + LG    ELL+LP+Y+ +PSD Q++IF+P PP ARK+V+ATNIAETSLTI+GI YVIDPGF KQK YN+++GM+ LIVTP S+A A+QR GRAGR   GKC+RLYT  AFK EM    VPEIQRTN+ + VL LK++GINDL+ FDFMD PP +TLV A+ +L+AL AL+  G LTKLGR+MAE P++PML+KM++ S    CSEE+LTI +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S FST WC++NFIQ RS+K A+DVR+QL G+M+R  +++ S   ++  I+K+I +G+F + AR   + GY+T+  QQ V++HP+S+LF  QP W+I+HELV TTKE+MR+V  IDS WL+E AP ++K
Sbjct:  369 QSIQEVRRSLPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTARLS-KGGYKTVKHQQTVYVHPNSSLFEEQPRWLIYHELVFTTKEFMRQVIEIDSAWLLEVAPHYYK 996          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 355/612 (58.01%), Postives = 467/612 (76.31%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNK-KIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREV 3409
            +SI E R+SLP+F  + +LL AI D+Q+LV+ GETGSGKTTQ+ QY+ E G  K   KI CTQPRRVAA SV+ RVAQE G  LG EVGY+IRFED T+  T +KYMTDGMLLRE L +P+L  YSVI++DEAHERT+HTD+LFGL+K  A  R DLK++V SATL++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYL+A + +V+ IH+T+PPGD+L+FLTGQEEI++CCE +  R + LG    ELL+LP+Y+ +PSD Q++IF+P PP ARK+V+ATNIAETSLTI+GI YVIDPGF KQK YN+++GM+ LIVTP S+A A+QR GRAGR   GKC+RLYT  AFK EM    VPEIQRTN+ + VL LK++GINDL+ FDFMD PP +TLV A+ +L+AL AL+  G LTKLGR+MAE P++PML+KM++ S    CSEE+LTI +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S FST WC++NFIQ RS+K A+DVR+QL G+M+R  +++ S   ++  I+K+I +G+F + AR   + GY+T+  QQ V++HP+S+LF  QP W+I+HELV TTKE+MR+V
Sbjct:  402 QSIQEVRRSLPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTARLS-KGGYKTVKHQQTVYVHPNSSLFEEQPRWLIYHELVFTTKEFMRQV 1012          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 553/766 (72.19%), Postives = 650/766 (84.86%), Query Frame = 2
Query: 1292 IVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            + +NPDGSL  AAMMQSAL K+RRE KQ  +  E M  + T       W DP+     +  G +I  N +       D+PEWKK+  GG     G  T M   SI+EQR+SLPI+KLK +L+QA+NDNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++EFGC LGQEVGYTIRFED T+ ETKIKYMTDGMLLRECL+D EL QYSV+MLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VE+LY+ EP+ DYL+ASL TVM IHLTEPPGD+LLFLTGQEEIDT CEI+Y R+K+LG + PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGK YRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKFNQ EGDH+TLLAV+N+WKN+KFS  WCY+NF+QAR+L+ AQDVRKQ+LGIMDR+ L + SC K T  +QKA++SGFFRNAA+KDPQEGYRTLVDQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID KWLVEFAP FFK SDPT+LS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:    1 VSQNPDGSLSQAAMMQSALAKERREMKQAAREAE-MDSIPTG--LNMHWIDPL----PDAEGRQIAANMRGLGLMPPDMPEWKKHAFGGNKASYGKKTAM---SIIEQRESLPIYKLKEQLVQAVNDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECLIDSELMQYSVVMLDEAHERTIHTDVLFGLLKKTIKRRLDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILLFLTGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYQLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQARTLRRAQDVRKQMLGIMDRHKLDVVSCAKATVRVQKAVLSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 756          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: zgc:158828 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 374.4 bits (960), Expect = 1.451e-115
Identity = 251/673 (37.30%), Postives = 377/673 (56.02%), Query Frame = 2
Query: 1541 GTGGRGASTQM-----LNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLI-KNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSE-TKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYF-----FGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKAL-----GQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNV-PEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHAL-SALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVH-IHPSSAL----------FHRQPDWVIFHELVLTTKEYMREVTTIDS-KWLVEFAPKFFKFS 3466
             T G  AST       ++ SI +QRQ LPIF  +N +L  +   + +V++GETG GK+TQ+ QY+AEAG   +   +A TQPRRVAA +VA RVA+E G LLG EVGY IRF+D +  + T+IK++TDGML+RE + DP L +YS ++L     R   T   +     A +  +   + VTS+T+ S  FS  F         I    G+         + P  DY++ ++ T+M IH     GD+L FLTGQEE++     +   ++A      G     +  LP+Y+ +P   Q ++F+    N RK+V+ATN+AETS+T+ GI +V+D GFVK + Y+ +  +D L+VTP S+A A QR GRAGR+ PGKCYRLY E  F +  LP    PE++R++MA  +L LKA+GI+++L F F+  PP++++V+A+  L+AL  A  D    + LG +MAEFP+ PM AKML+ S   GCS+EI+TI +M+ ++  F  P ++   A +++ KF   EGDH+T+L VF A+     S+ WC  +F+  + L  A  ++ QL  ++ R+   I S   N    +  +++     +A+     G+ T       +  HP   L           + Q  + I H+ +    E  R  T      WL E AP FF+ S
Sbjct:   25 ATPGEEASTAFVYNPHISLSIQQQRQRLPIFMHRNHVLYLVEKYRTVVIVGETGCGKSTQIPQYLAEAGWTAEGHVVAITQPRRVAATTVAARVAEERGALLGHEVGYCIRFDDCSDPQATRIKFLTDGMLVREMMADPLLKKYSPLLL-----RFGDTTAPY---PTACSSFNRSLVEVTSSTIPS-SFSRAFECQCCLADYILWRVGQCTNARSYILMYPVPDYVKTTVETIMKIHNDAADGDILAFLTGQEEVENVVSAVVEEVRAAAARSKGSLHRHVRALPMYAGLPYVDQMKVFERVGRNCRKVVVATNVAETSVTVPGIAFVVDCGFVKLRTYDPRRAVDALLVTPASRASAQQRAGRAGRSRPGKCYRLYPESEFAK--LPEATEPEMRRSDMAPVILQLKALGIDNVLRFSFLSPPPAESMVQAVELLYALGGAWRDASSSSPLGVRMAEFPMGPMYAKMLLESGTFGCSKEIITIAAMMQIQNVFLSPPNQKIKAARQQRKFAVEEGDHMTMLNVFEAFVKHNKSSAWCQQHFLNYKGLVRAGALQDQLRKLLRRF--HIPSNSSNGTDPKLPLLTWCILTSAKAT---GFGTATKSNTANPPHPLCTLPALIGTYQQHLNLQKIFSIIHQRIC---ETTRSATIYSGPAWLTELAPHFFQQS 678          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 338.961 bits (868), Expect = 5.631e-99
Identity = 197/546 (36.08%), Postives = 332/546 (60.81%), Query Frame = 2
Query: 1598 RQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEAS-----------LNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKF-----STPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSL 3187
            +++LPI + +++L++ +  +QV+VV G+TG GK+TQ+ QY+  AG+    ++ACTQPRR+A  S+AKRV+ E     G ++GY IRFE   T+ TK+ ++T+G+LLR+   +  +++Y V++LDE HER +H D+L G+L++    RDDL+L++ SAT+N   FS Y   +P+ ++PGR + ++V+Y   P+++    S           + ++ H +  +  GD+L+FL+G  +I    E      ++   +    ++L ++S + ++ Q ++FD AP   RK +++TNIAETS+TI+G+ +++D G VK+  Y+ K+ M +L    IS+A A+QRKGRAGRTGPG C+RLY E  + + + P  VPE+QR  + S VL +K+MG+ D   F F++ PP+ +L  +M  L    ALD++  LT +GR +A  PL+ +  KML++   LG  E +LTI + +SV+  F+R         + +       GD +TLL VFN W   K      S  WC  + ++ + L    ++++Q   ++ ++ L
Sbjct:  102 QRNLPIHEYRDQLVELVRAHQVVVVAGDTGCGKSTQVPQYLLSAGM---SRVACTQPRRIACMSLAKRVSYESLGEHGSQIGYQIRFETSKTAATKVLFLTEGLLLRQMQTEGFMSRYDVLILDEVHERHLHCDLLLGVLRELLPLRDDLRLVLMSATINIQLFSRYLGDAPVLQVPGRLYPIQVIYRPVPEEEKTGKSERIDPRPYLRIMQSIDHKYPADERGDLLVFLSGMADIARVAEA----AQSYAVETKRWIVLQLHSTLSAEQQDKVFDLAPEGVRKCIVSTNIAETSVTIDGVRFIVDSGKVKEMSYDPKAKMQRLQEFWISRASAEQRKGRAGRTGPGVCFRLYAESEY-DALEPYAVPEVQRVPLDSVVLQMKSMGLGDPRLFGFLEPPPASSLETSMQFLQEQGALDEQEELTPIGRVLATLPLDVLTGKMLLVGCVLGAVEPVLTIAAAMSVQSPFHRNAHTNPDCSRARRSLESDHGDPLTLLNVFNEWVQVKSGGQVPSRKWCKRHGLEEQRLYEIANLQRQFKELLVQFGL 639          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:NCBI gene;Acc:796505])

HSP 1 Score: 311.227 bits (796), Expect = 2.180e-95
Identity = 171/407 (42.01%), Postives = 249/407 (61.18%), Query Frame = 2
Query: 1577 NKSILEQRQSLPIFKLKNELLQAIND-NQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXX---XQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDD-----LKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHL-TEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNA-RKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQ-RTNMASTVLALKAMGINDLLTFDFMDAP 2761
            N  +  QR+ LPI+ ++ EL + + + +  +V+ G T  G TTQ+  +  E       ++A  QP    A  V  R     Q  G      VGYT+RFED+ ++ T+++++TDGMLLRE L DP L   S ++LDEAHER++HTD LFG++K A  QR +     LK+IV SAT++  +F  YF G+P+  + GR   +++ Y+ EP  D+L A+L T+   H   E    +L FLTGQEEI+       +  + L    P + ++P+Y+A+P   Q R+F  APP   RK+++ATNIAETS+TI G+  VID G VK K+++  +GM+ L +  +SQAQA QR GR+GR GPG C RLYTE  F + +  N  PE+Q R N+ S +L L A+GI+D+ +FDFMD P
Sbjct:   31 NSGLEVQRRGLPIYAVRAELTRRLQELHTAIVIFGITAQGSTTQVKSWTGEQDCPPGGEVAYMQPSHTTAVCVPSRRDFYRQNRG---RDVVGYTVRFEDVRSASTRVRFVTDGMLLREALGDPLLLATSAVVLDEAHERSLHTDTLFGVVKGAQRQRWEQKLRPLKVIVMSATMDVDRFVSYFNGAPVLYVEGRQHPIQIFYTREPHSDFLHATLITIFQTHQEQEAEHHILAFLTGQEEIEAMGRACRDLSRQLPPSVPRMCVVPLYAALPHAQQQRVFARAPPKGTRKVILATNIAETSITIPGVRTVIDCGLVKAKMFSPGTGMEVLALQKVSQAQAWQRAGRSGREGPGCCLRLYTEMHF-QSLAENTTPELQSRCNLTSVLLHLLALGISDVASFDFMDKP 433          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dqx1 (DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-150224-1])

HSP 1 Score: 279.641 bits (714), Expect = 7.172e-83
Identity = 169/476 (35.50%), Postives = 267/476 (56.09%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGL---IKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQ-DYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPS------DHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGP-GKCYRLYTERAFKE--EMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFY 2971
            ++L+ R++LP++  +    + I    V++V GE G GK+TQ+ Q+ AE  L    ++  + C QP  +AA S+A RVA E    +G EVGY++ FED  T++T +++ TD MLLRE   DP+L++Y  I+LDE  ER++ TDVL GLL+    QR  L++++ +    +     Y+   P   + G+  ++ V   VE +Q D + A++  V+ IH    PGD+L+FL   ++  T  E      + L     EL ++P+    P       D             R++V+++ IAE++ +  G+ +VID G   + VYN +   D  +V PIS++QA+Q    A R GP GKC+RLY E  FKE  E+ P   P +  +N+   VL LK + I D+   DF+D P      KA+ +L  L+ALD++G L+++G  M+E PL+P LAK L+ S    C  E+LT+ +ML+V P  +
Sbjct:   53 ALLKARRALPVWGAREMFRERIASYPVILVSGEPGVGKSTQIPQWCAEFALSRECEHGTVVCAQPHAMAATSLAVRVADEMDLNVGHEVGYSVPFEDCCTTDTILRFTTDEMLLRELTSDPQLDRYGAIVLDEVQERSLSTDVLMGLLRDVGRQRPGLRVVLVATPCAAEALHRYYGDVPWREVVGQQGQL-VYTGVETEQRDVVRAAVKLVLEIHRAAQPGDVLVFLPSDKDASTAYEQARREARQLSPALGELRLVPLLPGHPGGAGALYDAGGAAATAKGRGGRRVVLSSGIAESAFSFEGVRFVIDSGLETKNVYNPRIRADSQVVRPISRSQAEQTSCCAVRAGPAGKCFRLYPESVFKEMPELPP---PRVLESNLTRLVLLLKRLDIADMGQCDFVDRPAPANRTKALEDLDYLAALDNDGNLSEVGIIMSEIPLDPQLAKALLASCEFDCVTEMLTLAAMLTVVPLCF 524          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP22 (DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase; associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes; required for proofreading the exon ligation reaction [Source:SGD;Acc:S000000815])

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 473/979 (48.31%), Postives = 651/979 (66.50%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHL--TEFSGMVEGMVHISNLCTYHXXXXXXXXXXXXXXXXXXMAIENN-RIKLSMKVVNQKTGKDLLEEFQQDKFRNPEKPDVYSNQLDEEYIQVNTKRKIQR--MTSPERWELRQMENAGVLKITDHPDYSE-------------DTGVMFNAXXXXXXXXXXXXXXXX-------------PAFLKGQ-FNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRF-EEKDSWRIS 3556
            P   K+Y+G V ++    C V +  T      +G+VHIS +      D  DV+     ++ +V+ I+NN +I LSMK ++Q +G        + + RN E  +      D  +   N K KI+R  +TSPERWE+RQ+  +G   I D+P+  +             D G + N + E  +    E   ++             P FLK Q           +I K P G      M +SA+         +E+   +  ++  Q    + + DP   + ++    ++ +N+    V EW+K     +   G  T +    I  QRQ+LP++ +++EL+QA+ DNQ LV++GETGSGKTTQ+TQY+ E G      I CTQPRRVAA SVAKRVA+E GC +G +VGYTIRFED+T  +T+IKYMTDGML RE L+DPE+++YSVIMLDEAHERT+ TDVLF LLKKAA +R +LK+IVTSATLNS KFSEYF   PI  IPG+TF VEVLYS  PQ DY+EA+L+ V+ IH+ E PGD+L+FLTGQEEID+CCEI+Y+R+K LG    ELLILPVYSA+PS+ QS+IF+P P  +RK+V ATNIAETS+TI+GIYYV+DPGF K  +YN+++G++QLIV+PISQAQA+QRKGRAGRTGPGKCYRLYTE AF  EML N VPEIQR N++ T+L LKAMGINDLL FDFMD PP   ++ A++EL+ L +LDDEG LT LG++M+ FP++P L++ L+ SV   CS+EI+TI+SMLSV+  FYRPKD+   AD KKAKF+ P GDH+TLL V+  W+ + +S  +C  NF+  R LK A+DV+ Q+  I  +  LK+ SC  +  LI+K  VSGFF NAA++D Q GY+T+     V IHPSS+L+ ++ ++V++H +VLT++EYM +VT+I+ +WL+E AP F+K  D    SQ++K  +I PL+N+F ++++SWR+S
Sbjct:  175 PVLHKVYEGKVRNITTFGCFVQIFGTRMKN-CDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIKIQNNGKISLSMKNIDQHSG--------EIRKRNTESVEDRGRSNDA-HTSRNMKNKIKRRALTSPERWEIRQLIASGAASIDDYPELKDEIPINTSYLTAKRDDGSIVNGNTEKVDSKLEEQQRDETDEIDVELNTDDGPKFLKDQQVKGAKKYEMPKITKVPRG-----FMNRSAINGSNAIRDHREEKLRKKREIEQQIRKQQSFDDPTKNKKDSRNEIQMLKNQLI--VTEWEKNRMNESISYGKRTSL---PISAQRQTLPVYAMRSELIQAVRDNQFLVIVGETGSGKTTQITQYLDEEGFSNYGMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPELKVIVTSATLNSAKFSEYFLNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINEGPGDILVFLTGQEEIDSCCEILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTPKGSRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDDEGKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISMLSVQNVFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKKIGLKLISCHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGTEVGIHPSSSLYGKEYEYVMYHSIVLTSREYMSQVTSIEPQWLLEVAPHFYKAGDAE--SQSRKKAKIIPLHNKFAKDQNSWRLS 1131          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP43 (RNA helicase in the DEAH-box family; functions in both RNA polymerase I and polymerase II transcript metabolism; catalyzes removal of U2, U5, and U6 snRNPs from the postsplicing lariat-intron ribonucleoprotein complex; required for efficient biogenesis of both small- and large-subunit rRNAs; acts with Sqs1p to promote 20S to 18S rRNA processing catalyzed by endonuclease Nob1p [Source:SGD;Acc:S000003088])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 325/646 (50.31%), Postives = 457/646 (70.74%), Query Frame = 2
Query: 1586 ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIA--EAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQD--CPELLILPVYSAMPSDHQSRIFDPAPPN-----ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFST----PWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCG----KNTGLIQKAIVSGFFRNAARK-DPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSD 3469
            IL+ R+ LP+   ++E L+   +NQ++V +GETGSGKTTQ+ Q++   E   ++N ++ACTQPRRVAA SVA+RVA+E    LG+EVGY+IRFE+ T+++T +KYMTDGMLLRE + D +L++YS I+LDEAHERT+ TD+L GLLK+   +R DLK+I+ SATL++ KF  YF  +P+  +PGRT+ VE+ Y+ E Q+DYL++++ TV+ IH TE  GD+LLFLTG++EI+     I      L ++  C  L + P+Y ++P   Q RIF+PAP +      RK+VI+TNIAETSLTI+GI YV+DPGF KQKVYN +  ++ L+V+PIS+A A QR GRAGRT PGKC+RLYTE AF++E++  + PEI R+N++STVL LK +GI+DL+ FDFMD P  +T+++A+ EL+ L+ LDDEG LT LGR  ++FPL+PMLA MLI S    CS+EILTIV+MLSV   F RP      AD  K  F  P+GDHITLL V++A+K+ +        WC D+++  RSL  A ++R QL  +M+RY+L++ +      K    I+KA+ SGFF   A+K    +GY T+ D Q V IHPS+ L H   +WVI++E VLT+K Y+R VT++  +WL+E AP ++  S+
Sbjct:   86 ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTVLGH-DAEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIAPAYYDLSN 730          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP16 (DEAH-box RNA helicase involved in second catalytic step of splicing and in exon ligation; exhibits ATP-dependent RNA unwinding activity; mediates the release of Yju2p and Cwc25p in the second step; in the absence of ATP, stabilizes the binding of Cwc25p to the spliceosome in the first catalytic step; missense mutation in human ortholog DHX38 associated with early-onset retinitis pigmentosa [Source:SGD;Acc:S000001794])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 316/637 (49.61%), Postives = 442/637 (69.39%), Query Frame = 2
Query: 1586 ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLI--KNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSE-TKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTE--PPGDMLLFLTGQEEIDTCCEIIYNRI-----KALG----QDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLT-FDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSAL--FHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFA 3445
            I   ++ LP+F+ +++LL  I +NQV+V+IGETGSGKTTQ+ QY+ E G    + K I  TQPRRVAA SVAKRVA E    LG+EVGY+IRFED+T SE TK+K++TDG+LLRE L+D  L++YS +++DEAHER+++TD+L G  K    +R DLKLI+TSAT+N+ KFS +F  +P F IPGRTF V+ +Y+  P QDY+EA+++  + IHL      GD+L+F+TGQE+I+T  + +  +      K  G    ++  ++ ILP+YSA+P+D Q +IF       RK++IATNIAETSLTI GI YVID G+ K KVYN K G+D L++TPIS+A ADQR GRAGRT PG  YRLYTE  FKE+M    +PEIQRTN+++T+L LK++ + D L+ F F+D PP QT + ++ EL  + A+D  G LT LG +MA+FPL+P L+K+L+++V  GCS+E+LTIVSMLSV   FYRPK++   AD  + KF   + DH+TLL VF  W+ + FS+ WC  +F+Q +SL  A+D+R QLL I+    + + S GK+  +I+K I SGF   AA+      Y  L     V +HP+SAL      P +V++HEL++T+KEY+  VT++D  WL+E+ 
Sbjct:  343 IKHTKEQLPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFGNAPQFTIPGRTFPVQTIYTSNPVQDYVEAAVSQAVKIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFLQVYSKKFGTANFEEINDIEILPIYSALPADLQFKIFQDLHGTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSGQLTPLGLQMAKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQVFYRPKERQKEADIARNKFFIAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPVISSGKDWDIIKKCICSGFAHQAAKITGLRNYVHLKTGVSVQLHPTSALHGLGDLPPYVVYHELLMTSKEYICCVTSVDPFWLMEYG 979          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP2 (RNA-dependent DExD/H-box ATPase; required for activation of spliceosome before first transesterification step in RNA splicing; implicated in rearranging and proofreading snRNA structure in catalytic activation of spliceosome; ortholog of human protein DHX16 [Source:SGD;Acc:S000005294])

HSP 1 Score: 546.199 bits (1406), Expect = 1.998e-178
Identity = 300/655 (45.80%), Postives = 425/655 (64.89%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKK--IACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTT-SETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEP-PGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKML-IMSVHLGCS---EEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQL------LGIM---DRYSLKIRS-CGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQV---VHIHPSSALF-------HRQPDWVIFHELVLTTKEYMREVTTI-DSKWLVEFAPKFFK 3460
            +I E R+ LP+ + K+ELLQ I  NQVL+++GETGSGKTTQ+ QY+ E G     K  IA TQPRRVAA SVA RVA E   +LG+EVGY IRFED TT ++T +KYMTDGMLLRE L D +L++YS IM+DEAHERT+ TD+L GLLK    QR  LKL+++SAT+N+ KFSE+F   PIF +PGR + V++ Y+++P+ +Y+ A++ T+  IH T+  PGD+L+FLTGQEEI+     +   +  LG    +++I P+Y+ +P + Q +IF P P N RK+V+ATNIAETSLTI+GI YVIDPGFVK+  Y   +GM QL+  P S+A  DQR GRAGR GPGKC+R++T+ ++  E+     PEI RTN+++TVL L ++G+ DL+ F  MD P   TL K++  L+ L AL+ +G +T+LG+ M EFP EP  AK+L   + H  C    EE LTIVSML   P+ +         D   +  ++ E DHI  L +FN W+NSKFS  WC D+ IQ +++   +++R QL      +G++   D+  +KI +  G     I +  +SGF  N  +  P  GY+T+        V +HP+S LF        R   +V++ +L+LT+KE++R+   I   +WL++  P+ FK
Sbjct:  215 TIQEARKLLPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGFTDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTTPNKTVLKYMTDGMLLREFLTDSKLSKYSCIMIDEAHERTLATDILIGLLKDILPQRPTLKLLISSATMNAKKFSEFFDNCPIFNVPGRRYPVDIHYTLQPEANYIHAAITTIFQIHTTQSLPGDILVFLTGQEEIERTKTKLEEIMSKLGSRTKQMIITPIYANLPQEQQLKIFQPTPENCRKVVLATNIAETSLTIDGIRYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVGPGKCFRIFTKWSYLHELELMPKPEITRTNLSNTVLLLLSLGVTDLIKFPLMDKPSIPTLRKSLENLYILGALNSKGTITRLGKMMCEFPCEPEFAKVLYTAATHEQCQGVLEECLTIVSMLHETPSLF----IGQKRDAAASVLSEVESDHILYLEIFNQWRNSKFSRSWCQDHKIQFKTMLRVRNIRNQLFRCSEKVGLVEKNDQARMKIGNIAGYINARITRCFISGFPMNIVQLGPT-GYQTMGRSSGGLNVSVHPTSILFVNHKEKAQRPSKYVLYQQLMLTSKEFIRDCLVIPKEEWLIDMVPQIFK 864          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: DHR2 (Predominantly nucleolar DEAH-box ATP-dependent RNA helicase; required for 18S rRNA synthesis [Source:SGD;Acc:S000001561])

HSP 1 Score: 434.876 bits (1117), Expect = 7.954e-138
Identity = 282/717 (39.33%), Postives = 406/717 (56.62%), Query Frame = 2
Query: 1400 SKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEK---FSDVPEWKKYVTGGTGGRGASTQMLNKS----ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKK---IACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQ-RDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLIL--PVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNV-PEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPX----XXXXXXXXXXXXFNQPEGDHITLLAVFNAW--------KNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRY----------SLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALF-HRQPDWVIFHELVLTTKEYMREVTTIDSKWLVE 3439
            S+V++   + K      +  F NNT  RI R  K   F+D  E        +      T    KS    +L+ R++LP+++ K E++  I  N V V+IGETGSGK+TQ+ Q++ E  L   KK   IA TQPRRVAA ++A RVAQE GC LG++VGY++RF++ TT+ T++KY+TDGMLLRE +++ +L +YSVI++DEAHERT+ TD++ G LK      R DL++IV SATL + KFSE+F  +PI  + GR F+V+  Y   P  D ++A +   + I+  E  GD+L FL GQEEID    I+    K +  + P  LI+  P+Y+A+P+  QS +F P     RK+V +TNIAETS+TI+G+ +V+D G  K KV+  + G+  L+  PISQA A QR GRAGR   GK +RLY E  + +  LP    PEI R+++ S VL LK  G++DLL + + + P  + +V  + EL+ L ALD  G +TK G++MA  PL+P L+ +LI +  +GC  +++ IVS LSVE     P     D+ +          +  GD I L  +F+ +          S     WC    I  R  K+   VR QL     R           S KI   G+    I K  ++GF +N A   P   YRT+   + + IHPSS LF ++    +++ E V TTK Y R V+ I+  WL E
Sbjct:    7 SRVASNHTSKKQKVRRNIHPFTNNT--RIKRASKIVKFNDSGEGDHVSDQRSNKENVLTYKSLKSRASDLLKMRETLPVYQHKREIMSYIESNPVTVLIGETGSGKSTQIPQFVLEK-LYDTKKHGSIAVTQPRRVAAINLATRVAQEHGCKLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDLILGFLKSLIQGPRPDLRIIVMSATLQAEKFSEFFNNAPILFVEGRKFDVKQYYLKAPTDDIVDAVIRCCIQINQGEELGDILCFLPGQEEIDKAVTIMEKIAKYVSDEAPVPLIVPYPLYAALPAVQQSLVFAPIKGFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDYVK--LPKQSEPEIARSDVTSPVLMLKRYGVDDLLNWTWFENPGKEAIVMGLQELYELGALDTRGKITKRGQQMALLPLQPHLSSVLIKASEVGCLSQVIDIVSCLSVENLLLNPSPEERDEVNERRLSLCNAGKRYGDLIMLKELFDIYFYELGKSQDASSERNDWCKGLCISIRGFKNVIRVRDQLRVYCKRLFSSISEEDEESKKIGEDGELISKILKCFLTGFIKNTAIGMPDRSYRTVSTGEPISIHPSSMLFMNKSCPGIMYTEYVFTTKGYARNVSRIELSWLQE 718          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO49560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM4])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 389/519 (74.95%), Postives = 463/519 (89.21%), Query Frame = 2
Query: 2015 LKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            +KKA  +R DLKLIVTSATL++VKFS +FF +PIF IPGRTF VE+LY+ E + DYL+A+L TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK VIATNIAETSLTI+GIYYV+DPGFVKQ VYNSKSGMD L+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML   VPEIQRTN+AST+L+LKAMGINDLL+FDFMD PP +T++ AM  LH+LSALD+EGLLT+LGR+MAEFPLEP L+KMLI SVHLGCS+EILTIVSMLSV+  FYRPKDK   ADQKKAKF+QPEGDH+TLLAV+N+WKN+KFS  WC++NF+QARSL+ AQD+RKQ+LG+MDR+ L + SCGK+T  +QKAI SGFFRNAARKDPQEGYRT+VD QVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID KWLVEFAP FF+ +DPTKLS+ K+ +++EPLYNR+EE ++WRISRA ++
Sbjct:    1 MKKAVQRRPDLKLIVTSATLDAVKFSTFFFEAPIFTIPGRTFPVEILYTKEAESDYLDAALITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERTKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKCVIATNIAETSLTIDGIYYVVDPGFVKQNVYNSKSGMDALVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLATAVPEIQRTNLASTILSLKAMGINDLLSFDFMDPPPMETMISAMEALHSLSALDNEGLLTRLGRRMAEFPLEPQLSKMLIQSVHLGCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNAWCFENFVQARSLRRAQDIRKQMLGLMDRHKLDVVSCGKHTARVQKAITSGFFRNAARKDPQEGYRTVVDNQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEFAPSFFRVADPTKLSKRKRHERLEPLYNRYEEPNAWRISRAFRR 519          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO32531 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS3])

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 321/668 (48.05%), Postives = 458/668 (68.56%), Query Frame = 2
Query: 1493 NEKFSDVPEWKKYV---TGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDD-----LKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEP-PGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDD---EGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
            +E  S +P  +  +   +   GG        +  I  Q+ SLPIF  +  L+  I + Q ++++GETGSGKTTQ+ QY+ EA + +N  IACTQPRRVAA S+A+RV++E G  LG+EVGYT+RFED+T+++T+IKYMTDGMLLRE + D  L +YSVI+LDEAHERTIHTDVLFG++K A   R D     LK++V SATL + +FSEYF  + +  I GR   VE++Y+VEPQ DY+ A+L T+M +H  +P  GD+L+FLTGQ+EI++  +++ +       DCP+LL+ P+++A+PS  Q ++F PA P ARK++++TNIAETS+TI G+ YVID G+VK K ++ K+G+D L V P+S+AQA QR GRAGR   G CYRLYTE  F E++    VPEIQR N++S +L L A+GI D+ +FDFMD P +  +  A+ +L  L AL +   +  LT LG+KMA+FPLEP LAK+++ S  LGCSEEILT+V++LSV+   Y P+ K D A + + KF   EGD ITLL ++ A+K    +  WC ++FI  R +K   D+RKQL  I  R  +K++SCGK++  +++ +  G F N+A       Y+TL  ++ V IHPSS+LF  +P +V+++ELV T+K YMR+V+ +   WL+E AP FF+
Sbjct:   17 SESGSPLPAKRAVIRSSSASNGGEQNGHTHASSPIQRQKLSLPIFSARKSLITEIRNRQNVIIVGETGSGKTTQIPQYLYEAKVARNSVIACTQPRRVAAISIAQRVSREMGVQLGEEVGYTVRFEDVTSTKTRIKYMTDGMLLRESIGDSLLKRYSVIILDEAHERTIHTDVLFGIVKGAQISRKDKGMLPLKIVVMSATLEAHQFSEYFGSAEVLYIEGRQHPVELMYAVEPQVDYMHAALITIMQLHQEKPLGGDILVFLTGQDEIESLSKLVSDCSLHCPPDCPQLLVCPMFAALPSSQQMQVFRPAIPGARKVILSTNIAETSVTIPGVKYVIDTGYVKAKGFHPKTGLDMLRVQPVSKAQARQRLGRAGRECSGVCYRLYTEEQF-EQLAEATVPEIQRCNLSSVILQLMALGIADIASFDFMDKPSADAIDGALKQLVILEALQEINGDYKLTSLGQKMAQFPLEPRLAKVILASETLGCSEEILTVVALLSVDSITYTPQSKRDHALKVRKKFLSSEGDQITLLNIYRAYKQCGMNKSWCAEHFINTRVMKLVMDIRKQLREICIRLEIKLQSCGKDSATLRQCLCRGLFMNSAELQLDGTYQTLNHRETVAIHPSSSLFMSKPAYVVYNELVHTSKCYMRDVSVVSCDWLLEAAPGFFQ 683          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO32629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG0])

HSP 1 Score: 518.464 bits (1334), Expect = 5.783e-173
Identity = 262/465 (56.34%), Postives = 339/465 (72.90%), Query Frame = 2
Query: 1889 KYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEP-PGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPN------ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTG----LIQKAIVSGFF 3250
            +YMTDGMLLRE + DP L++Y+VI+LDEAHERT+ TD+L GLLK+ A QRDDLK+I+ SATL++ KF +YF   P+  IPGRT  VE+ Y+ EP++DYLEA++ TV+ IH+ E   GD+LLFLTGQEEI+  C+ I   +  LG +  EL  +P+YS +P   Q RIF+ APP+       RK V+ATNIAETSLTI+G+ +VIDPGF KQKVYN +  ++ L+V+ IS+A A QR GRAGRT PGKC+RLYTE+AF+EEM PN  PEI R+N+ + VL LK +GI+DL+ FDFMD P  +TL++A+  L+ L ALDD G LT+LG  MAEFPL+P LAKM+I S    CS EIL+I SMLSV   F RP +   AAD+ K KF   +GDH+TLL V++A+K +   T WCYDNFIQ RS+K A +VR QL  IMDR++L+ RS   N+      I+KA+VSGFF
Sbjct:    1 RYMTDGMLLREAMTDPLLDRYAVILLDEAHERTLATDILMGLLKEVAKQRDDLKIIIMSATLDAGKFQDYFDHCPLMTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMVEEVKGDILLFLTGQEEIEEACKRIKKEVDNLGSEIGELKCIPLYSTLPPTQQQRIFEAAPPDRPNGAIGRKCVVATNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVSAISRASAQQRAGRAGRTRPGKCFRLYTEKAFQEEMPPNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLGALDDNGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITSMLSVPQVFLRPNEAKKAADESKMKFAHIDGDHLTLLNVYHAYKQNHEDTQWCYDNFIQHRSMKSADNVRGQLARIMDRFNLQRRSTDFNSRDYYLNIRKALVSGFF 465          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO45861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP1])

HSP 1 Score: 492.271 bits (1266), Expect = 8.269e-161
Identity = 271/582 (46.56%), Postives = 388/582 (66.67%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKN-KKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSE-TKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFG----------SPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEG-LLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYR 3289
            SI  QRQ LPIFK +  +L  +   + ++++GETG GK+TQ+ +Y+ E+G   + KKI  TQPRRVAA +VA RVA+E     GQEVGY +RF D    + T IK+MTDG+LLRE + DP L+ YSVIM+DEAHERT+HTDVL GLLKK   +R DL++IV+SATL++  F ++F            + +  + GR++ V + Y++ P  +YL++++ T M IHL E PGD+L+FLTGQEE+++    +  R + + +    L +LP+YS +P + Q  +F   PPN RK+++ATN+AE S+TI+GI YV+D GFVK + Y+  +G++ L+VT ISQA A+QR GRAGR   GK YRLYTE A   E+ P  VPE+QR  +    + LK+MGI+++L FDF   PP+Q++V+ +  L+AL ALDD G L+  LG +MAEFPLEPM+AKML++S    CSEEILTI +ML ++  F  P  +  A++  + KF+  EGDH+T L V  A+   K S+ WC+DNF+  + L H+  +R+QL  ++  + + I SC  +   + + IV+GFF NAAR  P   YR
Sbjct:   31 SIDIQRQRLPIFKHRTNILYLLEKYETVIIVGETGCGKSTQV-KYLLESGWTADGKKIGITQPRRVAAITVAIRVAEERDTFAGQEVGYCVRFNDCFDPKLTSIKFMTDGILLREVMGDPLLSSYSVIMIDEAHERTLHTDVLLGLLKKIKKKRPDLRIIVSSATLDAEMFKDFFNTNITNDKSKDTAAVLSVEGRSYPVNIEYAISPVANYLQSAVETAMGIHLEEGPGDILVFLTGQEEVESAVSKLIERARGMPKGSSYLKVLPMYSGLPYEEQMLVFKRPPPNTRKVIVATNVAEASITIDGIVYVVDCGFVKLRAYSPATGIESLVVTEISQASAEQRAGRAGRVRAGKAYRLYTEDAL-HELKPVTVPEMQRYFIG---ILLKSMGIDNVLRFDFPARPPAQSMVRGLELLYALDALDDNGKLVDPLGVQMAEFPLEPMIAKMLLISGEFKCSEEILTIAAMLQIKNVFVTPSSQKAASEHARRKFSVYEGDHLTQLNVHRAFLKHKKSSRWCHDNFVNYKGLMHSVKIREQLKKLLQHFKIPIVSCDGDVDQVCRCIVAGFFSNAARYHPSGCYR 607          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO35622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ8])

HSP 1 Score: 397.897 bits (1021), Expect = 4.662e-122
Identity = 195/342 (57.02%), Postives = 264/342 (77.19%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPG 2605
            KS+++QRQ LPIF ++ ELL  + DNQV++++GETGSGKTTQ+TQY+ E G      I CTQPRRVAA SVAKRV++E  C LG+EVGY IRFED+T+ +T IKYMTDG+LLRE L + +L+ YSVI++DEAHER+++TDVLFGLL+   ++R DLKLIVTSAT+++ KF+++F   P ++IPGRTF VE+ ++    +DY+++++   + IHLT   GD+L+F+ GQE+I+  CE+I  R+  + ++ P L +LP+YS +PSD Q++IF  AP   RK V+ATNIAETSLT++GI +VID G+ K KVYN K GMD L V PISQA A+QR GRAGRTGPG
Sbjct:  518 KSLVQQRQYLPIFAVRQELLSIVRDNQVVIIVGETGSGKTTQLTQYMHEDGYTNYGMIGCTQPRRVAAMSVAKRVSEEMDCSLGEEVGYAIRFEDVTSDKTMIKYMTDGILLRESLRESDLDHYSVIIMDEAHERSLNTDVLFGLLRDVVSRRRDLKLIVTSATMDAQKFADFFGNVPTYKIPGRTFPVEIFFTRTVMEDYVDSAVKQALQIHLTPSKGDILVFMPGQEDIEVTCELISERLAEV-EEAPPLAVLPIYSQLPSDLQAKIFQKAPDGVRKCVVATNIAETSLTVDGIMFVIDAGYCKLKVYNPKIGMDALQVYPISQANANQRSGRAGRTGPG 858          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:101162325])

HSP 1 Score: 1196.8 bits (3095), Expect = 0.000e+0
Identity = 630/968 (65.08%), Postives = 773/968 (79.86%), Query Frame = 2
Query:  719 PETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTY-HXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDL--------LEEFQQDKFRNPEKPDVYSNQLDEEYIQVNT--KRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKF-----SDVPEWKKYVTGGT-GGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKK 3571
            P  G IY G +TS+ +  C V L       EG+VHIS L     V +V DV++   +V  KV++   ++  LSMK V+Q TG+DL          E ++   RNP++P   +     E  Q +T  ++++ +++ PE+WE++QM  A VL   + PD+ ++TG++   DDE +ED+EIE+VEE+P FL+G   + + +SPV+IVKNPDGSL  AAMMQSAL K+RRE KQ  +  E M  +       K W DP+     +  G +I  N +      +D+PEWKK+  GG     G  TQ+   SILEQR+SLPI+KLK +L+QA++DNQ+L+VIGETGSGKTTQ+TQY+AEAG     KI CTQPRRVAA SVAKRV++E+GC LGQEVGYTIRFED T+ ET IKYMTDGMLLRECL+D EL QY++IMLDEAHERTIHTDVLFGLLKK   +R D+KLIVTSATL++VKFS+YF+ +PIF IPGRT+ VEVLY+ EP+ DYL+ASL TVM IHLTEPPGD+L+FLTGQEEIDT CEI+Y R+K+LG D PEL+ILPVYSA+PS+ Q+RIFDPAPP +RK+VIATNIAETSLTI+GIYYV+DPGFVKQKVYNSK+G+DQL+VTPISQAQA QR GRAGRTGPGKCYRLYTERA+++EML  NVPEIQRTN+ASTVL+LKAMGINDLL+FDFMDAPP +TL+ AM +L+ L ALDDEGLLT+LGR+MAEFPLEPML KMLIMSVHLGCSEE+LTIVSMLSV+  FYRPKDK   ADQKKAKF+QPEGDH+TLLAV+N+WKN+KFS PWCY+NFIQARSL+ AQD+RKQ+LGIMDR+ L + SCGK T  +QKAI SGFFRNAA+KDPQEGYRTL+DQQVV+IHPSSALF+RQP+WV++HELVLTTKEYMREVTTID +WLVEFAP FFK SDPT+LS+ KK Q++EPLYNR+EE ++WRISRA ++
Sbjct:  258 PSVGDIYNGKITSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVGPEGEEVSMRNPDRPSNLNLGHAPEMEQDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDDETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERRELKQAAREAE-MDSIPMG--LNKHWVDPL----PDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQL---SILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTARGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1215          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:101168894])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 364/636 (57.23%), Postives = 478/636 (75.16%), Query Frame = 2
Query: 1559 ASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNK-KIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
            +  ++  +S+ E R+SLPIF  + +LL AIN++QVLV+ GETGSGKTTQ+ QY+ E G      KI CTQPRRVAA SVA RVA+E G  LG EVGY+IRFED T+  T +KYMTDGMLLRE L +P+L  YSVI++DEAHERT+HTD+LFGL+K  A  R DLK++V SATL++ +FS +F  +P+FRIPGR F V++ Y+  P+ DYL+A + +V+ IH+T+PPGD+L+FLTGQEEI+ CCE++  R + LG    ELL+LP+Y+ +PSD Q++IF P PP ARK+V+ATNIAETSLTI+GI YVIDPGF KQK YN+++GM+ LIVTP S+A A+QR GRAGR   GKC+RLYT  AFK EM    VPEIQRTN+ + VL LK++GINDL+ FDFMD PP +TLV A+ +L+AL AL+  G LTKLGR+MAE P++PML+KM++ S    CSEE+LTI +MLSV  + FYRPKDK   AD  +  F  P GDH+ LL V+  W  S FST WCY+NFIQ RS++ A+DVR QL G+M+R  +++ SC      I+KA+ +G+F + AR   + GY+T+  QQ V+ HP+S+LF  QP W+I+HELV TTKE+MR+V  I+S WL+E AP ++K
Sbjct:  394 SQAELKKQSMQEVRRSLPIFPYREDLLAAINEHQVLVIEGETGSGKTTQIPQYLMEEGYTNGGMKIGCTQPRRVAAMSVAARVAEEIGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVILIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIEACCELLQERCRRLGSKIAELLVLPIYANLPSDMQAKIFTPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGFSTQWCYENFIQFRSMRRARDVRDQLEGLMERIEVEVVSCQGENVPIRKAVTAGYFYHTARLS-KGGYKTVKHQQTVYTHPNSSLFEEQPRWLIYHELVFTTKEFMRQVIEIESAWLLEVAPHYYK 1028          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx38 (DEAH-box helicase 38 [Source:NCBI gene;Acc:101155586])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 341/685 (49.78%), Postives = 478/685 (69.78%), Query Frame = 2
Query: 1580 KSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHR--QPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEE----KDSWRISRAQKKFHVKVTF*IRHNKLC 3616
            KS+LEQRQ LPIF ++ +LL  I DN +++V+GETGSGKTTQ+TQY+ E G  +   + CTQPRRVAA SVAKRV++E G  LG+EVGY IRFED T+  T IKYMTDG+LLRE L + +L+ YS +++DEAHER+++TDVLFGLL++  ++R+DLKLIVTSAT++S KF+ +F   PIF IPGRTF V++L+S  PQ+DY+EA++   + IHL+   GD+L+F+ GQE+I+   + I  R+  L  + P L +LP+YS +PSD Q++IF  AP   RK ++ATNIAETSLT++GI +V+D G+ K KV+N + GMD L V PISQA A+QR GRAGRTGPG+CYRLYT+ A+K EML   +PEIQRTN+A+ VL LK++G+ DLL F FMD PP   ++ +M +L  L ALD+ G LT  GR M EFPL+P L+KMLI+S  +GCS +IL IVSMLSV   FYRPK + + +DQ + KF+ PE DH+T L V+N WKN+ +S+ WC D+FI  ++++  ++VR QL  IM +  + + SCG +  +I+K I + +F  AA+      Y  +      H+HP+S+LF     PD++I+HELV+TTKEYM+ VT +D +WL E  P F+      +  Q  + +  + + N  EE    ++  R  R +++    +   +R  K+C
Sbjct:  552 KSLLEQRQYLPIFAVRQQLLNIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTRYGMVGCTQPRRVAAMSVAKRVSEEIGSNLGEEVGYAIRFEDCTSESTMIKYMTDGILLRESLRESDLDHYSAVIMDEAHERSLNTDVLFGLLREVVSRRNDLKLIVTSATMDSDKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQALQIHLSGMVGDILIFMPGQEDIEVTSDQIVERLGEL-DNAPPLAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVVDSGYCKLKVFNPRIGMDALQVYPISQANANQRSGRAGRTGPGQCYRLYTQSAYKNEMLTTTIPEIQRTNLANVVLLLKSLGVQDLLLFHFMDPPPEDNMLNSMYQLWILGALDNTGALTPTGRLMVEFPLDPALSKMLIVSCDMGCSADILIIVSMLSVPAIFYRPKGREEESDQVREKFSVPESDHLTYLNVYNQWKNNNYSSIWCNDHFIHTKAMRKVREVRSQLKDIMVQQKMNLVSCGSDWDIIRKCICAAYFHQAAKLKGIGEYVNVRTGMPCHLHPTSSLFGMGYTPDYIIYHELVMTTKEYMQCVTAVDGEWLAELGPMFYSVKQAGRSRQENRRRAKDEITNMEEEMAMAQEQLRTRREEQEKKSNMNI-VRAVKIC 1234          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: DHX15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:105357480])

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 339/666 (50.90%), Postives = 461/666 (69.22%), Query Frame = 2
Query: 1586 ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEA--GLIKNKK-IACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPP-GDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPN------ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTG----LIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKD 3541
            IL++R  LP+++ K      I   Q  V++GETGSGKTTQ+ Q+  +   GL   K+ +ACTQPRRVAA SVA+RVA E   +LGQEVGY+IRFED ++++T +KYMTDGMLLRE + DP L +Y VI+LDEAHERT+ TD+L G+LK+   QR DLK+IV SATL++ KF  YF   P+  IPGRT  VE+ Y+ EP++DYLEA++ TV+ IH+ E   GD LLFLTGQEEID  C+ I   +  LG +  ++ I+P+YS +P   Q RIF+P PP        RK+V++TNIAETSLTI+G+ +VIDPGF KQKVYN +  ++ L+VT IS+A A QR GRAGRT PGKC+RLYTE+A+K EM  N  PEI R+N+ S VL LK +GI+DL+ FDFMD P  +TL++A+  L+ L+AL+D+G LT+LG  MAEFPL+P LAKM+I S    CS EIL+I +MLSV   F RP +   AAD+ K +F   +GDH+T+L V++A+K +  S  WCYDNF+  RSL  A +VR+QL  IMDR++L  RS    +      I++A+ +GFF   A  +    Y T+ D QVV +HPS+ L H+ P+WV+++E VLTTK Y+R  T I  +WLV+ AP+++  S+     Q +  +Q+E +  + E K+
Sbjct:   91 ILKKRLQLPVWEYKESFTNIITRQQSFVLVGETGSGKTTQIPQWCVDMVRGLPGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDCLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTMLNVYHAFKQNHESNQWCYDNFVNYRSLMSADNVRQQLSRIMDRFNLPRRSTEFTSRDYYINIRRALCTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHK-PEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSN---FPQCEAKRQLERIIAKLESKE 752          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 331/668 (49.55%), Postives = 468/668 (70.06%), Query Frame = 2
Query: 1586 ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKN-----KKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPP-GDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPN------ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTG----LIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKD 3541
            IL++R  LP+++ +    + +  NQ  V++GETGSGKTTQ+ Q+  +  ++++     + +ACTQPRRVAA SVA+RVA E   +LGQEVGY+IRFED ++++T +KYMTDGMLLRE + DP L +Y VI+LDEAHERT+ TD+L G+LK+   QR DLK+IV SATL++ KF  YF   P+  IPGRT  VE+ Y+ EP++DYLEA++ TV+ +H+ E   GD+LLFLTGQEEID  C+ I   ++ LG +  ++ I+P+YS +P   Q RIF+P+PPN       RK+V++TNIAETSLTI+G+ +VIDPGF KQKVYN +  ++ L+VT +S+A A QR GRAGRT PGKC+RLYTE+A+K EM  N  PEI R+N+ + VL LK +GI+DL+ FDFMD P  +TL++A+  L+ L+AL+D+G LT+LG  MAEFPL+P LAKM+I S    CS EILTI +MLSV   F RP +    AD+ K +F   +GDH+TLL V++A+K +  ST WCYDNF+  RSL  A +VR+QL  IM+R++L  RS   ++      I++A+V+GFF   A  +    Y T+ D QVV +HPS+ L H+ P+WV+++E VLTTK Y+R  T +  +WL+  AP+++   +     Q +  +Q+E ++ +   K+
Sbjct:   69 ILKKRLQLPVWEYRERFTEILMRNQSFVLVGETGSGKTTQIPQWCVD--MVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHMCEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEVGDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDLTELGAMMAEFPLDPQLAKMVIASCEYNCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNHESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRSTEFSSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHK-PEWVLYNEFVLTTKNYIRTCTDVKPEWLMRIAPQYYDLGN---FPQCEARRQLERIFAKLSSKE 730          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000006773.1 (SMESG000006773.1)

HSP 1 Score: 2051.17 bits (5313), Expect = 0.000e+0
Identity = 1128/1128 (100.00%), Postives = 1128/1128 (100.00%), Query Frame = 2
Query:  209 MPGSFLKNVFEITKRMSPKGGFKDYNEILKPKIIQTDATVKPNFEDPKLLEKKMKFPKLCRQNEGPIAIEVENSESYFSNLTSDTIKQINEVLEEEXXXXXXXXXXXXXXXXXXXXXXAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLERCDRQGYKYSRPETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTYHXXXXXXXXXXXXXXXXXXMAIENNRIKLSMKVVNQKTGKDLLEEFQQDKFRNPEKPDVYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNAXXXXXXXXXXXXXXXXPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALXXXXXXXXXXXXMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF 3592
            MPGSFLKNVFEITKRMSPKGGFKDYNEILKPKIIQTDATVKPNFEDPKLLEKKMKFPKLCRQNEGPIAIEVENSESYFSNLTSDTIKQINEVLEEEKKKSIKNDRRSRSKSDSRSRTRAHKRSRNDIDRKRSDRRKSRSRSKEYRKHRSNHRSRSKSLERCDRQGYKYSRPETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTYHVKDVKDVLAVKDKVYAKVMAIENNRIKLSMKVVNQKTGKDLLEEFQQDKFRNPEKPDVYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNADDESEEDIEIEIVEEDPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALQKQRRETKQQEKMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPRRVAAKSVAKRVAQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPKDKADAADQKKAKFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF
Sbjct:    1 MPGSFLKNVFEITKRMSPKGGFKDYNEILKPKIIQTDATVKPNFEDPKLLEKKMKFPKLCRQNEGPIAIEVENSESYFSNLTSDTIKQINEVLEEEKKKSIKNDRRSRSKSDSRSRTRAHKRSRNDIDRKRSDRRKSRSRSKEYRKHRSNHRSRSKSLERCDRQGYKYSRPETGKIYKGVVTSLRKNACIVHLTEFSGMVEGMVHISNLCTYHVKDVKDVLAVKDKVYAKVMAIENNRIKLSMKVVNQKTGKDLLEEFQQDKFRNPEKPDVYSNQLDEEYIQVNTKRKIQRMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNADDESEEDIEIEIVEEDPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALQKQRRETKQQEKMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKFSDVPEWKKYVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPRRVAAKSVAKRVAQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPKDKADAADQKKAKFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF 1128          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000052927.1 (SMESG000052927.1)

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 326/627 (51.99%), Postives = 451/627 (71.93%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFF-RNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFK 3460
            SI E ++SLP++K K +LL  I  NQ+L+V G+TG GK+TQ+ QY+   G    + IACTQPRRV A S+A RV++E    LG+ VGY+IRFE+ T+S TKI Y+TDG+L+RE   DP L  YSVIM+DEAHERTI TD LFG+LK     R DLKLI++SATL++ +FS+YF+ + IF+IPGR ++V++ +  + + +Y++  +  VM IH     GD+L+FL GQEEI+ CC +I  + +   ++ P+LLILP YSA+     S+IF P P + RK+V+ATNIAETSLTI GI YVIDPG VK KVYN   G+DQLI T +S+AQADQR GRAGR G G CYRL++E+ ++ +ML  +VPEIQR N+A+TVL LK++G+ D+  FDF++ P    L +AM EL  + AL + G LT+LG+ M+ FPL+P+L+K+LIMS    CSEEILTIV+ML V+  F +P ++   A+QKK + N+P+GDHITLL ++  W+++++S  WC  NFI+  ++K AQ++R QL+ IM R  LKI SCG      Q  I   +F RNAARK+P  GYRT+ D Q+V+IHPSSALF RQP WV+FH++++T ++Y+REVT I++ +L E  P  F+
Sbjct:   30 SIKEIQKSLPVYKCKVDLLSVIERNQILIVTGDTGCGKSTQIPQYLYNEGYASKRNIACTQPRRVGAISLANRVSEELNSQLGEIVGYSIRFENFTSSSTKIHYLTDGVLIREIQSDPLLKNYSVIMIDEAHERTIQTDALFGILKDLIKMRKDLKLIISSATLHAEEFSKYFYDAEIFKIPGRLYQVKIKFK-KSESEYIDEVVTKVMKIHKKHKLGDILVFLPGQEEIEACCNMIKKQNRYSDRNLPDLLILPAYSALVKKELSKIFQPTPKHCRKVVVATNIAETSLTIEGIIYVIDPGLVKLKVYNHMLGIDQLITTDVSRAQADQRAGRAGRVGKGVCYRLFSEKKYR-KMLEYSVPEIQRANLANTVLQLKSIGVIDVENFDFINPPGRDRLREAMKELTDIGALHESGSLTELGKSMSAFPLDPILSKILIMSSFKNCSEEILTIVAMLCVQNVFEKPANRISEANQKKQELNRPQGDHITLLYIYILWRDNQYSKGWCETNFIRYSTMKQAQNIRNQLVEIMIRCQLKIVSCGNRIVEAQNTISLYYFRRNAARKEPGNGYRTIADNQIVYIHPSSALFDRQPGWVVFHDIMITKEKYIREVTKINAFFLQELVPSTFQ 654          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000065130.1 (SMESG000065130.1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 330/663 (49.77%), Postives = 460/663 (69.38%), Query Frame = 2
Query: 1586 ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAE---AGLIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPP-GDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPN------ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTG----LIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTKLSQAKKSQQIEPLYNRFE 3532
            I ++R  LP+++ K+     +  NQ +V++GETGSGKTTQ+ Q+  E         K++ CTQPRRVAA SVA+RVA+E    LGQEVGY+IRFED T+++T +KY+TDGMLLRE + D  L +Y VI+LDEAHERT+ TD+L GLLK+    R DLK+++ SATL++ KF EYF  +P+ ++PGRT  VE+ Y+ EP++DYLEA++ TV+ IH+ E   GD+L+FLTGQEEID  C+ I   ++ LG D  EL  +P+YS +P + Q RIF+P PP        RK+V++TNIAETSLTI+G+ +VIDPGF KQKV+N +  ++ L+VTPIS+A A QR GRAGRT PGKC+RLYTE+ +  EM  N  PEI R+N+ + VL LK +GI+DL+ FDFMD P  +TL++A+  L+ L+ALDD+G LT LG  MAEFPL+P LAKM+I S    CS EIL+I +MLSV   F RP +   AAD+ K  F   +GDH+T+L V++A+K ++  + WCYD+F+  RSLK A +VR QL  IMDR++L+  S   ++      I+KA+VSGFF   A  +    Y T+ D Q+VH+HPS+ L H+ P+WV+++E VLTTK ++R V  +  +WLV+ AP+++  S+          + IE + NR +
Sbjct:   64 IYKRRIQLPVWEYKDYFFDVLTKNQAVVLVGETGSGKTTQIPQWCLEWVRENFSTRKEVGCTQPRRVAAMSVAQRVAEEMDVTLGQEVGYSIRFEDCTSNKTLMKYLTDGMLLREAMSDALLEKYGVILLDEAHERTLATDILMGLLKEVIKVRTDLKIVIMSATLDAGKFQEYFGNAPLMKVPGRTHPVEIFYTPEPEKDYLEAAIRTVIQIHMCEETEGDILVFLTGQEEIDEACKRIQREVENLGPDVGELKCIPLYSTLPPNLQQRIFEPPPPKKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVFNPRIRVESLLVTPISKASAQQRAGRAGRTRPGKCFRLYTEKGYNNEMHENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGGMMAEFPLDPQLAKMVIASCDFNCSNEILSITAMLSVPQCFVRPTEARTAADEAKMGFAHIDGDHLTMLNVYHAFKQNREDSQWCYDHFVNYRSLKAADNVRIQLSRIMDRFNLRRSSTDFSSKDYYVNIRKALVSGFFMQVAHLERSGHYLTVKDNQIVHLHPSTCLDHK-PEWVLYNEFVLTTKNFIRTVCEVKPEWLVKVAPQYYDMSN---FPPCAAKEIIERIINRLQ 722          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 320/633 (50.55%), Postives = 452/633 (71.41%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAG-LIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSA--LFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSD 3469
            +I + ++ LPI++LKNEL++ I +NQ++V+ GETGSGKTTQ+ QY+ EAG  +++K I CTQPRRVAA SVA RVAQE    LG +VGY++RFE   + +T+IKYMTDGMLLRE L DP +  YSV+++DEAHERT+ TD+LFGLL      R DLK+I++SAT +  KF + FF +P F+IPGR + VE  Y+ + + D++EA++ T++ IH+T+  GD+L+FLTGQE+I+   + +  RIKALG    EL++LP+YSA+PS+ Q++IF P PP ARK+V+ATNIAETSLTI+GI +VID G+ K K Y+ +S MD L V PI++A A QR GRAGR  PGKC+RLY +  F EE     +PEIQRTN+ + VL LK++GI D+L FD+MD P  ++L+ A+ EL+ LSA+D +G L+ +GRKM E P +PM++ M++ S   GCSEEI+TI +MLS++   FY PK+K   A Q    F Q EGDH+TLL V+N + N+ +S+ WC DN+IQ+RS+K A+++R QL+ + DR  LK+ S  ++T  I KAI +GFF N AR +  + YR +  +  V++  +S   +    P +V+F+ +V TTKEYMR  T I+ +WL + AP  +K  D
Sbjct:  226 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQ-FFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDID 856          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 320/633 (50.55%), Postives = 452/633 (71.41%), Query Frame = 2
Query: 1583 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAG-LIKNKKIACTQPXXXXXXXXXXXXXQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPA-FYRPXXXXXXXXXXXXXFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSA--LFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSD 3469
            +I + ++ LPI++LKNEL++ I +NQ++V+ GETGSGKTTQ+ QY+ EAG  +++K I CTQPRRVAA SVA RVAQE    LG +VGY++RFE   + +T+IKYMTDGMLLRE L DP +  YSV+++DEAHERT+ TD+LFGLL      R DLK+I++SAT +  KF + FF +P F+IPGR + VE  Y+ + + D++EA++ T++ IH+T+  GD+L+FLTGQE+I+   + +  RIKALG    EL++LP+YSA+PS+ Q++IF P PP ARK+V+ATNIAETSLTI+GI +VID G+ K K Y+ +S MD L V PI++A A QR GRAGR  PGKC+RLY +  F EE     +PEIQRTN+ + VL LK++GI D+L FD+MD P  ++L+ A+ EL+ LSA+D +G L+ +GRKM E P +PM++ M++ S   GCSEEI+TI +MLS++   FY PK+K   A Q    F Q EGDH+TLL V+N + N+ +S+ WC DN+IQ+RS+K A+++R QL+ + DR  LK+ S  ++T  I KAI +GFF N AR +  + YR +  +  V++  +S   +    P +V+F+ +V TTKEYMR  T I+ +WL + AP  +K  D
Sbjct:  170 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQ-FFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDID 800          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHX80.000e+064.98DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX80.000e+064.98DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX80.000e+064.18DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX160.000e+055.15DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX160.000e+054.99DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mog-50.000e+061.09Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-40.000e+054.69Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-10.000e+051.92Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-10.000e+051.92Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
ddx-150.000e+049.07Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pea0.000e+064.17gene:FBgn0086895 transcript:FBtr0087518[more]
l(2)37Cb0.000e+056.32gene:FBgn0086444 transcript:FBtr0081163[more]
l(1)G00070.000e+044.68gene:FBgn0026713 transcript:FBtr0073900[more]
Dhx150.000e+051.50gene:FBgn0033160 transcript:FBtr0336909[more]
Dhx150.000e+051.50gene:FBgn0033160 transcript:FBtr0088966[more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL833789.30.000e+064.68DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:N... [more]
dhx80.000e+064.68DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx80.000e+062.86DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx160.000e+057.94DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
dhx160.000e+057.94DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps15a0.000e+064.68ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a0.000e+064.68ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a0.000e+064.68ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a0.000e+064.68ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a0.000e+075.51ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx80.000e+064.98DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx80.000e+065.13DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx160.000e+055.19DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
Dhx380.000e+052.33DEAH (Asp-Glu-Ala-His) box polypeptide 38 [Source:... [more]
Dhx150.000e+050.75DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14562|DHX8_HUMAN0.000e+064.98ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX... [more]
sp|A2A4P0|DHX8_MOUSE0.000e+064.98ATP-dependent RNA helicase DHX8 OS=Mus musculus OX... [more]
sp|A1Z9L3|DHX8_DROME0.000e+064.17ATP-dependent RNA helicase DHX8 OS=Drosophila mela... [more]
sp|Q09530|MOG5_CAEEL0.000e+061.09Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
sp|Q38953|DEAH5_ARATH0.000e+058.90Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LBH40.000e+068.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YW230.000e+068.88ATP-dependent RNA helicase DHX8/PRP22 OS=Clonorchi... [more]
A0A3R7EZH90.000e+068.78ATP-dependent RNA helicase DHX8 (Fragment) OS=Clon... [more]
A0A4E0R3M30.000e+067.60Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
A0A4Z2CM880.000e+067.46ATP-dependent RNA helicase DHX8 OS=Schistosoma jap... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx80.000e+064.68DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx80.000e+064.68DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx160.000e+057.87DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx160.000e+057.87DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx160.000e+058.01DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx80.000e+072.19DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
zgc:1588281.451e-11537.30DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
dhx345.631e-9936.08DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
dhx332.180e-9542.01DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
dqx17.172e-8335.50DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP220.000e+048.31DEAH-box RNA-dependent ATPase/ATP-dependent RNA he... [more]
PRP430.000e+050.31RNA helicase in the DEAH-box family; functions in ... [more]
PRP160.000e+049.61DEAH-box RNA helicase involved in second catalytic... [more]
PRP21.998e-17845.80RNA-dependent DExD/H-box ATPase; required for acti... [more]
DHR27.954e-13839.33Predominantly nucleolar DEAH-box ATP-dependent RNA... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495600.000e+074.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325310.000e+048.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326295.783e-17356.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458618.269e-16146.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356224.662e-12257.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx80.000e+065.08DEAH-box helicase 8 [Source:NCBI gene;Acc:10116232... [more]
dhx160.000e+057.23DEAH-box helicase 16 [Source:NCBI gene;Acc:1011688... [more]
dhx380.000e+049.78DEAH-box helicase 38 [Source:NCBI gene;Acc:1011555... [more]
DHX150.000e+050.90DEAH-box helicase 15 [Source:NCBI gene;Acc:1053574... [more]
dhx150.000e+049.55pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006773.10.000e+0100.00SMESG000006773.1[more]
SMESG000052927.10.000e+051.99SMESG000052927.1[more]
SMESG000065130.10.000e+049.77SMESG000065130.1[more]
SMESG000030778.10.000e+050.55SMESG000030778.1[more]
SMESG000030778.10.000e+050.55SMESG000030778.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000473 ID=SMED30000473|Name=ATP-dependent RNA helicase DHX8|organism=Schmidtea mediterranea sexual|type=transcript|length=3625bp
TATATAAATCTTATATGATAACAATCAGATGAAAGGAGTTATTCTTTTGC
AGTTCCACAGCTTAATTAACAAAATCACCCAGGAAGTAGAAAATCACTTT
CATCTTGGGGATAAATCAAATTTAACTTCCAGATTTCTTATTTCACATGC
TTTAGAATCAGAATCTGAAAAAGATTTTATCGCAAAAGTTCCGAAAGCTG
CAGCATTTATGCCAGGATCTTTTCTCAAGAATGTTTTTGAAATTACTAAA
AGAATGTCACCTAAAGGAGGATTTAAAGATTATAATGAAATTTTGAAACC
CAAAATTATTCAGACTGATGCTACAGTGAAACCCAATTTCGAAGATCCCA
AACTGCTAGAGAAAAAAATGAAATTTCCAAAACTGTGTCGCCAAAATGAA
GGTCCCATTGCTATAGAGGTCGAAAATTCTGAGTCGTATTTTTCTAATTT
GACCTCCGACACCATCAAACAGATAAATGAAGTTTTGGAAGAAGAAAAGA
AAAAATCCATTAAAAATGATCGTAGAAGTCGCTCTAAATCAGACTCTCGA
TCAAGAACACGAGCTCACAAAAGAAGTAGAAATGACATTGATAGAAAGAG
AAGCGATAGAAGAAAATCCAGATCGAGATCGAAGGAATATAGAAAACATA
GAAGTAATCATCGAAGTCGATCGAAATCCTTAGAGAGATGCGATAGACAA
GGTTATAAATATAGTCGGCCGGAAACGGGAAAGATTTACAAAGGAGTTGT
TACGAGTCTACGAAAAAATGCTTGTATAGTTCATTTGACTGAGTTTTCTG
GAATGGTAGAAGGAATGGTTCATATATCAAATCTGTGCACATATCACGTG
AAAGACGTGAAAGATGTACTTGCTGTCAAGGACAAAGTCTATGCCAAAGT
CATGGCAATTGAAAATAATAGGATTAAGCTCAGTATGAAGGTTGTCAATC
AAAAAACCGGCAAAGATCTACTTGAAGAATTCCAACAAGACAAATTCCGA
AATCCGGAAAAACCCGACGTTTATAGTAATCAACTGGACGAGGAATATAT
CCAAGTAAACACTAAACGAAAAATCCAAAGAATGACCAGTCCAGAACGAT
GGGAACTACGCCAAATGGAAAATGCTGGCGTCCTGAAGATCACCGACCAT
CCTGATTATAGTGAAGATACAGGAGTGATGTTCAACGCCGATGACGAATC
CGAGGAGGATATAGAAATTGAAATCGTCGAAGAAGATCCGGCTTTTTTAA
AGGGACAATTCAACGAAGAATTAACACTATCTCCAGTGAGAATTGTGAAA
AACCCTGACGGCTCCCTGCAAAACGCTGCAATGATGCAATCGGCATTGCA
GAAACAGAGACGAGAAACGAAACAGCAAGAGAAAATGAATGAACAAATGT
CAAAAGTTTCCACGCAAAAAGTAACCGGAAAAGATTGGCACGATCCGGTA
ATGAAAGAATTTAACAATAACACAGGTTCTCGAATAAATCGAAATGAAAA
GTTCTCCGACGTCCCTGAATGGAAGAAATACGTCACCGGTGGAACTGGAG
GCCGTGGAGCATCGACCCAAATGCTCAATAAATCGATTCTCGAACAGAGG
CAGAGTTTGCCGATATTCAAATTGAAAAATGAGCTCCTACAAGCGATCAA
TGACAATCAGGTGTTGGTGGTTATCGGAGAAACCGGGAGTGGGAAAACTA
CACAAATGACTCAGTATATCGCAGAAGCCGGGCTGATAAAGAACAAAAAA
ATCGCCTGTACTCAACCGAGAAGAGTAGCAGCGAAATCCGTTGCCAAACG
AGTCGCACAAGAATTCGGTTGTTTATTAGGCCAGGAAGTCGGTTACACGA
TTCGATTCGAGGACATGACAACATCGGAAACGAAAATCAAATACATGACC
GATGGAATGTTGTTGCGGGAATGCCTGGTCGATCCGGAACTCAACCAGTA
CTCGGTAATCATGTTGGATGAGGCCCATGAGCGCACTATCCATACCGATG
TGTTGTTTGGACTACTGAAGAAAGCTGCCACTCAGAGAGATGATTTAAAA
TTGATTGTCACGTCGGCTACCTTGAATTCCGTTAAGTTCTCGGAATATTT
CTTCGGCTCTCCGATTTTTCGAATTCCCGGGCGCACTTTTGAAGTGGAAG
TTCTTTATAGCGTTGAACCGCAACAGGACTATCTGGAGGCAAGTTTGAAC
ACTGTGATGCATATCCACTTGACAGAACCGCCCGGGGACATGCTGCTGTT
TCTCACTGGTCAAGAGGAGATCGATACTTGCTGTGAGATAATCTACAACC
GGATCAAAGCTCTCGGTCAGGATTGCCCGGAACTGTTGATTTTGCCGGTG
TATTCTGCAATGCCGTCCGATCACCAGTCGAGAATATTCGATCCCGCTCC
TCCGAATGCGCGGAAACTCGTTATCGCAACCAATATCGCAGAAACCAGTT
TGACAATCAACGGAATATATTACGTCATCGATCCGGGATTTGTCAAGCAA
AAGGTATACAACAGCAAATCAGGAATGGATCAACTAATCGTTACACCGAT
CTCACAGGCCCAAGCCGATCAGCGCAAAGGCAGAGCCGGTAGAACGGGAC
CCGGCAAATGTTATCGACTTTACACCGAGCGAGCGTTCAAAGAGGAAATG
TTACCAAATAACGTTCCGGAAATCCAAAGGACCAACATGGCCAGCACTGT
GTTGGCGTTGAAAGCTATGGGAATCAATGATCTGTTGACATTCGACTTTA
TGGACGCGCCTCCCTCCCAAACCCTTGTGAAAGCAATGAGTGAATTGCAT
GCTCTCTCTGCATTGGACGATGAAGGGCTGCTGACGAAACTCGGCCGGAA
AATGGCGGAATTCCCATTGGAGCCGATGTTGGCAAAAATGTTGATTATGT
CGGTCCATTTGGGATGCAGCGAAGAAATCCTCACAATTGTCTCGATGTTG
AGTGTTGAACCGGCATTCTATCGACCGAAAGACAAAGCCGATGCAGCCGA
TCAAAAGAAAGCGAAATTCAACCAACCGGAAGGCGATCATATAACTCTAC
TGGCGGTGTTCAACGCTTGGAAAAACAGCAAATTCTCCACTCCCTGGTGT
TACGATAACTTCATTCAGGCTCGCTCATTGAAACATGCCCAGGACGTCCG
AAAGCAATTGCTCGGTATTATGGACAGGTACTCGTTGAAGATTCGATCTT
GTGGCAAAAATACCGGCTTGATTCAGAAAGCAATTGTTTCAGGATTCTTT
CGAAATGCTGCTAGGAAAGATCCCCAAGAAGGATACCGGACTCTTGTCGA
TCAACAGGTCGTTCATATCCATCCATCGAGTGCACTGTTTCATCGACAGC
CGGACTGGGTGATTTTCCATGAGCTGGTTTTGACAACGAAAGAGTACATG
AGAGAAGTGACAACGATCGACTCGAAATGGCTTGTGGAATTCGCCCCGAA
ATTCTTCAAATTTTCCGATCCGACGAAGCTTAGTCAGGCGAAGAAATCAC
AGCAAATTGAACCGCTATATAATAGATTTGAAGAAAAAGATTCGTGGAGA
ATTTCGAGAGCTCAAAAGAAGTTTCATGTTAAAGTTACTTTTTAAATTAG
ACATAATAAACTGTGCTGTTGTCCG
back to top

protein sequence of SMED30000473-orf-1

>SMED30000473-orf-1 ID=SMED30000473-orf-1|Name=SMED30000473-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1189bp
MKGVILLQFHSLINKITQEVENHFHLGDKSNLTSRFLISHALESESEKDF
IAKVPKAAAFMPGSFLKNVFEITKRMSPKGGFKDYNEILKPKIIQTDATV
KPNFEDPKLLEKKMKFPKLCRQNEGPIAIEVENSESYFSNLTSDTIKQIN
EVLEEEKKKSIKNDRRSRSKSDSRSRTRAHKRSRNDIDRKRSDRRKSRSR
SKEYRKHRSNHRSRSKSLERCDRQGYKYSRPETGKIYKGVVTSLRKNACI
VHLTEFSGMVEGMVHISNLCTYHVKDVKDVLAVKDKVYAKVMAIENNRIK
LSMKVVNQKTGKDLLEEFQQDKFRNPEKPDVYSNQLDEEYIQVNTKRKIQ
RMTSPERWELRQMENAGVLKITDHPDYSEDTGVMFNADDESEEDIEIEIV
EEDPAFLKGQFNEELTLSPVRIVKNPDGSLQNAAMMQSALQKQRRETKQQ
EKMNEQMSKVSTQKVTGKDWHDPVMKEFNNNTGSRINRNEKFSDVPEWKK
YVTGGTGGRGASTQMLNKSILEQRQSLPIFKLKNELLQAINDNQVLVVIG
ETGSGKTTQMTQYIAEAGLIKNKKIACTQPRRVAAKSVAKRVAQEFGCLL
GQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAH
ERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIP
GRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDT
CCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIA
TNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRK
GRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGIN
DLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPM
LAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPKDKADAADQKKAKFNQP
EGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDR
YSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPS
SALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSDPTK
LSQAKKSQQIEPLYNRFEEKDSWRISRAQKKFHVKVTF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR007502Helicase-assoc_dom
IPR022967S1_dom
IPR001650Helicase_C
IPR011545DEAD/DEAH_box_helicase_dom
IPR003029S1_domain
IPR011709DUF1605
IPR027417P-loop_NTPase
IPR012340NA-bd_OB-fold
IPR002464DNA/RNA_helicase_DEAH_CS
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0008026ATP-dependent helicase activity
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0016787hydrolase activity
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005681spliceosomal complex
GO:0005737cytoplasm
GO:0016604nuclear body
GO:0071013catalytic step 2 spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 380..400
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 169..255
e-value: 1.6E-20
score: 75.0
NoneNo IPR availableGENE3DG3DSA:1.20.120.1080coord: 943..999
e-value: 1.0E-5
score: 27.2
coord: 841..942
e-value: 2.7E-33
score: 116.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 643..817
e-value: 1.5E-69
score: 235.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 446..642
e-value: 8.2E-86
score: 288.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 383..407
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..165
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..111
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 134..154
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 119..133
NoneNo IPR availablePANTHERPTHR18934ATP-DEPENDENT RNA HELICASEcoord: 164..1117
NoneNo IPR availablePANTHERPTHR18934:SF120coord: 164..1117
NoneNo IPR availableCDDcd17971DEXHc_DHX8coord: 462..640
e-value: 2.20463E-111
score: 342.155
NoneNo IPR availableCDDcd18791SF2_C_RHAcoord: 644..805
e-value: 1.76644E-80
score: 258.232
IPR022967RNA-binding domain, S1SMARTSM00316S1_6coord: 172..244
e-value: 7.7E-13
score: 58.7
IPR007502Helicase-associated domainSMARTSM00847ha2_5coord: 858..948
e-value: 3.9E-38
score: 142.7
IPR007502Helicase-associated domainPFAMPF04408HA2coord: 859..947
e-value: 7.0E-24
score: 84.2
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 465..649
e-value: 2.5E-30
score: 116.7
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 477..640
score: 19.349
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 693..797
e-value: 7.3E-17
score: 72.0
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 668..797
e-value: 4.3E-11
score: 43.2
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 662..838
score: 16.564
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 474..623
e-value: 2.2E-8
score: 34.1
IPR003029S1 domainPFAMPF00575S1coord: 170..243
e-value: 2.7E-9
score: 37.2
IPR003029S1 domainPROSITEPS50126S1coord: 174..244
score: 15.746
IPR011709Domain of unknown function DUF1605PFAMPF07717OB_NTP_bindcoord: 1005..1081
e-value: 1.9E-23
score: 82.6
IPR002464DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved sitePROSITEPS00690DEAH_ATP_HELICASEcoord: 582..591
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 455..991
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 165..246