Dynamin-1-like protein

Overview
NameDynamin-1-like protein
Smed IDSMED30000459
Length (bp)2381
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-1-like protein (SMED30000459) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-1-like protein (SMED30000459) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-1-like protein (SMED30000459) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-1-like protein (SMED30000459) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000459

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30000459h1SMcG0006950 Contig721GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000459h1SMcG0006950 Contig721GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30000459h1SMcG0013705 Contig721GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000459h1SMcG0013705 Contig721GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30000459h1SMcG0013705 PL030004B10H05smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30000459h1SMcG0013705 PL030004B10H05smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000459h1SMcG0013705 PL030004B10H05smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30000459h1SMcG0006950 Contig721GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000459h1SMcG0013705 Contig721GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30000459h1SMcG0013705 dd_Smed_v4_388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000459h1SMcG0013705 dd_Smed_v4_388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000459h1SMcG0013705 dd_Smed_v4_388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000459h1SMcG0013705 dd_Smed_v4_388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000459h1SMcG0013705 dd_Smed_v4_388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000459h1SMcG0013705 Contig53685uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000459h1SMcG0013705 Contig53685newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000459h1SMcG0013705 Contig33335uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000459h1SMcG0013705 Contig33335newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30000459h1SMcG0013705 dd_Smed_v6_388_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000459h1SMcG0013705 dd_Smed_v6_388_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000459h1SMcG0013705 SMED30000459smed_20140614PMID:24950970
Talbot et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 423.32 bits (1087), Expect = 6.177e-137
Identity = 278/753 (36.92%), Postives = 421/753 (55.91%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--DPDGSKGT----------RGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEP---DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDL--IQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH    D  K T           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R   D LI               QD  R      E+ NV+     +    + EP   + +G++     + L  +    +++K + I    +P+     +L  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSR---DKLI---------------QDSRR------ETKNVASGGGGVGDGVQ-EPTTGNWRGMLKTSKAEELLAE----EKSKPIPIMPA-SPQKGHAVNLLDVPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 710          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 424.476 bits (1090), Expect = 6.964e-137
Identity = 275/768 (35.81%), Postives = 423/768 (55.08%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------------DPDGSKGTR-----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIH--YLESGNVSLRVMEILQSREIEP---DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDL--IQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH              DP   K +R           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R     +         +  P    +    +I     E+ NV+     +    + EP   + +G++     + L  +    +++K + I    +P+     +L  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQ-EPTTGNWRGMLKTSKAEELLAE----EKSKPIPIMPA-SPQKGHAVNLLDVPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 749          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 424.091 bits (1089), Expect = 7.654e-137
Identity = 274/755 (36.29%), Postives = 421/755 (55.76%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--DPDGSKGT----------RGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIH--YLESGNVSLRVMEILQSREIEP---DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDL--IQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH    D  K T           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R     +         +  P    +    +I     E+ NV+     +    + EP   + +G++     + L  +    +++K + I    +P+     +L  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQ-EPTTGNWRGMLKTSKAEELLAE----EKSKPIPIMPA-SPQKGHAVNLLDVPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 736          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 394.43 bits (1012), Expect = 1.022e-125
Identity = 224/537 (41.71%), Postives = 323/537 (60.15%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------------DPDGSKGTR-----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLA 1682
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH              DP   K +R           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLA 534          

HSP 2 Score: 58.9214 bits (141), Expect = 3.359e-8
Identity = 36/106 (33.96%), Postives = 62/106 (58.49%), Query Frame = 3
Query: 2037 ELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            +L+ R  +D E  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:  611 KLSAREQRDCE--VIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 712          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 393.66 bits (1010), Expect = 1.215e-125
Identity = 223/524 (42.56%), Postives = 321/524 (61.26%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--DPDGSKGT----------RGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLA 1682
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH    D  K T           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLA 521          

HSP 2 Score: 58.9214 bits (141), Expect = 3.416e-8
Identity = 36/106 (33.96%), Postives = 62/106 (58.49%), Query Frame = 3
Query: 2037 ELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            +L+ R  +D E  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:  598 KLSAREQRDCE--VIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 699          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 373.244 bits (957), Expect = 3.762e-118
Identity = 219/505 (43.37%), Postives = 308/505 (60.99%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMP--FIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP--DGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL--GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEA--SKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP++N+LQD ++ L      I LPQIV++GSQSAGKSSVLEN+V ++FLPRGTGIVTR PL+L L H    D SK  R            F HTG K + DF  +++EI  +TD + G  K IS  PI+LKIYSH   +L+L+DLPG+TK+ V  QP +I+ QI+   L +    +SIILA++ AN D A S+ ++ A E+D  G+RTL V+TKLDLMD+GT A D+L+GKV+P +LG IGVV+RSQ++IL  K I +++  E+ F  K Y  +AS+NGT +L + LNMLL  HI+ CLP LK   R  I +AQ + DL+  G  ++DK   + + +TRF+ AY    +G        ++ GGA I  I ++ F   L  ++    LT   I+T IRN  GP    F  + +F  LVK QIQ+L  PS  C++ V++ +Q  VQ    +    +  FP L  +I E    ++K+  K T  L+ENL+  E + I   HP +
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKA--RVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 54.299 bits (129), Expect = 3.472e-7
Identity = 35/112 (31.25%), Postives = 67/112 (59.82%), Query Frame = 3
Query: 1968 NPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLE 2300
            +P+ K   + +    + QL ++  LT R  +D   +I+  L+  YF +VR+NI   +PK I + LV  +++NL + L + +Y   ++D LL E+ED++++R+ T E ++ L+
Sbjct:  583 SPQEKQSANFLPEVPETQLGRK--LTSREQRD--VAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQ 690          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 373.244 bits (957), Expect = 3.762e-118
Identity = 219/505 (43.37%), Postives = 308/505 (60.99%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMP--FIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP--DGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL--GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEA--SKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP++N+LQD ++ L      I LPQIV++GSQSAGKSSVLEN+V ++FLPRGTGIVTR PL+L L H    D SK  R            F HTG K + DF  +++EI  +TD + G  K IS  PI+LKIYSH   +L+L+DLPG+TK+ V  QP +I+ QI+   L +    +SIILA++ AN D A S+ ++ A E+D  G+RTL V+TKLDLMD+GT A D+L+GKV+P +LG IGVV+RSQ++IL  K I +++  E+ F  K Y  +AS+NGT +L + LNMLL  HI+ CLP LK   R  I +AQ + DL+  G  ++DK   + + +TRF+ AY    +G        ++ GGA I  I ++ F   L  ++    LT   I+T IRN  GP    F  + +F  LVK QIQ+L  PS  C++ V++ +Q  VQ    +    +  FP L  +I E    ++K+  K T  L+ENL+  E + I   HP +
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKA--RVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 54.299 bits (129), Expect = 3.472e-7
Identity = 35/112 (31.25%), Postives = 67/112 (59.82%), Query Frame = 3
Query: 1968 NPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLE 2300
            +P+ K   + +    + QL ++  LT R  +D   +I+  L+  YF +VR+NI   +PK I + LV  +++NL + L + +Y   ++D LL E+ED++++R+ T E ++ L+
Sbjct:  583 SPQEKQSANFLPEVPETQLGRK--LTSREQRD--VAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQ 690          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 373.244 bits (957), Expect = 3.762e-118
Identity = 219/505 (43.37%), Postives = 308/505 (60.99%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMP--FIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP--DGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL--GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEA--SKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP++N+LQD ++ L      I LPQIV++GSQSAGKSSVLEN+V ++FLPRGTGIVTR PL+L L H    D SK  R            F HTG K + DF  +++EI  +TD + G  K IS  PI+LKIYSH   +L+L+DLPG+TK+ V  QP +I+ QI+   L +    +SIILA++ AN D A S+ ++ A E+D  G+RTL V+TKLDLMD+GT A D+L+GKV+P +LG IGVV+RSQ++IL  K I +++  E+ F  K Y  +AS+NGT +L + LNMLL  HI+ CLP LK   R  I +AQ + DL+  G  ++DK   + + +TRF+ AY    +G        ++ GGA I  I ++ F   L  ++    LT   I+T IRN  GP    F  + +F  LVK QIQ+L  PS  C++ V++ +Q  VQ    +    +  FP L  +I E    ++K+  K T  L+ENL+  E + I   HP +
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKA--RVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 54.299 bits (129), Expect = 3.472e-7
Identity = 35/112 (31.25%), Postives = 67/112 (59.82%), Query Frame = 3
Query: 1968 NPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLE 2300
            +P+ K   + +    + QL ++  LT R  +D   +I+  L+  YF +VR+NI   +PK I + LV  +++NL + L + +Y   ++D LL E+ED++++R+ T E ++ L+
Sbjct:  583 SPQEKQSANFLPEVPETQLGRK--LTSREQRD--VAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQ 690          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 372.859 bits (956), Expect = 6.496e-118
Identity = 219/505 (43.37%), Postives = 308/505 (60.99%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMP--FIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP--DGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL--GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEA--SKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP++N+LQD ++ L      I LPQIV++GSQSAGKSSVLEN+V ++FLPRGTGIVTR PL+L L H    D SK  R            F HTG K + DF  +++EI  +TD + G  K IS  PI+LKIYSH   +L+L+DLPG+TK+ V  QP +I+ QI+   L +    +SIILA++ AN D A S+ ++ A E+D  G+RTL V+TKLDLMD+GT A D+L+GKV+P +LG IGVV+RSQ++IL  K I +++  E+ F  K Y  +AS+NGT +L + LNMLL  HI+ CLP LK   R  I +AQ + DL+  G  ++DK   + + +TRF+ AY    +G        ++ GGA I  I ++ F   L  ++    LT   I+T IRN  GP    F  + +F  LVK QIQ+L  PS  C++ V++ +Q  VQ    +    +  FP L  +I E    ++K+  K T  L+ENL+  E + I   HP +
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKA--RVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 54.299 bits (129), Expect = 3.457e-7
Identity = 35/112 (31.25%), Postives = 67/112 (59.82%), Query Frame = 3
Query: 1968 NPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLE 2300
            +P+ K   + +    + QL ++  LT R  +D   +I+  L+  YF +VR+NI   +PK I + LV  +++NL + L + +Y   ++D LL E+ED++++R+ T E ++ L+
Sbjct:  590 SPQEKQSANFLPEVPETQLGRK--LTSREQRD--VAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQ 697          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 372.859 bits (956), Expect = 6.496e-118
Identity = 219/505 (43.37%), Postives = 308/505 (60.99%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMP--FIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP--DGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL--GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEA--SKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP++N+LQD ++ L      I LPQIV++GSQSAGKSSVLEN+V ++FLPRGTGIVTR PL+L L H    D SK  R            F HTG K + DF  +++EI  +TD + G  K IS  PI+LKIYSH   +L+L+DLPG+TK+ V  QP +I+ QI+   L +    +SIILA++ AN D A S+ ++ A E+D  G+RTL V+TKLDLMD+GT A D+L+GKV+P +LG IGVV+RSQ++IL  K I +++  E+ F  K Y  +AS+NGT +L + LNMLL  HI+ CLP LK   R  I +AQ + DL+  G  ++DK   + + +TRF+ AY    +G        ++ GGA I  I ++ F   L  ++    LT   I+T IRN  GP    F  + +F  LVK QIQ+L  PS  C++ V++ +Q  VQ    +    +  FP L  +I E    ++K+  K T  L+ENL+  E + I   HP +
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKA--RVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEF 503          

HSP 2 Score: 54.299 bits (129), Expect = 3.457e-7
Identity = 35/112 (31.25%), Postives = 67/112 (59.82%), Query Frame = 3
Query: 1968 NPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLE 2300
            +P+ K   + +    + QL ++  LT R  +D   +I+  L+  YF +VR+NI   +PK I + LV  +++NL + L + +Y   ++D LL E+ED++++R+ T E ++ L+
Sbjct:  590 SPQEKQSANFLPEVPETQLGRK--LTSREQRD--VAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQ 697          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: Drp1 (gene:FBgn0026479 transcript:FBtr0077744)

HSP 1 Score: 397.127 bits (1019), Expect = 8.150e-127
Identity = 261/752 (34.71%), Postives = 411/752 (54.65%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP-------DGSKGTR-----GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAF--PIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSRE-IEPDQKGIMLDEIFD--RLFHDCPEIQENKVVIINTILNP--EYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++GSQS+GKSSV+E++V + FLPRGTGIVTR PL+L L++ P           GT      GRFLHT  K + DF +I++EI  +T+  AG  K I  +PI LKI+S    NLTL+DLPG+TKV V  QP+DI+ QIK   L++    NSIILA++AAN D+A S++L+ A+++DP+G+RTL V+TKLDLMD GT A DIL G+V+P +LG IGV++RSQ+DI+  K I++ +  E  F  + Y  +A++NGT +L ++LN LL  HI+ CLP+LK   R  I + Q++  L+  G ++ DK   + + +T+FS+AY    +G        ++ GGA +  I +E F   L  I   + L+   I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ +++ +Q  VQ         +  FP L ++I++    L+++    T  ++EN++  E + I   HP++     L   +  +  ++  + +N          N +      I  +  G+ Q   +       S     +V E     E   P      L  I        D  E   N   + N I++P        D+  +    +L+ +E+         +  ++  L+  YF +VR++I   +PK I  FLV ++K+NL + L  ++Y     ++LL ES+ I+ +RK   ++++ L      I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVLQLIYSPLDDRENRSAENGTSNAEEWGRFLHT-KKCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVMNRSQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLK--TRVNIMATQFQSLLNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELIHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVENIVAIELAYINTKHPDFHKDAALVP-SLLKTDSDPYSQINLGQRRANTPRNHMSPQ---ISSHSAGSQQPQQQQPPQPNSSQQQYSQVHEQNHVAENSTPSMASTWLSNILPPAPTRPDSIENSTNNTPVHNNIVSPVKPVNLLPDVPANHNPRRLTDKEQ--------KDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQSELVTHLYKSDKAETLLNESDHIAVRRKEAADMLKALTRANHIISEIRETH--MW 735          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: Drp1 (gene:FBgn0026479 transcript:FBtr0335173)

HSP 1 Score: 397.127 bits (1019), Expect = 8.150e-127
Identity = 261/752 (34.71%), Postives = 411/752 (54.65%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP-------DGSKGTR-----GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAF--PIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSRE-IEPDQKGIMLDEIFD--RLFHDCPEIQENKVVIINTILNP--EYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++GSQS+GKSSV+E++V + FLPRGTGIVTR PL+L L++ P           GT      GRFLHT  K + DF +I++EI  +T+  AG  K I  +PI LKI+S    NLTL+DLPG+TKV V  QP+DI+ QIK   L++    NSIILA++AAN D+A S++L+ A+++DP+G+RTL V+TKLDLMD GT A DIL G+V+P +LG IGV++RSQ+DI+  K I++ +  E  F  + Y  +A++NGT +L ++LN LL  HI+ CLP+LK   R  I + Q++  L+  G ++ DK   + + +T+FS+AY    +G        ++ GGA +  I +E F   L  I   + L+   I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ +++ +Q  VQ         +  FP L ++I++    L+++    T  ++EN++  E + I   HP++     L   +  +  ++  + +N          N +      I  +  G+ Q   +       S     +V E     E   P      L  I        D  E   N   + N I++P        D+  +    +L+ +E+         +  ++  L+  YF +VR++I   +PK I  FLV ++K+NL + L  ++Y     ++LL ES+ I+ +RK   ++++ L      I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVLQLIYSPLDDRENRSAENGTSNAEEWGRFLHT-KKCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVMNRSQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLK--TRVNIMATQFQSLLNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELIHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVENIVAIELAYINTKHPDFHKDAALVP-SLLKTDSDPYSQINLGQRRANTPRNHMSPQ---ISSHSAGSQQPQQQQPPQPNSSQQQYSQVHEQNHVAENSTPSMASTWLSNILPPAPTRPDSIENSTNNTPVHNNIVSPVKPVNLLPDVPANHNPRRLTDKEQ--------KDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQSELVTHLYKSDKAETLLNESDHIAVRRKEAADMLKALTRANHIISEIRETH--MW 735          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301597)

HSP 1 Score: 345.125 bits (884), Expect = 5.189e-106
Identity = 258/748 (34.49%), Postives = 396/748 (52.94%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYE--KFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVS------------LRVMEILQSREIE----------------PDQKGIMLDEIFDRLFHDC---PEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNR--LQNIYSHCDLDSLLQESEDISKQRK 2270
            MD LI I+N+LQD ++ L +   +DLPQI ++G QSAGKSSVLEN V ++FLPRG+GIVTR PL+L L++         G FLH   K +  F +I++EI  +TD + G  K IS+ PI L++YS    NLTLIDLPGLTKVA+  QP DI+ QIK    +F RKE  +ILA++ AN DLANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT ARDIL  K+LP + GYIGVV+RSQ+DI   K I ++L  E++FF  H  Y  +A + GT +L R LN  L  HI+  LP L++ +++++ + + +++           IK K +L  I +  + F     I   G    N N++ GGA I++I +E  +F  + M  D E  L  ++    IRN  G     F+   AF  +VK QI  L  P   C+D V   +   V+  +    +  +P L +E        ++Q     K  I  LI  E + +  +H ++ +GF         A A+N +        RQ+ + +I  G  +I QN+ G  +  SR     L S ++S            +  ++ L+ R+IE                PD + +  D  + +L   C    +++  K   +   + PE +   +    E + Q S  EE +  P  + +   +R LV  Y  +V +     +PK I   L+I+  ++ +N   L ++Y+  D   +++ES + + +R+
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIN----GVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERT--IEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACD-EKELRREISF-AIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAK--MSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDF-IGF---------ANAQNKSENANKTGTRQLGNQVIRKGHMVI-QNL-GIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKD--YKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIM-MLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRRE 723          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301596)

HSP 1 Score: 345.51 bits (885), Expect = 9.359e-106
Identity = 259/748 (34.63%), Postives = 396/748 (52.94%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYE--KFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVS------------LRVMEILQSREIE----------------PDQKGIMLDEIFDRLFHDC---PEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNR--LQNIYSHCDLDSLLQESEDISKQRK 2270
            MD LI I+N+LQD ++ L +   +DLPQI ++G QSAGKSSVLEN V ++FLPRG+GIVTR PL+L L++         G FLH   K +  F +I++EI  +TD + G  K IS+ PI L++YS    NLTLIDLPGLTKVA+  QP DI+ QIK    +F RKE  +ILA++ AN DLANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT ARDIL  K+LP + GYIGVV+RSQ+DI   K I ++L  E++FF  H  Y  +A + GT +L R LN  L  HI+  LP L++ +++++ + + +++           IK K +L  I +  + F     I   G    N N++ GGA I++I +E  +F  + M  D E  L  + I   IRN  G     F+   AF  +VK QI  L  P   C+D V   +   V+  +    +  +P L +E        ++Q     K  I  LI  E + +  +H ++ +GF         A A+N +        RQ+ + +I  G  +I QN+ G  +  SR     L S ++S            +  ++ L+ R+IE                PD + +  D  + +L   C    +++  K   +   + PE +   +    E + Q S  EE +  P  + +   +R LV  Y  +V +     +PK I   L+I+  ++ +N   L ++Y+  D   +++ES + + +R+
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIN----GVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERT--IEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACD-EKELRRE-ISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAK--MSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDF-IGF---------ANAQNKSENANKTGTRQLGNQVIRKGHMVI-QNL-GIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKD--YKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIM-MLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRRE 723          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074122)

HSP 1 Score: 332.798 bits (852), Expect = 2.010e-101
Identity = 256/748 (34.22%), Postives = 394/748 (52.67%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYE--KFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVS------------LRVMEILQSREIE----------------PDQKGIMLDEIFDRLFHDC---PEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNR--LQNIYSHCDLDSLLQESEDISKQRK 2270
            MD LI I+N+LQD ++ L +   +DLPQI ++G QSAGKSSVLEN V ++FLPRG+GIVTR PL+L L++         G FLH   K +  F +I++EI  +TD + G  K IS+ PI L++YS    NLTLIDLPGLTKVA+  QP DI+ QIK    +F RKE  +ILA++ AN DLANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT ARDIL  K+LP + GYIGVV+RSQ+DI   K I ++L  E++FF  H  Y  +A + GT +L R LN  L  HI+  LP L++ +++++ + + +++           IK K +L  I +  + F     I   G    N N++ GGA I++I +E  +F  + M  D E  L  ++    IRN  G     F+   AF  +VK QI  L  P   C+D V   +   V+  +    +  +P L +E        ++Q     K  I  LI  E + +  +H ++ +GF         A A+N +        RQ+ + +I  G  +I QN+ G  +  SR     L S ++S            +  ++ L+ R+IE                PD + +  D  + +L   C    +++  K   +   + PE +      + +     S  EE +  P  + +   +R LV  Y  +V +     +PK I   L+I+  ++ +N   L ++Y+  D   +++ES + + +R+
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIN----GVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERT--IEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACD-EKELRREISF-AIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAK--MSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDF-IGF---------ANAQNKSENANKTGTRQLGNQVIRKGHMVI-QNL-GIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKD--YKQLELSCETVEDVESWKASFLRAGVYPEKQ------ETQENGDESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAI-MMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRRE 717          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:393896])

HSP 1 Score: 422.55 bits (1085), Expect = 4.457e-137
Identity = 269/747 (36.01%), Postives = 411/747 (55.02%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH DP+  + T           G+FLHT +K Y DF +I++EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   L++    NSIILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + SAQY+  L   G  ++D    + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +  +  +      +D + G G +   +   G +    R M+   + G    +    LQS      QKG  ++        D P                               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLHTKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSVP----RDKMAG-GAQAEQEGGTGTW----RGMLKKGDEGQGEEKTK--LQSSIPASPQKGHAVN------LLDVPV--------------------------PVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETH--LW 691          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:393896])

HSP 1 Score: 421.779 bits (1083), Expect = 1.833e-136
Identity = 268/751 (35.69%), Postives = 417/751 (55.53%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIIC----QNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH DP+  + T           G+FLHT +K Y DF +I++EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   L++    NSIILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + SAQY+  L   G  ++D    + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +  +  +    +   +L G G + +      +  G+    +       E G  + R M + +  E + ++K  +   I           Q+   V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLHTKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSVPRDK---SLKGPGGQSMSPTDQPSAEGDGPKMAGGAQAEQEGGTGTWRGM-LKKGDEGQGEEKTKLQSSI-------PASPQKGHAVNLLDVPVP------------VARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETH--LW 715          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: si:dkey-32e23.4 (si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-41])

HSP 1 Score: 360.147 bits (923), Expect = 2.301e-113
Identity = 210/531 (39.55%), Postives = 317/531 (59.70%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP--------DGSKGTR---------------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQY--KLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY-ELGFVLQKMNFFEAKA 1670
            M+ LIPIIN LQ+ +  +    I LPQIV++GSQS+GKSSVLE++V ++FLPRG+GIVTR PL+L LV+ P        D   G++               G FLH  ++ + DF++I++EI  +TD  +   K IS +PI LKIYS    +LTL+DLPG+TKV V  QP+DI++Q++   L +    NS+IL +S AN DLA SD+L+ A E+D +G+RTL V++KLDLMD GT A ++L+G+V+P +LG IGVV+RSQ D+   K + +S   E+ F  +HY  +AS+ G+ +L R+L+ LL  HI+ CLP LK   R  + +AQY  +L+  G  ++D    + + +T+F+  Y    +G       +++ GGA +  I +E F   L  ID    LT   I+T IRN  GP    F  + +F  LVK+QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   IT  ++ NL+  E + I   HP++ +   V   +N  +A+A
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKQDNGNGSKQNSQNNYPGIKAEEWGTFLHCKNQIFTDFNEIRKEIEEETD-RSTNNKGISKEPIYLKIYSPNVLSLTLVDLPGITKVPVGDQPEDIEIQVQEMILSYISNPNSLILCVSPANSDLATSDALKLAREVDADGRRTLLVVSKLDLMDAGTDALEVLLGRVIPVRLGIIGVVNRSQHDLNTQKSLSDSCRDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELK--TRVTVLTAQYQSRLNSYGQPVEDHSATLLQIVTKFATDYCSTIEGTARHIQTSELCGGARMCYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKKQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTGLLRKRLPITNEMVHNLVAIELAYINTKHPDFTDAAQVSASVNSQQAEA 528          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: si:dkey-32e23.4 (si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-41])

HSP 1 Score: 360.147 bits (923), Expect = 2.301e-113
Identity = 210/531 (39.55%), Postives = 317/531 (59.70%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP--------DGSKGTR---------------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQY--KLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY-ELGFVLQKMNFFEAKA 1670
            M+ LIPIIN LQ+ +  +    I LPQIV++GSQS+GKSSVLE++V ++FLPRG+GIVTR PL+L LV+ P        D   G++               G FLH  ++ + DF++I++EI  +TD  +   K IS +PI LKIYS    +LTL+DLPG+TKV V  QP+DI++Q++   L +    NS+IL +S AN DLA SD+L+ A E+D +G+RTL V++KLDLMD GT A ++L+G+V+P +LG IGVV+RSQ D+   K + +S   E+ F  +HY  +AS+ G+ +L R+L+ LL  HI+ CLP LK   R  + +AQY  +L+  G  ++D    + + +T+F+  Y    +G       +++ GGA +  I +E F   L  ID    LT   I+T IRN  GP    F  + +F  LVK+QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   IT  ++ NL+  E + I   HP++ +   V   +N  +A+A
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKQDNGNGSKQNSQNNYPGIKAEEWGTFLHCKNQIFTDFNEIRKEIEEETD-RSTNNKGISKEPIYLKIYSPNVLSLTLVDLPGITKVPVGDQPEDIEIQVQEMILSYISNPNSLILCVSPANSDLATSDALKLAREVDADGRRTLLVVSKLDLMDAGTDALEVLLGRVIPVRLGIIGVVNRSQHDLNTQKSLSDSCRDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELK--TRVTVLTAQYQSRLNSYGQPVEDHSATLLQIVTKFATDYCSTIEGTARHIQTSELCGGARMCYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKKQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTGLLRKRLPITNEMVHNLVAIELAYINTKHPDFTDAAQVSASVNSQQAEA 528          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm2a (dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84])

HSP 1 Score: 350.517 bits (898), Expect = 8.555e-109
Identity = 252/737 (34.19%), Postives = 405/737 (54.95%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNV-YDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNI-PGNFQDF-----SRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDE----IFD----RLFHDCPEI------QEN----KVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNR-LQNIYSHCDLDSLLQESEDISKQR 2267
            M++LIP+IN+LQD +S +     +DLPQI ++G QSAGKSSVLEN V ++FLPRG+GIVTR PL+L LV++    K     FLH   + + DF ++++EI  +TD + G  K IS  PI L++YS    NLTLIDLPG+TKVAV  QP DI+ QI++  ++F  +E+ +ILA++ AN+DLANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT ARDIL  K+LP + GYIGVV+RSQ+DI   K I  +L  E++FF  H  Y  +A + GT  L ++LN  L  HI+  LP L+  ++ ++ S + +++         P  K K +L  + + +F   +    +G  D+ +  ++ GGA I++I +E+FP  L+ I  +       I   I+N  G     F+   AF  +VK+QI KL  P   CID V  ++I  F Q  +K   + ++P L +E        +++    TK  +  LI +E S I  +H ++        + F  A+  N+ N      +R I + +I  G+  +  +I  G  +++     + ++  Y +      + M  L + ++   +KG M  +    IF+     ++ D  +I      QE+    K   +   + PE     D ++ E   + +  +  +  P  + +   +R LV  Y  +V + I   +PK I   ++   K+ + +  L  +YS  D +SL++ES D +++R
Sbjct:    6 MEELIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNN----KAEYAEFLHCKGRKFVDFDEVRQEIEAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMIMQFITRESCLILAVTPANMDLANSDALKVAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDIRAALAAERKFFLSHPSYRHMAERMGTPHLQKALNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALL--QMVQQFGVDFEKCIEGSGDQVDTAELSGGARINRIFHERFPFELVKIVFDEKELRREISHAIKNVHGVRTGLFTPDLAFEAIVKKQIIKLKEPCLKCIDLVIQELINTFRQCTNK---LSSYPRLREETERIVTTYVREREGKTKDQVLLLIDTELSYINTNHEDF--------IGFANAQQRNIVN-----KKRAIPNQVIRKGWLTLNISIMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSTKHIFAIFNTEQRNVYKDLRQIELACDSQEDMDSWKASFLRAGVYPE----KDQVESE---EAAPADSFSMDPQLERQVETIRNLVDSYIGIVNKTIRDLMPKTIMHLMINSAKDFIHSELLAYLYSSGDQNSLMEESADQAQRR 713          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 420.239 bits (1079), Expect = 8.384e-136
Identity = 271/763 (35.52%), Postives = 415/763 (54.39%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------------DPDG-------SKGTR----GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPE--IQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH              DP+        SKG      G+FLHT +K Y DF +I++EI  +T+ ++G  K IS +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LR+    NSIILA++AAN D+A S++L+ A E DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  ++DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    LT   I+T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +A       E+       G G                       ++G  + R M   +  E+  ++K        +R     P   ++ + V +++             +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    L+ LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENDPNAWKIPKHFSKGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRIARELPPPREKAAPAGNTGDGLP---------------------DAGTGNWRGMLKPKGEELPAEEK--------NRAPPALPASPLRGHAVNLLD-------------VPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLKALQRASQIIAEIRETH--LW 708          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 420.239 bits (1079), Expect = 1.634e-135
Identity = 272/764 (35.60%), Postives = 413/764 (54.06%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------------DPDG-------SKGTR----GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENK---VVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH              DP+        SKG      G+FLHT +K Y DF +I++EI  +T+ ++G  K IS +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LR+    NSIILA++AAN D+A S++L+ A E DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  ++DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    LT   I+T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +A       E+  K      G        P      + T      +GN    +          PD        +      + P  ++N+    +  + +        D  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    L+ LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENDPNAWKIPKHFSKGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRIARELPPPREKPPK----ASGPLPAASLEPSPASSSAETDGKAAPAGNTGDGL----------PDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAVNLLD--VPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLKALQRASQIIAEIRETH--LW 735          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 419.083 bits (1076), Expect = 4.418e-135
Identity = 270/763 (35.39%), Postives = 412/763 (54.00%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTRG-------------RFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENK---VVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH           D +G+   RG             +FLHT +K Y DF +I++EI  +T+ ++G  K IS +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LR+    NSIILA++AAN D+A S++L+ A E DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  ++DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    LT   I+T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +A       E+  K      G        P      + T      +GN    +          PD        +      + P  ++N+    +  + +        D  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    L+ LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGNVSARGSPVQLGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRIARELPPPREKPPK----ASGPLPAASLEPSPASSSAETDGKAAPAGNTGDGL----------PDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAVNLLD--VPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLKALQRASQIIAEIRETH--LW 734          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 403.675 bits (1036), Expect = 1.574e-129
Identity = 264/735 (35.92%), Postives = 408/735 (55.51%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTR-GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIEN-LIKSEKSDIMCSHPNYELGFV---LQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIP-GNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPE--IQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIE 2291
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH           D +G +    G+FLHT +K Y DF +I++EI  +T+ ++G  K IS +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LR+    NSIILA++AAN D+A S++L+ A E DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  ++DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    LT   I+T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ +  +      ++   P  +L F    L    +      N  +     N R +   +I C   +  Q  P GN  D         ++G  + R M   +  E+  ++K        +R     P   ++ + V +++             +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    L+ LL ESED++++RK   ++++
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVRDEALALCPLRLLPRCPFADLTFYDTRLLACRYITWWPSN--SPTSTPNTRTLPMPIIICQLALPLQAAPAGNTGD------GLPDAGTGNWRGMLKPKGEELPAEEK--------NRAPPALPASPLRGHAVNLLD-------------VPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLK 695          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 393.66 bits (1010), Expect = 1.464e-125
Identity = 219/510 (42.94%), Postives = 319/510 (62.55%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTRG-------RFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH           D +G+   RG       +FLHT +K Y DF +I++EI  +T+ ++G  K IS +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LR+    NSIILA++AAN D+A S++L+ A E DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  ++DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    LT   I+T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGNVSARGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDF 507          

HSP 2 Score: 51.6026 bits (122), Expect = 4.866e-6
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 3
Query: 2037 ELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIE 2291
            +L+ R  +D E  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    L+ LL ESED++++RK   ++++
Sbjct:  616 KLSAREQRDCE--VIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLTESEDMAQRRKEAADMLK 699          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 423.32 bits (1087), Expect = 3.748e-137
Identity = 270/755 (35.76%), Postives = 410/755 (54.30%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGT-----------RGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEP-------DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH  P+  + T            G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LK++S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R    +  G       +   GN++   +T            +  E+L   + +P        QKG  ++        D P                               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKVPSAGGGIGDGGQEPTTGNWRGMLKTS-----------KAEELLAEEKSKPIPIMPASPQKGHAVN------LLDVPV--------------------------PVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 699          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 422.165 bits (1084), Expect = 1.251e-136
Identity = 272/768 (35.42%), Postives = 411/768 (53.52%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------------DPDGSKGTR-----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEP-------DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH              DP   K +R           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LK++S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R    +  G       +   GN++   +T            +  E+L   + +P        QKG  ++        D P                               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKVPSAGGGIGDGGQEPTTGNWRGMLKTS-----------KAEELLAEEKSKPIPIMPASPQKGHAVN------LLDVPV--------------------------PVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 712          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 421.394 bits (1082), Expect = 3.361e-136
Identity = 276/759 (36.36%), Postives = 421/759 (55.47%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGT-----------------RGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEP---DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDL--IQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH  P+  + T                  G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LK++S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R   D LI               QD  R      E+ NV      I    + EP   + +G++     + L  +    +++K + I    +P+     +L  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSR---DKLI---------------QDNRR------ETKNVPSAGGGIGDGGQ-EPTTGNWRGMLKTSKAEELLAE----EKSKPIPIMPA-SPQKGHAVNLLDVPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 716          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 347.821 bits (891), Expect = 1.403e-106
Identity = 248/731 (33.93%), Postives = 397/731 (54.31%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGF--VLQKMNFFEAKAENLANVNCAANERQIKDNLIGC--------GFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVME--ILQSREI----EPDQKGIMLDEIFDRLFHDC---PEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNR-LQNIYSHCDLDSLLQESEDISKQR 2267
            M+ LIP++N LQD +S +     +DLPQI ++G QSAGKSSVLEN V ++FLPRG+GIVTR PL+L LV+    S      FLH   K + DF +++ EI  +TD + G  K IS  PI L++YS    NLTL+DLPG+TKV V  QP DI+ QI++  ++F  KEN +ILA+S AN DLANSD+L+ A+E+DP+G+RT+ VITKLDLMD+GT ARD+L  K+LP + GYIGVV+RSQ+DI   K I  +L  E++FF  H  Y  +A + GT +L + LN  L  HI+  LP L+  ++ ++ S + ++D         P  K K +L  + + +F+  +    +G  D+ +  ++ GGA I++I +E+FP  L+ ++ +       I   I+N  G     F+   AF  +VK+Q++K+  P   C+D V   + + V++ +K   +  +P L +E+       I++    TK  +  LI  E + +  +H ++ +GF    Q+ N    K     + N    +  +  N IG          F +  +N+     D  +   + L   N+ LR +E   + S+ I      +Q+ +  D  + +L   C    E+   K   +   + PE +  D     E +   S     +  P  + +   +R LV  Y  +V + +   +PK I   ++ + KE + +  L N+YS  D ++L++ES + +++R
Sbjct:    6 MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVN----STTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALL--QMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKK--LQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDF-IGFANAQQRSNQMNKKK---TSGNQVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKD--YRQLELACETQEEVDSWKASFLRAGVYPE-RVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRR 721          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm3 (dynamin 3 [Source:MGI Symbol;Acc:MGI:1341299])

HSP 1 Score: 347.436 bits (890), Expect = 1.487e-106
Identity = 249/748 (33.29%), Postives = 403/748 (53.88%), Query Frame = 3
Query:  162 KMDQLIPIINELQDTYSKLNMP-FIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFV-LQKMNFFEAKAENLAN------VNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVME--ILQSREI----EPDQKGIMLDEIFDRLFHDCPE-IQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNR-LQNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDI 2327
            +M++LIP++N LQD +S L     ++LPQI ++G QSAGKSSVLEN V ++FLPRG+GIVTR PL+L LV     SK     FLH   K + DF +++ EI  +TD + G  K IS  PI L++YS    NLTLIDLPG+TKV V  QP DI+ QI++  ++F  +EN +ILA++ AN DLANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT ARD+L  K+LP + GY+GVV+RSQ+DI   K I+ ++  E++FF  H  Y  IA + GT  L + LN  L  HI+  LPN +  ++ ++ S +++++         P  K K +L  + +F   F    RI   G+  + L ++ GGA I++I +E+FP  ++ ++         I   I+N  G     F+   AF  +VK+QI KL  PS   +D V   +   V++ +K   +  FP L +E        I++    TK  +  LI  + S I  +H ++ +GF   Q+ +    K   + N          +N   +K    G  F +  +++     D  +   + L   N+ +R +E   + S+ +      +Q+ +  D  F  L  D  E +   K  ++   + P+    ++       ++  + E  +  P  + +   +R LV  Y +++ + I   IPK I   ++ ++K+ + +  L  +YS  D ++L++ES + +++R     + + L+     I DI
Sbjct:    5 EMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVT----SKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAFKNFKPEDPTRKTKALLQMVQQFAVDFEK--RIEGSGDQVDTL-ELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVMQELINTVKKCTKR--LANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDF-IGFANAQQRSSQVHKKSTIGNQVIRKGWLTVSNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKGFMSSKHVFALFNTEQRNVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVTEN-------DENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALAIIGDI 735          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q7SXN5|DNM1L_DANRE (Dynamin-1-like protein OS=Danio rerio OX=7955 GN=dnm1l PE=2 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 3.365e-136
Identity = 269/747 (36.01%), Postives = 411/747 (55.02%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH DP+  + T           G+FLHT +K Y DF +I++EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   L++    NSIILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + SAQY+  L   G  ++D    + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +  +  +      +D + G G +   +   G +    R M+   + G    +    LQS      QKG  ++        D P                               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLHTKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSVP----RDKMAG-GAQAEQEGGTGTW----RGMLKKGDEGQGEEKTK--LQSSIPASPQKGHAVN------LLDVPV--------------------------PVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETH--LW 691          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|O00429|DNM1L_HUMAN (Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2)

HSP 1 Score: 424.091 bits (1089), Expect = 3.676e-136
Identity = 274/755 (36.29%), Postives = 421/755 (55.76%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--DPDGSKGT----------RGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIH--YLESGNVSLRVMEILQSREIEP---DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDL--IQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH    D  K T           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R     +         +  P    +    +I     E+ NV+     +    + EP   + +G++     + L  +    +++K + I    +P+     +L  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQ-EPTTGNWRGMLKTSKAEELLAE----EKSKPIPIMPA-SPQKGHAVNLLDVPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 736          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q2KIA5|DNM1L_BOVIN (Dynamin-1-like protein OS=Bos taurus OX=9913 GN=DNM1L PE=2 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 1.763e-135
Identity = 279/774 (36.05%), Postives = 423/774 (54.65%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------------DPDGSKGTR-----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQ--------NIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEP---DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDL--IQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH              DP   K +R           G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R  K + +        Q           G     SR       SG     V + +Q    EP   + +G++     + L  +    +++K + I    +P+     +L  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVAPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRD-KSSKVPSALAPASQEPSPAASAEADGKLIQESRRETKNAASGGGG--VGDAVQ----EPTTGNWRGMLKTSKAEELLAE----EKSKPIPIMPA-SPQKGHAVNLLDVPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 749          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q8K1M6|DNM1L_MOUSE (Dynamin-1-like protein OS=Mus musculus OX=10090 GN=Dnm1l PE=1 SV=2)

HSP 1 Score: 422.165 bits (1084), Expect = 1.997e-135
Identity = 274/762 (35.96%), Postives = 422/762 (55.38%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGT-----------------RGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQ---DFSRTMIHYLESGNVSLRVMEILQSREIEP---DQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDL--IQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH  P+  + T                  G+FLHT +K Y DF +I++EI  +T+ ++G  K +S +PI LK++S    NLTL+DLPG+TKV V  QPKDI++QI+   LRF    NSIILA++AAN D+A S++L+ + E+DP+G+RTL VITKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E  +++ GGA I  I +E F   L  +D    L    I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   +T  ++ NL+  E + I   HP++     L   N  E +   LA    +A  R  K + +        Q  P       D      +  E+ NV      I    + EP   + +G++     + L  +    +++K + I    +P+     +L  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIET-SELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRD-KSSKVPSALAPASQEPPPAASAEADGKLIQDNRRETKNVPSAGGGIGDGGQ-EPTTGNWRGMLKTSKAEELLAE----EKSKPIPIMPA-SPQKGHAVNLLDVPVPVARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETH--LW 742          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q94464|DYNA_DICDI (Dynamin-A OS=Dictyostelium discoideum OX=44689 GN=dymA PE=1 SV=2)

HSP 1 Score: 415.231 bits (1066), Expect = 1.992e-131
Identity = 234/501 (46.71%), Postives = 333/501 (66.47%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTR----GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKR----ILIPEFLTRFSNAYRIINDGEF-DENLNKIKGGAIISQIIYEKFPAILMDID-IESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELG 1631
            MDQLIP+IN+LQD ++ L    +DLPQIV++GSQS+GKSSVLENIV ++FLPRG+GIVTR PL+L L H P    G++    G FLH  +  +YDFS+I+EEIIR TD + G  K IS QPI LKIYS    NLTL+DLPG+TKV V  QP DI+ QI+   + + +K+N+II+A++ AN DLANSD+L+ A+E+DPEGKRT+ VITKLDLMDKGT A ++L G+V+P  LG+IGV++RSQEDI+  K I ESL  E  +F  H  Y  IA+++GT +L+++LN LL  HI+  LP+LK  + + +   Q +L   G  + D +     L+ + +T FS+ ++   DG+  D + N++ GGA IS I  E +   + +ID +E    ND I TT+RN  GP    F  + +F  LVK+Q+ +L  PS  C++ VYD +Q  V +  +A  +  F +L   ++E  + L+++    TK++IE+LIK E + I  SHP++  G
Sbjct:    1 MDQLIPVINKLQDVFNTLGSDPLDLPQIVVVGSQSSGKSSVLENIVGRDFLPRGSGIVTRRPLILQLTHLPIADDGSQTQEWGEFLHKPNDMFYDFSEIREEIIRDTDRMTGKNKGISAQPINLKIYSPHVVNLTLVDLPGITKVPVGDQPTDIEQQIRRMVMAYIKKQNAIIVAVTPANTDLANSDALQLAKEVDPEGKRTIGVITKLDLMDKGTDAMEVLTGRVIPLTLGFIGVINRSQEDIIAKKSIRESLKSEILYFKNHPIYKSIANRSGTAYLSKTLNKLLMFHIRDTLPDLKVKVSKMLSDVQGELSTYGDPLYDTKNSQGALLLQIITIFSSNFKDAIDGKLTDLSNNELYGGARISYIFNEIYSHCVNNIDPLEGISLND-IRTTMRNATGPRAALFIPEISFELLVKKQVVRLEEPSAQCVEYVYDELQRIVSQL-EAKELSRFINLKARVIEVVNNLLQKHKVPTKTMIEHLIKIETAFINTSHPDFVGG 499          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A095ALR2 (Dynamin-1-like protein OS=Schistosoma haematobium OX=6185 GN=MS3_03326 PE=3 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.984e-142
Identity = 272/745 (36.51%), Postives = 421/745 (56.51%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDG-EFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQEN-KVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLEN+V ++FLPRG GIVTR PL+L L+H           + DG+      FLHT  K Y DF +++ EI  +TD +AG  K +S +PI LKI+S    NLTL+DLPG+TKV V  QP+DI+  I + CL +    NSIILA++ AN D+A S+ L+ A+ +DP+G+RTLC++TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI  GK I+E+L  E  F  + Y  +AS+NGT FL R+LN LL  HI+ CLP+LK   R  + +AQ++  L+  G EI+D+  L+ + +T+F+ AY    DG   D    ++ GGA I  I +E F   L  ID    L+   I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q       +  FP L + I++   ++++Q  + T  ++ NL+  E + I   HP++     L+ ++    +A  L N++                      + P     FS + +  + + +++ R+   LQ  E +P    I           + P   +N + + I   L P+ +   ++ QH+              PN+ H+  ++  L+  YF +VR+NI   +PK I  FLV  +K+NL + L   +Y   + ++LLQESE ++++R+   E+++ L+     I +I   H  +W
Sbjct:    1 MESLIPVINKLQDVFNTVGSETIQLPQIVVLGTQSSGKSSVLENLVGRDFLPRGHGIVTRRPLVLQLIHVDESDHATRVAEGDGTSTEWATFLHT-KKIYRDFDEVRNEIKSETDRVAGAGKAVSSEPINLKIFSPRVLNLTLVDLPGITKVPVGDQPEDIETLINDLCLHYINNPNSIILAVTPANADMATSEGLKLAKTIDPDGRRTLCILTKLDLMDHGTDAHDLLLGRVVPVKLGIIGVVNRSQADIKAGKNIDEALQDEASFLQRRYPSLASRNGTPFLARTLNRLLMHHIRDCLPDLK--TRVNVMAAQFQNLLNTFGDEIEDRGQLLLQIITKFNTAYCNTIDGVAKDIETTELCGGARICYIFHETFYRTLSKIDPLGGLSTLDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGAQQELLRFPKLHERIVDVVTSVLRQRLQPTNQMVTNLVAVELAYINTRHPDF-----LEALSTHRQQAPGLENLS--------------------LNDQPATQGSFSGSSLRTITASHLTRRLPGTLQHEE-QPGSLNI-----------NGPSSDQNPENLHIGLSLTPDIQ--TEVQQHKLT------------PNERHDCEVIGKLIRSYFLIVRKNIQDTVPKAIMHFLVNFVKDNLQSELVGKLYKQDEYNTLLQESERVAQRRREASEMLKALQKASMIIGEIRETH--LW 689          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A430Q902 (Dynamin 1-like protein OS=Schistosoma bovis OX=6184 GN=DC041_0006047 PE=3 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 2.048e-141
Identity = 271/745 (36.38%), Postives = 420/745 (56.38%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDG-EFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQEN-KVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLEN+V ++FLPRG GIVTR PL+L L+H           + DG+      FLHT  K Y DF +++ EI  +TD +AG  K +S +PI LKI+S    NLTL+DLPG+TKV V  QP+DI+  I + CL +    NSIILA++ AN D+A S+ L+ A+ +DP+G+RTLC++TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI  GK I+E+L  E  F  + Y  +AS+NGT FL R+LN LL  HI+ CLP+LK   R  + +AQ++  L+  G EI+D+  L+ + +T+F+ AY    DG   D    ++ GGA I  I +E F   L  ID    L+   I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q       +  FP L + I++   ++++Q  + T  ++ NL+  E + I   HP++     L+ ++    +A  L N++                      + P      S + +  + + +++ R+   LQ  E +P    I           + P   +N + + I   L P+ +   ++ QH+              PN+ H+  ++  L+  YF +VR+NI   +PK I  FLV  +K+NL + L   +Y   + ++LLQESE ++++R+   E+++ L+     I +I   H  +W
Sbjct:    1 MESLIPVINKLQDVFNTVGSETIQLPQIVVLGTQSSGKSSVLENLVGRDFLPRGHGIVTRRPLVLQLIHVDESDHATRVAEGDGTSTEWATFLHT-KKIYRDFDEVRNEIKSETDRVAGAGKAVSSEPINLKIFSPRVLNLTLVDLPGITKVPVGDQPEDIETLINDLCLHYINNPNSIILAVTPANADMATSEGLKLAKTIDPDGRRTLCILTKLDLMDHGTDAHDLLLGRVVPVKLGIIGVVNRSQADIKAGKNIDEALQDEASFLQRRYPSLASRNGTPFLARTLNRLLMHHIRDCLPDLK--TRVNVMAAQFQNLLNTFGDEIEDRGQLLLQIITKFNTAYCNTIDGVAKDIETTELCGGARICYIFHETFYRTLSKIDPLGGLSTLDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGAQQELLRFPKLHERIVDVVTSVLRQRLQPTNQMVTNLVAVELAYINTRHPDF-----LEALSTHRQQAPGLENLS--------------------LNDQPATQGSISGSSLRTITASHLTRRLPGTLQHEE-QPGSLNI-----------NGPSSDQNPENLHIGLSLTPDIQ--TEVQQHKLT------------PNERHDCEVIGKLIRSYFLIVRKNIQDTVPKAIMHFLVNFVKDNLQSELVGKLYKQDEYNTLLQESERVAQRRREASEMLKALQKASMIIGEIRETH--LW 689          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: G4V9Q0 (Putative dynamin OS=Schistosoma mansoni OX=6183 GN=Smp_067280 PE=3 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 4.980e-141
Identity = 274/747 (36.68%), Postives = 418/747 (55.96%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDG-EFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQ---KGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLEN+V ++FLPRG GIVTR PL+L L+H           + DG+      FLH   K Y DF +++ EI  +TD +AG  K +S +PI LKI+S    NLTL+DLPG+TKV V  QP+DI+  I + CL +    NSIILA++ AN D+A S+ L+ A+ +DP+G+RTLC++TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI  GK I+E+L  E  F  + Y  +AS+NGT FL R+LN LL  HI+ CLP+LK   R  + +AQ++  L+  G EI+D+  L+ + +T+F+ AY    DG   D    ++ GGA I  I +E F   L  ID    L+   I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q       +  FP L + I++   ++++Q  + T  ++ NL+  E + I   HP++     L+ ++    +A  L N++   NE+                  P      S + +  +   ++S R+   LQ  E +P      G   D+  D L              I   L P+ +   ++ QH+              PN+ H+  ++  L+  YF +VR+NI   +PK I  FLV  +K+NL + L   +Y   + ++LLQESE ++++R+   E+++ L+     I +I   H  +W
Sbjct:    1 MESLIPVINKLQDVFNTVGSETIQLPQIVVLGTQSSGKSSVLENLVGRDFLPRGHGIVTRRPLVLQLIHVDESDHATRVAEGDGTSTEWATFLHN-KKIYRDFDEVRNEIKSETDRVAGAGKAVSSEPINLKIFSPSVLNLTLVDLPGITKVPVGDQPEDIETLINDLCLHYINNPNSIILAVTPANADMATSEGLKLAKTIDPDGRRTLCILTKLDLMDHGTDAHDLLLGRVVPVKLGIIGVVNRSQADIKAGKNIDEALQDEASFLQRRYPSLASRNGTPFLARTLNRLLMHHIRDCLPDLK--TRVNVMAAQFQNLLNTFGDEIEDRGQLLLQIITKFNTAYCNTIDGVAKDIETTELCGGARICYIFHETFYRTLSKIDPLGGLSTLDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGAQQELLRFPKLHERIVDVVTSVLRQRLQPTNQMVTNLVAVELAYINTRHPDF-----LEALSTHRQQAPGLENLSL--NEQ------------------PATQGSISGSSLRTITGSHLSRRLPGTLQHEE-QPSSLNVNGPSSDQNPDNLH-------------IGLSLTPDIQ--TEVQQHKLT------------PNERHDCEVIGKLIRSYFLIVRKNIQDTVPKAIMHFLVNFVKDNLQSELVGKLYKQDEYNTLLQESERVAQRRREASEMLKALQKASMIIGEIRETH--LW 689          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A5K3EJB0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.571e-139
Identity = 274/745 (36.78%), Postives = 415/745 (55.70%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDG-EFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQK---------MNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDI 2327
            M+ LIP+IN+LQD ++ +    + LPQIV+IGSQS+GKSSVLENIV ++FLPRG GIVTR PL+L LVH           + DG+     +FLH     Y DF  ++EEI ++T  LAG  K +S + I LK+YS    NLTL+DLPG+TKV V  QP+DI+ QI + CL +    N IILA++ AN D+A S+SL+ A+E+DPEGKRTLCV+TKLDLMD GT A D+L+ +V+P +LG IGVV+RSQ DI   K I ++L YE  F  + Y  +AS+NGT +L ++LN LL  HI+ CLP LK   R  + +AQ++  L+  G E++DK  L+ + +T+F+ AY    DG   D   +++ GGA I  I +E F + L  ID    LT   ++T IRN+ GP    F  + AF  LVK QI++L  PS  C++ V++ +Q  +Q       ++ FP+L + I++   +L+++  + T  ++ NL+  E + I   HP++    ++ +         +   + +A  L       +  QI  N +  G     Q  PG          H     + + R  ++LQ      +           + F   P+IQ                    + QH    QLS  E+        H+  ++  L+  YF +VR+NI   +PK I +FLV ++K+NL + L  ++Y   + + LL+ESE ++++RK   E+++ L+   + I +I
Sbjct:    1 MESLIPVINKLQDVFNTVGTESLQLPQIVVIGSQSSGKSSVLENIVGRDFLPRGPGIVTRRPLVLQLVHVGENDDAIRKEEGDGTSKEWAKFLHNKQVIYTDFDKVREEIEKETTRLAGIGKMVSSEAIHLKVYSPNVLNLTLVDLPGITKVPVGDQPEDIEKQINSLCLHYISNPNCIILAVTPANADMATSESLKLAKEVDPEGKRTLCVLTKLDLMDHGTDAHDLLLNRVIPVKLGIIGVVNRSQADINSKKSITDALAYEASFLQRRYPSLASRNGTVYLAKTLNRLLMHHIRDCLPELK--TRVNVMAAQFQTLLNSFGTEVEDKGQLLLQIITKFNTAYCNTIDGVSKDIETSELCGGARICYIFHEIFYSTLGRIDPMGGLTTLDVLTAIRNSTGPRPALFVPEVAFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGTQQEMYRFPNLHERIVDVVTSLLRRRLQPTNEMVTNLVAIELAYINTRHPDFTEELMVHRQQAPPGLNNLGLIQRRAIQLQLSEVEHDWIQISHNTLAEG---PSQAQPGKRSQQQAVARHPNPPPSRAQRPNDVLQ------EADSSDAASAATQGFQMPPDIQ------------------TQVQQH----QLSAAEK--------HDCDLISQLIRSYFQIVRKNILDSVPKAIMNFLVNYVKDNLQSELVSSLYKTDECNGLLKESEHVAQRRKEASEMLKALQRASQIISEI 704          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: C1LEY9 (Dynamin 1-like protein OS=Schistosoma japonicum OX=6182 GN=DNM1L PE=2 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 2.612e-139
Identity = 271/748 (36.23%), Postives = 420/748 (56.15%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDG-EFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSR----TMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLEN+V ++FLPRG GIVTR PL+L L+H           + DG+      FLH   K Y DF +++ EI  +TD +AG  K +S +PI LKI+S    NLTL+DLPG+TKV V  QP+DI+  I + CL +    NS+ILA++ AN D+A S+ L+ A+ +DP+G+RTLC++TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI  GK I+E+L  E  F  + Y  +AS+NGT FL R+LN LL  HI+ CLP+LK   R  + +AQ++  L+  G EI+D+  L+ + +T+F+ AY    DG   D    ++ GGA I  I +E F   L  ID    L+   I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q       +  FP L + I++   ++++Q  + T  ++ NL+  E + I   HP++      + ++    +A  L N++   ++   + ++ G   +    +       FSR    T++H  E    SL V      ++++  Q G+ L           P+IQ                   ++ QH+              PN+ H+  ++  L+  YF +VR+NI   +PK I  FLV  +K+NL + L   +Y   + ++LLQESE ++++R+   E+++ L+     I +I   H  +W
Sbjct:    1 MESLIPVINKLQDVFNTVGSESIQLPQIVVLGTQSSGKSSVLENLVGRDFLPRGHGIVTRRPLILQLIHVDESDHATRIAEGDGTSTEWATFLHN-KKIYRDFDEVRNEIKSETDRVAGAGKAVSAEPINLKIFSPRVLNLTLVDLPGITKVPVGDQPEDIETLINDLCLPYINNPNSVILAVTPANADMATSEGLKLAKTVDPDGRRTLCILTKLDLMDHGTDAHDLLLGRVVPVKLGIIGVVNRSQADIKAGKNIDEALQDEATFLQRRYPSLASRNGTPFLARTLNRLLMHHIRDCLPDLK--TRVNVMAAQFQNLLNTFGDEIEDRGQLLLQIITKFNTAYCNTIDGVAKDIETTELCGGARICYIFHETFYRTLSKIDPLGGLSTLDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVELVHEEMQRIIQHCGAQQELLRFPKLHERIVDVVTSVLRQRLQPTNQMVTNLVAIELAYINTRHPDFS-----EALSTHRQQAPGLENLSL-NDQPATQGSISGSALRATTTS------HFSRRLPTTLLH--EEQGSSLNVNGPSSDQQLDNLQFGLSL----------TPDIQT------------------EVQQHKLT------------PNERHDCEVIGKLIRSYFLIVRKNIQDTVPKAIMHFLVNFVKDNLQSELVGKLYKQDEYNTLLQESERVAQRRREASEMLKALQKASMIIGEIRETH--LW 689          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 421.009 bits (1081), Expect = 2.687e-136
Identity = 269/750 (35.87%), Postives = 418/750 (55.73%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIIC-QNIPGNFQDFSRTMIHY--LESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH DP+  + T           G+FLHT +K Y DF +I++EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   L++    N IILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +++  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L   G  + DK   + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +  +  A    +   +L G G + +   + P    D  + +      E+G  + R M + +  E +P+ K       F +        Q+   V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVPRDK---SLKGPGGQSLSPSDQPQADGDALKAVGAQGDQEAGTGNWRGM-LKKGEEGQPEDK-------FKQQGPLPASPQKGHAVNLLDVPVP------------VARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETH--LW 714          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 417.927 bits (1073), Expect = 3.023e-135
Identity = 267/759 (35.18%), Postives = 410/759 (54.02%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-------------DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH             DP+  K  R          G+FLHT +K Y DF +I++EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   L++    N IILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +++  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L   G  + DK   + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +  +  A      +D  +G                         E+G  + R M + +  E +P+ K       F +        Q+   V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENDPNAWKNGRLYKGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVP----RDKAVGAQGD--------------------QEAGTGNWRGM-LKKGEEGQPEDK-------FKQQGPLPASPQKGHAVNLLDVPVP------------VARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETH--LW 702          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 418.698 bits (1075), Expect = 3.391e-135
Identity = 270/762 (35.43%), Postives = 418/762 (54.86%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-------------DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIIC-QNIPGNFQDFSRTMIHY--LESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH             DP+  K  R          G+FLHT +K Y DF +I++EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   L++    N IILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +++  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L   G  + DK   + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +  +  A    +   +L G G + +   + P    D  + +      E+G  + R M + +  E +P+ K       F +        Q+   V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENDPNAWKNGRLYKGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVPRDK---SLKGPGGQSLSPSDQPQADGDALKAVGAQGDQEAGTGNWRGM-LKKGEEGQPEDK-------FKQQGPLPASPQKGHAVNLLDVPVP------------VARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETH--LW 726          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 417.542 bits (1072), Expect = 2.005e-134
Identity = 269/758 (35.49%), Postives = 416/758 (54.88%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-------------DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIIC-QNIPGNFQDFSRTMIHY--LESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDH 2339
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTGIVTR PL+L LVH             DP+  K  R          G+FLHT +K Y DF +I++EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QPKDI++QI+   L++    N IILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +++  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L   G  + DK   + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   +  +  A    +   +L G G + +   + P    D  + +      E+G  + R M + +  E +P+ K       F +        Q+   V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENDPNAWKNGRLYKGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVPRDK---SLKGPGGQSLSPSDQPQADGDALKAVGAQGDQEAGTGNWRGM-LKKGEEGQPEDK-------FKQQGPLPASPQKGHAVNLLDVPVP------------VARKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLTESEDMAQRRNEAADMLKALQKASQVIAEIRETH 724          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: si:dkey-32e23.4 (dynamin-1-like protein [Source:NCBI gene;Acc:103036512])

HSP 1 Score: 369.392 bits (947), Expect = 4.079e-117
Identity = 210/501 (41.92%), Postives = 307/501 (61.28%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP---------DGSKGTR-GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQY--KLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIPIIN LQ+ +  +    I LPQIV++GSQS+GKSSVLE++V ++FLPRG+GIVTR PL+L LV+ P          G K    G FLH  ++ + DFS+I+ EI  +TD +    K IS +PI LKI+S    NLTL+DLPG+TKV V  QP+DI+ Q++   L F    NS+IL +S AN DLA SD+L+ A E+DP+G+R+L V++KLDLMD GT A ++L+G+V+P +LG IGVV+RSQ D+   K +E++   E+ F  +HY  +AS+ G+ +L R+L+ LL  HI+ CLP LK   R  + SAQY  +L   G  ++D    + + +T+F++ Y    +G       +++ GGA I  I +E F   L  ID    LT   I+T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   IT  ++ NL++ E + I   HP++
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKHEHGIKAEEWGTFLHCKNQIFTDFSEIRSEIEAETDRVTN-NKGISPEPIHLKIFSPNVLNLTLVDLPGITKVPVGDQPEDIETQVQEMILSFISNPNSLILCVSPANSDLATSDALKLAREVDPDGRRSLLVVSKLDLMDAGTDALEVLLGRVIPVRLGIIGVVNRSQHDLNTQKTVEDAARDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLPELK--TRVTVLSAQYQTRLSSYGQPVEDHSATLLQIVTKFASDYCNTIEGTARHIQTSELCGGARICYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEELQRIIQHCSSYSTQELLRFPKLHDSIVEVVTTLLRKRLPITNDMVHNLVQIELAYINTKHPDF 498          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 404.831 bits (1039), Expect = 3.763e-130
Identity = 272/768 (35.42%), Postives = 416/768 (54.17%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-----------DPDGSKGTR--------------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY-ELGFVLQKMN--FFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQ-------DFSRTMI-------HYLESG---NVSLRVMEILQSREIEPD--QKGIMLDEIFDRLF----HDCPEIQENKVVIINTILN--PEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIE 2291
            M+ LIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLE++V ++FLPRGTGIVTR PL+L LVH           + +G+  T               G+FLHT +K Y DF++I++EI  +T+ + G  K IS + I LKI+S    NLTL+DLPG+TKV V  QP DI+ QI+   ++F    NSIILA++AAN DLA S++L+ A E+D +G+RTL VITKLDLMD GT A DIL G+V+P +LG IGVV+RSQ DI   K I +++  E+ F  K Y  +A++NGT FL ++LN LL  HI+ CLP LK   R  + +AQY+  L   G  + DK   + + +T+F+  Y    +G       +++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L   I+E    L+++   ++  ++ NL+  E + I   HP++ +   V  ++N    + +  N        +   + D   G G K+  Q  P   +       ++ R M+       H+ +SG   + S +  +  Q     P   ++GI  ++  D+      H  P          N+ +   P     D  +      +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+NL + L   +Y    LD LL ESED++++RK   ++++
Sbjct:    1 MEALIPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAMDILTGRVIPVKLGIIGVVNRSQLDINTKKTILDAMQDEQSFMQKKYPSLANRNGTKFLGKTLNRLLMHHIRDCLPELK--TRVNVMAAQYQSLLGGYGNPVDDKNATLLQLVTKFAAEYCNTIEGTAKHIETSELCGGARICYIFHETFGRTLESVDPLGGLTTLDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVSNEMVHNLVAIELAYINTKHPDFADASMVSTQINNSLEDQRRRNRTFPGMQGDSAAVVD---GKGPKVRSQASPPKRKVPKIKEDEWGRLMVDPACDSMHFDDSGSRFDCSYQTGQEAQEGAPGPQAWRRGIRAEDGDDKARAAGNHHTP-------ASFNSPMKGPPSINLLD--VPVPVSRKLSAREQ--------RDCEVIEKLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKQQLLDELLTESEDMAQRRKEASDMLK 746          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.1 bits (710), Expect = 6.166e-85
Identity = 174/452 (38.50%), Postives = 264/452 (58.41%), Query Frame = 3
Query:  306 QEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGF 1634
            ++FLPRG+GIVTR PL+L L+      K     FLH   K + DF +++ EI  +TD L G  K IS  PI L++YS    NLTLIDLPG+TKV V  QP DI+ QI+   ++F  KEN +ILA+S AN DLANSD+L+ A+E+DP+G RT+ VITKLDLMD GT ARDIL  K+LP + GYIGVV+RSQ+DI   K I  ++  E++FF  H  Y  +A + GT +L ++LN  L  HI+  LP L+  ++ ++ S + +++         P  K K +L  + + +F+  +    +G  D+ +  ++ GGA I++I +E+FP  L+ ++ +       I   IRN  G     F+   AF  +VK+QIQKL  P   C+D V   +   +++ S+   + ++P L  +        I++    TK  +  LI  + + +  +H ++ +GF
Sbjct:    1 RDFLPRGSGIVTRRPLILQLMF----CKAEYAEFLHCKGKKFTDFEEVRAEIEAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLSHPSYRHMADRMGTPYLQKTLNQQLTNHIRDTLPALRNKLQGQMLSMEKEVEEYKNFRPDDPTRKTKALL--QMVQQFAFDFEKRIEGSGDQIDTVELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIRNINGIRTGLFTPDLAFEAIVKKQIQKLKEPCLKCVDLVVGELTNVIRKCSEK--LGSYPRLRDDTDRIVTTYIREREGRTKDQVLLLIDIQLAYMNTNHEDF-IGF 443          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 192.586 bits (488), Expect = 1.696e-52
Identity = 144/442 (32.58%), Postives = 222/442 (50.23%), Query Frame = 3
Query:  231 IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKG-----TRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGT--TARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNG-----TGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKD----KRILIPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDI--ESYLT--NDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCI----DNVYDVIQAFVQEASKAFPIF 1484
            + LP + +IG QS+GKSSVLE +   + LPRG+GIVTRCPL L L   P    G      +GR ++T         D    +++    L G +  +S   I L++ S   P+LTLIDLPG+ +VA+  Q  DI+ QIK+       ++ +I L +   NVD+A +++L+ A+ +DP G RTL V+TK DLMD+GT   A  IL  +V P   GY+ V  RSQ D+   + + E+   E  FF KH       NG     T  L   L   L  +IK+ LP L++ + EK++ A  +L+  G  I D    K+  I   + R+++  R +  GE   NL +     ++  ++ E F   L D+    +++L   +++I   I N  G +   F    AF  L +  +Q+L  P+ + +      + DV      +  K  P F
Sbjct:   46 VGLPAVAVIGDQSSGKSSVLEALSGVQ-LPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGD---AVLQAQSELTGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGYVLVKCRSQRDVEAHQTLAEASRVEAAFFKKHPVFCHVHNGGKLTTTTVLAAKLTEELVDNIKRTLPKLRKDLAEKLREACAELESQGESIPDDARAKQQFINARVMRYNDDVRGLARGEPSRNLPR---NMMLYTLVREHFRTWLKDLKRAQDAWLEELDNLIREYIDNRSGRELPGFVSYHAFENLARVHVQRLEKPALNVLAVTCSKLSDVFMRLADDVFKFLPEF 480          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007915.1 (pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene:ENSPMAG00000007153.1 transcript:ENSPMAT00000007915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 1.580e-49
Identity = 103/295 (34.92%), Postives = 160/295 (54.24%), Query Frame = 3
Query:  747 GKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            G+RTL V++KLDLMD GT A D+L+G+V+P +LG +GVV+RSQ DI K K + +SL  E  F  + Y  +A+++GT  L ++LN LL  HI+ CLP LK  +   +   Q  L   G  + D    +   +T+F++ Y    +G       +++ GGA I  I +E F   L  +     LT   ++T IRN  GP    F  + +F  LVK QI++L  P   C++ V++ +Q  VQ  S      +  FP L   I+E   +L+++    T  ++ NL+  E + I   HP++
Sbjct:   10 GRRTLAVVSKLDLMDAGTDATDVLLGRVVPVKLGIVGVVNRSQLDINKNKSVSDSLRDEDVFLQRKYPALANRSGTKNLAKTLNRLLMHHIRDCLPELKARVNMLVAQYQSLLSGYGEMVDDPSATLLSIVTKFASEYCHTIEGTSKHIETSELCGGARICYIFHETFGRTLESLHPLGGLTTMDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPGLRCVELVHEEMQRIVQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPFTNEMVHNLVAIELAYINTKHPDF 304          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 104.375 bits (259), Expect = 3.310e-23
Identity = 85/275 (30.91%), Postives = 136/275 (49.45%), Query Frame = 3
Query:  159 LKMDQLIPIINELQDTYSKLNMPFI---DLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTG-IVTRCPLMLHLVHDPDGS---KGTRGRFLHTGDKDYYDFSDIKEEI-IR-QTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTA----RDILIGKVLP-KQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDK 941
            +K   LI + +E+ D  S  +  +     LP++V++G QS+GK+SVLE I +    PRG+G ++TR P+ + L   P      K +   F  T + D    + +++EI IR +  +  G    +S + I+L +       + L+DLPG+          D    I      + +  N+IIL I   +VD   S        +DP+GKRT+ V+TK+DL +K   +    + IL GK+ P K LGY  VV+       + + IE    YE++FF K
Sbjct:  191 MKQKSLIEMYSEVLDILSDYDANYNTQDQLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKEDD---LAALRKEIEIRMKKSVKEG--HTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVDLAEKNLASPNRIQQILDGKLFPMKALGYFAVVTGKGN---RDESIESIKDYEEEFFQK 457          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 342.043 bits (876), Expect = 1.650e-106
Identity = 213/531 (40.11%), Postives = 303/531 (57.06%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHL---------VHDPDGS--------------KGTR---------------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDL---LGPEIKDKRI-LIPEFLTRFSNAYRIINDG-EFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            ++ LIP +N+LQD      +  +DLP + ++GSQS+GKSS+LE +V ++FLPRGTGIVTR PL+L L         + + D S               GT+               G FLH   K +YDF DIK EI  +T  +AG +K IS  PI LK++S    NLTL+DLPG+TKV +  QP DI+ QIKN  L +    N +ILA+S ANVDL NS+SL+ A E+DP+GKRT+ VITKLDLMD GT A DIL GK+ P +LG++GVV+RSQ+DI   K +EESL  E+ +F KH  Y  I++K GT +L + LN  L  HI+  LP++K  +   I   + +L     +G    + R  L+ + + +FS  +    DG   D N  ++ GGA I  I    F   L  ID  S L+   + T IRN+ GP    F  + AF  LVK QI+ L+ PS  C++ VY+ +     +   A  +  +P L   ++E    L+++  + T+S +E+LI   ++ I  +HPN+
Sbjct:    4 LEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKCGSA-ELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNF 533          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 340.117 bits (871), Expect = 2.480e-106
Identity = 213/547 (38.94%), Postives = 307/547 (56.12%), Query Frame = 3
Query:  168 DQLIPIINELQDTYSKL---NMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLV------------------------------------HDPDG----SKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDK-RILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAK 1667
            + LI  IN+LQD  + L   +   IDLPQI ++GSQS+GKSSVLENIV ++FLPRGTGIVTR PL+L L+                                    H  +G    +K   G FLH   K +Y+F +I++EI+++TD + G    IS  PI L+IYS     LTL+DLPGLTKV V  QP DI+ QIK+  L++  K N+IIL+++AAN DLANSD L+ A E+DPEG RT+ V+TK+DLMD+GT   DIL G+V+P + GYI V++R Q+DI   K I E+L  E++FF+ H  YS  A   GT +L + LN +L  HI++ LP +K  I   ++  Q +L  LGPE  D    ++   +T FSN Y  I DGE  E +  ++ GGA IS + +E F   +  +D    + +  I T + N+ G     F   +AF  LVK+QI++   PS   +  V+D +   +++         +P L + I  +    +K +   T   + ++IK+E++ I  +HP+   G   Q M   E K
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNELINLGPETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDLLKGS--QAMVMVEEK 547          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 169.474 bits (428), Expect = 4.586e-44
Identity = 99/243 (40.74%), Postives = 155/243 (63.79%), Query Frame = 3
Query:  156 TLKMDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDI 884
            T +M ++  I+N++  + + L      LP IV+IGSQS+GKSSVLE+IV +EFLP+G+ +VTR P+ L LV+ P+ +  T   F      +  DF ++K  ++ + ++     + +S++PI L I S   P+L+L+DLPG  +V    QP ++  +I++ C ++    N IILAISAA+VDLANS +L+ ++  DP+G RT+ VITKLDL+D    AR IL  K  P  +GY+GV++++   I
Sbjct:  188 TKQMIEIRTILNKVDSSSAHLT-----LPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVT-ADFPSMRLYNIKDFKEVK-RMLMELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKARSILNNKKYPLSMGYVGVITKTPSSI 421          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 391.349 bits (1004), Expect = 3.129e-125
Identity = 219/515 (42.52%), Postives = 313/515 (60.78%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDP---------------------DGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEA-SKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVL 1640
            M+QLIP+IN+LQD ++ +    I LPQIV++G+QS+GKSSVLEN+V ++FLPRG+G+VTR PL+L LVH P                     D      G+FLH  +K + DF+ I+EEI R+TD + G  K IS +PI LKIYS +  NLTL+DLPG+TKV V  QP DI+ QI++  L++    NSIILA++ AN+DLA S++L+ A E+DP+G RTL V TKLDLMD GT A D+L G+V+P +LG IGVV+RSQ DI   K IE +L  E  FF ++Y  +AS+NGT +L ++LN LL  HI+ CLP LK  +        + L   G  + DK   + + +TRF+  Y  I +G   E   +++ GGA I  I ++ F   L  +D    L+   I+T IRN  GP    F  + +F  LVK QI++L  PS  CI+ V++ +Q  +Q +  +   I  FP L + I++    L+++       ++ENL+  E + I  +HP++  G  L
Sbjct:    1 MEQLIPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAMDVLYGRVIPVKLGIIGVVNRSQLDINNRKSIENALRDEADFFARNYPTVASRNGTPYLAKTLNKLLMHHIRNCLPELKSRVNSMTSQYHHLLQSYGEPVMDKGPYLLQMITRFAATYCSIIEGTAHEIETSELCGGARICYIFHDIFGRTLTIMDAMEGLSTRDILTAIRNATGPRPALFVPEISFELLVKRQIRRLEEPSLRCIELVHEEMQRIIQHSFDQVMEIKRFPRLHESIVDVIINLLQRRLMPCNEMVENLVAIELAYINTNHPDFTDGASL 515          

HSP 2 Score: 53.5286 bits (127), Expect = 3.349e-7
Identity = 34/101 (33.66%), Postives = 59/101 (58.42%), Query Frame = 3
Query: 2040 LTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDH 2339
            LT R   D +  I+R L+  YF +VR++I   +PK I +FLV ++KE + + L + +Y     ++LLQESE +  +RK   E+++ L+   + I ++   H
Sbjct:  618 LTEREQMDSD--IIRKLIKSYFVIVRKSIQDSVPKAIMAFLVNYVKERIQSELVEKLYKSERFETLLQESEHMHIKRKEAAEMLKALQRAGQIISEVRDTH 716          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 346.665 bits (888), Expect = 7.134e-111
Identity = 206/501 (41.12%), Postives = 304/501 (60.68%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMP-FIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFF--DKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKRIL------IPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFV 1637
            M+ LIPI+N++QD ++ +     IDLPQI ++GSQSAGKSSVLEN V ++FLPRG+GIVTR PL+L L      SK     FLH  +K + DF ++++EI+ +TD + G  K IS+ PI L++YS    +LTL+DLPG+TKV V  QP DI+ QI++  L F  KEN +ILA+S AN DLANSD+L+ A E+DP+G RT+ VITKLDLMD+GT ARDIL  +VLP + GYIG+V+RSQ DI   K I  +L  E++FF  +  Y  +A K GT +L + LN  L  HIK  LP L+  +++ + + + ++   G E  + R L      + + +  FS  +    +G  D  N  ++ GGA I++I +E+FP  L+ ++ +       IM  I+N  G     F+   AF  +VK QI KL SP+  C+D V   + + +Q+   A  +  +P L  ++       I+ +   TK  ++  I+ E + I  +HP++ +GF 
Sbjct:    6 MEDLIPIVNKIQDAFASIGYSSMIDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQL----QPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEGTDARDILENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMADKMGTQYLQKVLNQQLTNHIKDTLPALRSKLQDNLLALEKEVK--GYENYNPRDLSVRTKALMQMMQTFSADFEKAIEGSGDSINTVELSGGAKINRIFHERFPYELVKMEFDEKQLRREIMFAIKNIHGIRVGLFTPDMAFEAIVKRQIDKLRSPAIKCVDMVMTELTSVIQKC--ATQMAKYPLLRDQVERIVIDHIRSNEVTTKEQVQTFIELELAYINTNHPDF-VGFA 497          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 112.079 bits (279), Expect = 1.443e-25
Identity = 75/245 (30.61%), Postives = 123/245 (50.20%), Query Frame = 3
Query:  237 LPQIVIIGSQSAGKSSVLENIVRQEFLPRGTG-IVTRCPLMLHLVHDPDG---SKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTA----RDILIGKVLP-KQLGYIGVVS---RSQEDILKGKPIEESLYYEKQFF 935
            LP++V++G QSAGK+SVLE I +    PRG+G ++TR P+M+ L   P+     KG   +F  T +K+     D++ E+  +        + +S + I++ +       + L+DLPG+         +     I +   R+    N+IIL I    +D   S+       +DP+GKRT+ V+TK+DL ++  T+    + IL G + P K LGY  VV+    + E I   K  EE  +   + F
Sbjct:   29 LPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQFKGNSRQFDLTQEKE---LKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVVTGTGNTSESIETIKTSEEGFFRTSKLF 270          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: DNM1L (dynamin-1-like protein [Source:NCBI gene;Acc:101160650])

HSP 1 Score: 412.149 bits (1058), Expect = 4.214e-133
Identity = 270/747 (36.14%), Postives = 413/747 (55.29%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    + LPQIV++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH DP+  + T           G+FLHT +K Y DF +I+ EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QP+DI++QIK   L++    NSIILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI + K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L+  ++E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   L  +         +D     G     Q+ P   Q          E G  S R M + +  E     +  +  +I        P  Q +  V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIMQLPQIVVVGTQSSGKSSVLESLVGRDILPRGTGVVTRRPLILQLVHIDPEDRRKTNEENGIDGEEWGKFLHTKNKIYTDFEEIRAEIEAETERISGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPRDIEIQIKELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINQKKLVVDSIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGNPVDDKNSTLLQLITKFAAEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTMDVLTAIRNATGPRPALFVPEISFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLIDAVVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACSLINNNLDEQRRHRLKEMPAGVP----RDKAPAGG----SQSAPAGEQT---------EGGTGSWRGM-LRRGDEGSSGDRVALHTQI-------PPSPQRSHAVNLLDVPVP------------VTRKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDCLQSELVGQLYKGPLLDDLLIESEDMAQRRTEAADMLKALQKSSQVIAEIRETH--MW 697          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: DNM1L (dynamin-1-like protein [Source:NCBI gene;Acc:101160650])

HSP 1 Score: 409.453 bits (1051), Expect = 1.213e-131
Identity = 270/756 (35.71%), Postives = 415/756 (54.89%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGTR----------GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKI---------ICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    + LPQIV++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH DP+  + T           G+FLHT +K Y DF +I+ EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QP+DI++QIK   L++    NSIILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI + K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L+  ++E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   L  +       +   +  G  F           + +   G  Q  S       E G  S R M + +  E     +  +  +I        P  Q +  V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIMQLPQIVVVGTQSSGKSSVLESLVGRDILPRGTGVVTRRPLILQLVHIDPEDRRKTNEENGIDGEEWGKFLHTKNKIYTDFEEIRAEIEAETERISGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPRDIEIQIKELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINQKKLVVDSIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGNPVDDKNSTLLQLITKFAAEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTMDVLTAIRNATGPRPALFVPEISFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLIDAVVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACSLINNNLDEQRRHRLKEMPAGVPRDKSLKSPSGQSFSYTDPPALEGEVLKAPAGGSQ--SAPAGEQTEGGTGSWRGM-LRRGDEGSSGDRVALHTQI-------PPSPQRSHAVNLLDVPVP------------VTRKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDCLQSELVGQLYKGPLLDDLLIESEDMAQRRTEAADMLKALQKSSQVIAEIRETH--MW 721          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: DNM1L (dynamin-1-like protein [Source:NCBI gene;Acc:101160650])

HSP 1 Score: 395.971 bits (1016), Expect = 7.166e-127
Identity = 265/740 (35.81%), Postives = 406/740 (54.86%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH-DPDGSKGTR---GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            M+ LIP+IN+LQD ++ +    + LPQIV++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH DP+  + T    G         Y DF +I+ EI  +T+ ++G  K ISD+PI LKI+S    NLTL+DLPG+TKV V  QP+DI++QIK   L++    NSIILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI + K + +S+  E  F  K Y  +A++NGT +L R+LN LL  HI+ CLP LK  I   + +AQY+  L+  G  + DK   + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   ++T IRN  GP    F  + +F  LVK QI++L  PS  C++ V++ +Q  +Q  S      +  FP L+  ++E   +L+++   +T  ++ NL+  E + I   HP++     L   N  E +   L  +         +D     G     Q+ P   Q          E G  S R M + +  E     +  +  +I        P  Q +  V +  +  P               +LS RE+         +  ++  L+  YF +VR+NI   +PK +  FLV H+K+ L + L   +Y    LD LL ESED++++R    ++++ L+   + I +I   H  +W
Sbjct:    1 MEALIPVINKLQDVFNTVGADIMQLPQIVVVGTQSSGKSSVLESLVGRDILPRGTGVVTRRPLILQLVHIDPEDRRKTNEENGNVPFPLLFIYTDFEEIRAEIEAETERISGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPRDIEIQIKELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINQKKLVVDSIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLNSYGNPVDDKNSTLLQLITKFAAEYCNTIEGTAKYIET-AELCGGARICYIFHETFGRTLESVDPLGGLTTMDVLTAIRNATGPRPALFVPEISFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLIDAVVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACSLINNNLDEQRRHRLKEMPAGVP----RDKAPAGG----SQSAPAGEQT---------EGGTGSWRGM-LRRGDEGSSGDRVALHTQI-------PPSPQRSHAVNLLDVPVP------------VTRKLSAREQ--------RDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDCLQSELVGQLYKGPLLDDLLIESEDMAQRRTEAADMLKALQKSSQVIAEIRETH--MW 690          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000013419.2 (dynamin-1-like protein [Source:NCBI gene;Acc:101168415])

HSP 1 Score: 379.407 bits (973), Expect = 9.721e-121
Identity = 210/502 (41.83%), Postives = 318/502 (63.35%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------DPDGSKGTR--GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH        + DG K  +  G+FLHT  K + DF +I+ EI ++T+ ++G  K IS++PI LKI+S    NLTL+DLPG+TKV V  QP+DI++QI++  L+     N IILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +++  E+ F  K Y  +A++NGT +L ++LN LL  HI+ CLP LK  I   + +AQY+  L   G  ++D    + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   I+T IRN  GP    F  + +F  LVK+Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L + I+E   +L+++   IT  ++ NL+  E + I   HP++
Sbjct:    1 METLIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVDAGDARNNEDGGKEVQEWGKFLHTKSKIFTDFDEIRLEIEQETERISGNNKGISEEPIHLKIFSPFVVNLTLVDLPGITKVPVGDQPQDIEIQIRDLILKHISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKCVADAIRDEQAFLQKKYPSLANRNGTKYLAKTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLSSYGEPVEDASATLLQLITKFATEYCNTIEGTAKYIET-AELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPSLFVPEISFELLVKKQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELQRFPKLHEAIVEVVTSLLRKRLPITNEMVHNLVAIELAYINTKHPDF 499          

HSP 2 Score: 56.9954 bits (136), Expect = 6.706e-8
Identity = 35/106 (33.02%), Postives = 62/106 (58.49%), Query Frame = 3
Query: 2037 ELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR*IW 2351
            +L+ R  +D E  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    L  LL ESED++++RK   ++++ L+   + I +I   H  +W
Sbjct:  580 KLSSREQRDCE--VIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSGLLTDLLTESEDMAQRRKEAADMLQALQRASQVIAEIRETH--LW 681          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000042041.1 (dynamin-1-like protein [Source:NCBI gene;Acc:101168415])

HSP 1 Score: 378.252 bits (970), Expect = 4.148e-119
Identity = 210/502 (41.83%), Postives = 318/502 (63.35%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVH--------DPDGSKGTR--GRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYK--LDLLGPEIKDKRILIPEFLTRFSNAY--RIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEAS--KAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNY 1622
            M+ LIP+IN+LQD ++ +    I LPQI ++G+QS+GKSSVLE++V ++ LPRGTG+VTR PL+L LVH        + DG K  +  G+FLHT  K + DF +I+ EI ++T+ ++G  K IS++PI LKI+S    NLTL+DLPG+TKV V  QP+DI++QI++  L+     N IILA++AAN D+A S++L+ A E+DP+G+RTL V+TKLDLMD GT A D+L+G+V+P +LG IGVV+RSQ DI   K + +++  E+ F  K Y  +A++NGT +L ++LN LL  HI+ CLP LK  I   + +AQY+  L   G  ++D    + + +T+F+  Y   I    ++ E   ++ GGA I  I +E F   L  +D    LT   I+T IRN  GP    F  + +F  LVK+Q+++L  PS  C++ V++ +Q  +Q  S      +  FP L + I+E   +L+++   IT  ++ NL+  E + I   HP++
Sbjct:    1 METLIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVDAGDARNNEDGGKEVQEWGKFLHTKSKIFTDFDEIRLEIEQETERISGNNKGISEEPIHLKIFSPFVVNLTLVDLPGITKVPVGDQPQDIEIQIRDLILKHISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKCVADAIRDEQAFLQKKYPSLANRNGTKYLAKTLNRLLMHHIRDCLPELKTRI--NVLAAQYQSLLSSYGEPVEDASATLLQLITKFATEYCNTIEGTAKYIETA-ELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPSLFVPEISFELLVKKQVKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELQRFPKLHEAIVEVVTSLLRKRLPITNEMVHNLVAIELAYINTKHPDF 499          

HSP 2 Score: 51.2174 bits (121), Expect = 4.052e-6
Identity = 30/86 (34.88%), Postives = 53/86 (61.63%), Query Frame = 3
Query: 2037 ELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRL-QNIYSHCDLDSLLQESEDISKQRKVTKELIE 2291
            +L+ R  +D E  ++  L+  YF +VR+NI   +PK +  FLV H+K++L + L   +Y    L  LL ESED++++RK   ++++
Sbjct:  580 KLSSREQRDCE--VIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSGLLTDLLTESEDMAQRRKEAADMLQ 663          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000058940.1 (SMESG000058940.1)

HSP 1 Score: 1472.6 bits (3811), Expect = 0.000e+0
Identity = 721/726 (99.31%), Postives = 725/726 (99.86%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR 2342
            MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSN+CID+VYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNF EAKAENLANVNCAANERQIKDNLIGCGFKI+CQNIPGNFQDF+RTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR
Sbjct:    1 MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDENLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNNCIDDVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFLEAKAENLANVNCAANERQIKDNLIGCGFKIVCQNIPGNFQDFNRTMIHYLESGNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHCDLDSLLQESEDISKQRKVTKELIEDLENVRRRIEDIYCDHR 726          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 348.591 bits (893), Expect = 1.112e-107
Identity = 253/741 (34.14%), Postives = 392/741 (52.90%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIP---GNFQDF-----SRTMIHYLESGNVSLRV---MEILQSREIE--------------PDQKGIMLDEIFDRLFHDCPEIQE-NKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHC-DLDSLLQESEDISKQRK 2270
            M+ LIPI+N+LQD +S + +P  +DLPQI ++GSQSAGKSSVLEN V ++FLPRG+GIVTR PL+L L    + S      F+H  +K + DF ++++EI  +TD L G  K IS  PI L++YS    NLTLIDLPGLTKVAV  QP DI+ QI++  + F   EN +ILA+S AN D+ANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT AR+IL  K+LP + GYIGVV+RSQ+DI   K I+ +L  E++FF  H  Y  +A + GTG+L + LN  L  HI++ LP L+  ++ ++ S + ++          P  K K +L  + +F T F  A     DG   E + + + GGA+I++I +E+FP  L+ I+ +       I   I+N  G     F+   AF  +V++QI KL  P+  CID V   +   V + +       FP L +EI       +K+    TK  +  L+  + S +  +H ++ +GF             N    +  + + ++ + +I  G+  I QNIP      +DF     + T+  Y +     ++    +E L+ R++E              PD K +  D     L  +  E+ +  K   +   + P       + Q    N       +   P  + +   +R LV  Y  ++ +     +PK I   +V  +K+     L  +   C D  +L++ES +  ++R+
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----NFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAI----DGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKME--NFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF-IGFA------------NAEQKSSDSGKNKLGNQIIRKGWLTI-QNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP-------VKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKRE 716          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 348.977 bits (894), Expect = 1.317e-107
Identity = 254/748 (33.96%), Postives = 391/748 (52.27%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGF-------KIICQNIP---GNFQDF-----SRTMIHYLESGNVSLRV---MEILQSREIE--------------PDQKGIMLDEIFDRLFHDCPEIQE-NKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHC-DLDSLLQESEDISKQRK 2270
            M+ LIPI+N+LQD +S + +P  +DLPQI ++GSQSAGKSSVLEN V ++FLPRG+GIVTR PL+L L    + S      F+H  +K + DF ++++EI  +TD L G  K IS  PI L++YS    NLTLIDLPGLTKVAV  QP DI+ QI++  + F   EN +ILA+S AN D+ANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT AR+IL  K+LP + GYIGVV+RSQ+DI   K I+ +L  E++FF  H  Y  +A + GTG+L + LN  L  HI++ LP L+  ++ ++ S + ++          P  K K +L  + +F T F  A     DG   E + + + GGA+I++I +E+FP  L+ I+ +       I   I+N  G     F+   AF  +V++QI KL  P+  CID V   +   V + +       FP L +EI       +K+    TK  +  L+  + S +  +H ++ +GF   +    ++    L N        Q+  N+    F        +  QNIP      +DF     + T+  Y +     ++    +E L+ R++E              PD K +  D     L  +  E+ +  K   +   + P       + Q    N       +   P  + +   +R LV  Y  ++ +     +PK I   +V  +K+     L  +   C D  +L++ES +  ++R+
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----NFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAI----DGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKME--NFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF-IGFANAEQKSSDSGKNKLGN--------QVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP-------VKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKRE 728          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 348.206 bits (892), Expect = 1.902e-107
Identity = 253/741 (34.14%), Postives = 392/741 (52.90%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIP---GNFQDF-----SRTMIHYLESGNVSLRV---MEILQSREIE--------------PDQKGIMLDEIFDRLFHDCPEIQE-NKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHC-DLDSLLQESEDISKQRK 2270
            M+ LIPI+N+LQD +S + +P  +DLPQI ++GSQSAGKSSVLEN V ++FLPRG+GIVTR PL+L L    + S      F+H  +K + DF ++++EI  +TD L G  K IS  PI L++YS    NLTLIDLPGLTKVAV  QP DI+ QI++  + F   EN +ILA+S AN D+ANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT AR+IL  K+LP + GYIGVV+RSQ+DI   K I+ +L  E++FF  H  Y  +A + GTG+L + LN  L  HI++ LP L+  ++ ++ S + ++          P  K K +L  + +F T F  A     DG   E + + + GGA+I++I +E+FP  L+ I+ +       I   I+N  G     F+   AF  +V++QI KL  P+  CID V   +   V + +       FP L +EI       +K+    TK  +  L+  + S +  +H ++ +GF             N    +  + + ++ + +I  G+  I QNIP      +DF     + T+  Y +     ++    +E L+ R++E              PD K +  D     L  +  E+ +  K   +   + P       + Q    N       +   P  + +   +R LV  Y  ++ +     +PK I   +V  +K+     L  +   C D  +L++ES +  ++R+
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----NFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAI----DGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKME--NFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF-IGFA------------NAEQKSSDSGKNKLGNQIIRKGWLTI-QNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP-------VKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKRE 716          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 347.821 bits (891), Expect = 2.995e-107
Identity = 253/741 (34.14%), Postives = 392/741 (52.90%), Query Frame = 3
Query:  165 MDQLIPIINELQDTYSKLNMPF-IDLPQIVIIGSQSAGKSSVLENIVRQEFLPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEIIRQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDIDVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLCVITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESLYYEKQFFDKH--YSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKIQSAQYKLDLL------GPEIKDKRIL--IPEFLTRFSNAYRIINDGEFDE-NLNKIKGGAIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAFIGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEILEETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEAKAENLANVNCAANERQIKDNLIGCGFKIICQNIP---GNFQDF-----SRTMIHYLESGNVSLRV---MEILQSREIE--------------PDQKGIMLDEIFDRLFHDCPEIQE-NKVVIINTILNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMVRENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHC-DLDSLLQESEDISKQRK 2270
            M+ LIPI+N+LQD +S + +P  +DLPQI ++GSQSAGKSSVLEN V ++FLPRG+GIVTR PL+L L    + S      F+H  +K + DF ++++EI  +TD L G  K IS  PI L++YS    NLTLIDLPGLTKVAV  QP DI+ QI++  + F   EN +ILA+S AN D+ANSD+L+ A+E+DP+G RT+ VITKLDLMD+GT AR+IL  K+LP + GYIGVV+RSQ+DI   K I+ +L  E++FF  H  Y  +A + GTG+L + LN  L  HI++ LP L+  ++ ++ S + ++          P  K K +L  + +F T F  A     DG   E + + + GGA+I++I +E+FP  L+ I+ +       I   I+N  G     F+   AF  +V++QI KL  P+  CID V   +   V + +       FP L +EI       +K+    TK  +  L+  + S +  +H ++ +GF             N    +  + + ++ + +I  G+  I QNIP      +DF     + T+  Y +     ++    +E L+ R++E              PD K +  D     L  +  E+ +  K   +   + P       + Q    N       +   P  + +   +R LV  Y  ++ +     +PK I   +V  +K+     L  +   C D  +L++ES +  ++R+
Sbjct:    7 MEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----NFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAI----DGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKME--NFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDF-IGFA------------NAEQKSSDSGKNKLGNQIIRKGWLTI-QNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSKNVYKDYKQLELVAESQELMDCWKASFLRAGIYP-------VKQESESNNTEADNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKRE 716          
The following BLAST results are available for this feature:
BLAST of Dynamin-1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM1L6.177e-13736.92dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L6.964e-13735.81dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L7.654e-13736.29dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L1.022e-12541.71dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L1.215e-12542.56dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drp-13.762e-11843.37Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-13.762e-11843.37Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-13.762e-11843.37Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-16.496e-11843.37Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-16.496e-11843.37Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drp18.150e-12734.71gene:FBgn0026479 transcript:FBtr0077744[more]
Drp18.150e-12734.71gene:FBgn0026479 transcript:FBtr0335173[more]
shi5.189e-10634.49gene:FBgn0003392 transcript:FBtr0301597[more]
shi9.359e-10634.63gene:FBgn0003392 transcript:FBtr0301596[more]
shi2.010e-10134.22gene:FBgn0003392 transcript:FBtr0074122[more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l4.457e-13736.01dynamin 1-like [Source:NCBI gene;Acc:393896][more]
dnm1l1.833e-13635.69dynamin 1-like [Source:NCBI gene;Acc:393896][more]
si:dkey-32e23.42.301e-11339.55si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-4... [more]
si:dkey-32e23.42.301e-11339.55si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-4... [more]
dnm2a8.555e-10934.19dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l8.384e-13635.52dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l1.634e-13535.60dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l4.418e-13535.39dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l1.574e-12935.92dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l1.464e-12542.94dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnm1l3.748e-13735.76dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l1.251e-13635.42dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l3.361e-13636.36dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm11.403e-10633.93dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm31.487e-10633.29dynamin 3 [Source:MGI Symbol;Acc:MGI:1341299][more]
back to top
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SXN5|DNM1L_DANRE3.365e-13636.01Dynamin-1-like protein OS=Danio rerio OX=7955 GN=d... [more]
sp|O00429|DNM1L_HUMAN3.676e-13636.29Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q2KIA5|DNM1L_BOVIN1.763e-13536.05Dynamin-1-like protein OS=Bos taurus OX=9913 GN=DN... [more]
sp|Q8K1M6|DNM1L_MOUSE1.997e-13535.96Dynamin-1-like protein OS=Mus musculus OX=10090 GN... [more]
sp|Q94464|DYNA_DICDI1.992e-13146.71Dynamin-A OS=Dictyostelium discoideum OX=44689 GN=... [more]
back to top
BLAST of Dynamin-1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095ALR21.984e-14236.51Dynamin-1-like protein OS=Schistosoma haematobium ... [more]
A0A430Q9022.048e-14136.38Dynamin 1-like protein OS=Schistosoma bovis OX=618... [more]
G4V9Q04.980e-14136.68Putative dynamin OS=Schistosoma mansoni OX=6183 GN... [more]
A0A5K3EJB01.571e-13936.78Uncharacterized protein OS=Mesocestoides corti OX=... [more]
C1LEY92.612e-13936.23Dynamin 1-like protein OS=Schistosoma japonicum OX... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l2.687e-13635.87dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
dnm1l3.023e-13535.18dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
dnm1l3.391e-13535.43dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
dnm1l2.005e-13435.49dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
si:dkey-32e23.44.079e-11741.92dynamin-1-like protein [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002816.13.763e-13035.42pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
ENSPMAT00000006976.16.166e-8538.50pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
mxb1.696e-5232.58myxovirus (influenza) resistance B [Source:NCBI ge... [more]
ENSPMAT00000007915.11.580e-4934.92pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene... [more]
opa13.310e-2330.91OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
DNM11.650e-10640.11Dynamin-related GTPase involved in mitochondrial o... [more]
VPS12.480e-10638.94Dynamin-like GTPase required for vacuolar sorting;... [more]
MGM14.586e-4440.74Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO348953.129e-12542.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321917.134e-11141.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403591.443e-2530.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM1L4.214e-13336.14dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
DNM1L1.213e-13135.71dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
DNM1L7.166e-12735.81dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000013419.29.721e-12141.83dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000042041.14.148e-11941.83dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058940.10.000e+099.31SMESG000058940.1[more]
SMESG000067156.11.112e-10734.14SMESG000067156.1[more]
SMESG000067156.11.317e-10733.96SMESG000067156.1[more]
SMESG000067156.11.902e-10734.14SMESG000067156.1[more]
SMESG000067156.12.995e-10734.14SMESG000067156.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000459 ID=SMED30000459|Name=Dynamin-1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2381bp
ATAGAATGGTGTCAAATATGATCTAAACGGCTGATTTTCACTAATTTTGC
GTCCTGTTGTTGAAATTACCGTTTTCTATTGAATTATTTACATGTGTCAA
GGGTCACTTAAAGTTTTTATATAAACAGAGATTTTAATATTAAAATTTTG
TGAAAACGTTGAAAATGGATCAATTAATTCCAATTATCAATGAGTTACAA
GATACTTACTCTAAGCTCAACATGCCCTTCATTGACTTACCTCAGATTGT
CATCATTGGATCACAGAGCGCTGGAAAAAGTTCAGTTCTAGAAAATATCG
TACGTCAGGAATTCCTGCCAAGAGGAACTGGAATAGTCACAAGATGTCCC
TTAATGTTGCATTTGGTTCACGATCCGGATGGCTCTAAAGGAACCAGGGG
TCGATTTCTTCATACTGGTGACAAAGACTATTATGATTTCAGTGATATAA
AAGAAGAAATAATCCGACAAACCGACATACTTGCTGGATGTGAAAAGAAT
ATTTCTGATCAACCAATAACATTGAAGATTTACAGTCATGAATTCCCGAA
TTTGACCCTGATTGACCTACCTGGATTAACAAAAGTAGCCGTGGAAACCC
AACCAAAAGATATTGATGTTCAAATAAAGAATACTTGTTTGAGATTTGCG
AGAAAAGAAAATTCGATAATCCTAGCGATTTCTGCTGCCAACGTCGACTT
GGCCAACAGCGATTCGTTAAGATTTGCTGAAGAATTAGATCCCGAAGGCA
AACGAACTTTGTGCGTTATTACTAAACTAGATCTCATGGACAAAGGAACA
ACAGCCCGTGACATTCTTATTGGAAAGGTCCTTCCAAAGCAACTGGGCTA
CATTGGAGTAGTAAGTCGATCACAAGAAGACATTCTAAAAGGAAAACCAA
TCGAGGAATCTTTGTATTATGAAAAGCAATTTTTCGACAAACATTATTCG
GATATCGCATCTAAAAATGGAACTGGTTTTTTGACACGTAGCCTCAATAT
GTTACTGAAAAAGCACATAAAAAAGTGCCTACCCAATCTAAAAGAAACAA
TCAGAGAAAAGATTCAATCAGCTCAATATAAATTGGATTTGCTAGGTCCG
GAAATCAAAGATAAAAGGATCCTGATCCCAGAATTTCTTACAAGATTTTC
AAATGCTTATCGAATAATCAATGATGGAGAATTCGATGAAAATCTAAATA
AAATTAAAGGGGGGGCAATTATTTCTCAAATAATTTACGAGAAATTTCCA
GCTATTTTAATGGATATCGACATAGAAAGTTATCTCACAAATGATGTTAT
TATGACGACCATACGAAACACATGTGGGCCCGATAAAATGTCGTTTTCGC
GTCAGAAAGCATTCATAGGCTTGGTGAAGGAACAAATACAAAAATTAGTG
AGTCCAAGTAATGACTGTATTGATAACGTCTATGATGTAATACAAGCGTT
CGTTCAGGAAGCCAGTAAAGCATTTCCAATTTTCACATTTCCGCATCTGA
TGAAGGAGATTTTAGAAGAAACGCATGCACTGATTAAACAGAGTTATAAA
ATTACGAAATCTTTGATTGAAAATTTGATCAAAAGTGAAAAGTCCGACAT
AATGTGCAGCCATCCTAATTATGAATTGGGTTTTGTACTGCAAAAAATGA
ACTTTTTTGAAGCAAAGGCGGAAAATCTAGCAAATGTCAACTGTGCAGCC
AATGAAAGGCAAATAAAAGATAACTTAATCGGATGTGGTTTCAAAATAAT
CTGTCAAAACATCCCAGGAAACTTTCAGGATTTCAGCAGAACAATGATTC
ATTATCTGGAATCGGGCAATGTCAGTCTGCGAGTTATGGAAATATTGCAA
AGCCGGGAAATTGAACCCGACCAAAAAGGCATTATGCTAGATGAGATATT
TGATAGACTCTTTCATGACTGTCCTGAAATCCAAGAAAATAAAGTCGTCA
TTATCAACACAATTCTCAATCCCGAATACAAGTTTTATGATGATCTCATT
CAACACGAATTTAAAAATCAGCTTTCTAAGCGAGAAGAGTTGACTCCAAG
ACCTAATCAAGACCACGAATTTTCTATATTAAGAGCGCTCGTCATAGAAT
ACTTCAACATGGTGCGGGAAAATATCTGCTACTACATTCCAAAACTGATC
AAATCTTTCTTAGTGATCCATATTAAGGAGAACTTGATGAACCGTTTACA
GAATATCTATTCACATTGCGATTTGGATAGTTTGCTGCAGGAGTCAGAAG
ATATCAGCAAGCAAAGAAAGGTTACCAAAGAATTGATAGAGGATTTGGAA
AACGTCAGACGACGCATCGAAGACATTTACTGTGATCACAGATAGATTTG
GACAAGAGCTACATGTTTTATGATGCTTAAA
back to top

protein sequence of SMED30000459-orf-1

>SMED30000459-orf-1 ID=SMED30000459-orf-1|Name=SMED30000459-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=727bp
MDQLIPIINELQDTYSKLNMPFIDLPQIVIIGSQSAGKSSVLENIVRQEF
LPRGTGIVTRCPLMLHLVHDPDGSKGTRGRFLHTGDKDYYDFSDIKEEII
RQTDILAGCEKNISDQPITLKIYSHEFPNLTLIDLPGLTKVAVETQPKDI
DVQIKNTCLRFARKENSIILAISAANVDLANSDSLRFAEELDPEGKRTLC
VITKLDLMDKGTTARDILIGKVLPKQLGYIGVVSRSQEDILKGKPIEESL
YYEKQFFDKHYSDIASKNGTGFLTRSLNMLLKKHIKKCLPNLKETIREKI
QSAQYKLDLLGPEIKDKRILIPEFLTRFSNAYRIINDGEFDENLNKIKGG
AIISQIIYEKFPAILMDIDIESYLTNDVIMTTIRNTCGPDKMSFSRQKAF
IGLVKEQIQKLVSPSNDCIDNVYDVIQAFVQEASKAFPIFTFPHLMKEIL
EETHALIKQSYKITKSLIENLIKSEKSDIMCSHPNYELGFVLQKMNFFEA
KAENLANVNCAANERQIKDNLIGCGFKIICQNIPGNFQDFSRTMIHYLES
GNVSLRVMEILQSREIEPDQKGIMLDEIFDRLFHDCPEIQENKVVIINTI
LNPEYKFYDDLIQHEFKNQLSKREELTPRPNQDHEFSILRALVIEYFNMV
RENICYYIPKLIKSFLVIHIKENLMNRLQNIYSHCDLDSLLQESEDISKQ
RKVTKELIEDLENVRRRIEDIYCDHR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR003130GED
IPR001401Dynamin_GTPase
IPR027417P-loop_NTPase
IPR000375Dynamin_central
IPR019762Dynamin_GTPase_CS
IPR020850GED_dom
IPR030381G_DYNAMIN_dom
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0000266mitochondrial fission
GO:0016559peroxisome fission
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022812Dynamin superfamilyPRINTSPR00195DYNAMINcoord: 124..141
score: 67.01
coord: 25..43
score: 75.51
coord: 50..67
score: 75.74
coord: 174..192
score: 50.59
coord: 193..209
score: 67.71
coord: 216..235
score: 43.88
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 28..204
e-value: 7.0E-47
score: 159.6
IPR022812Dynamin superfamilyPANTHERPTHR11566DYNAMINcoord: 1..721
IPR001401Dynamin, GTPase domainSMARTSM00053dynamin_3coord: 1..244
e-value: 2.9E-103
score: 359.0
IPR001401Dynamin, GTPase domainCDDcd08771DLP_1coord: 23..290
e-value: 3.22347E-117
score: 351.548
IPR003130Dynamin GTPase effectorSMARTSM00302GED_2coord: 631..721
e-value: 5.5E-8
score: 42.5
IPR003130Dynamin GTPase effectorPFAMPF02212GEDcoord: 632..720
e-value: 1.7E-15
score: 56.9
IPR000375Dynamin central domainPFAMPF01031Dynamin_Mcoord: 214..486
e-value: 9.9E-63
score: 212.0
IPR019762Dynamin, GTPase region, conserved sitePROSITEPS00410G_DYNAMIN_1coord: 51..60
IPR030381Dynamin-type guanine nucleotide-binding (G) domainPROSITEPS51718G_DYNAMIN_2coord: 22..290
score: 51.854
IPR020850GTPase effector domainPROSITEPS51388GEDcoord: 636..726
score: 14.522
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..299