Calcitonin receptor

Overview
NameCalcitonin receptor
Smed IDSMED30000450
Length (bp)1177
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcitonin receptor (SMED30000450) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcitonin receptor (SMED30000450) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcitonin receptor (SMED30000450) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcitonin receptor (SMED30000450) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000450

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30000450h1SMcG0007917 SmedASXL_009385SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000450h1SMcG0007917 dd_Smed_v4_18236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000450h1SMcG0007917 dd_Smed_v4_18236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000450h1SMcG0007917 dd_Smed_v4_18236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcitonin receptor vs. Ensembl Human
Match: CALCRL (calcitonin receptor like receptor [Source:HGNC Symbol;Acc:HGNC:16709])

HSP 1 Score: 178.333 bits (451), Expect = 8.629e-51
Identity = 125/385 (32.47%), Postives = 197/385 (51.17%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNI----NAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN--------AAATRRFQTVRSTSRRSFTKSDGSFDGH 1165
            +  PI     ++C   +D  +LCWN    G+++ Q CPD    F      +K C+ +G W+   A NRTWTN+  C +N    +    N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ +T +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPLI    +A  R  L   + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +L     E +    + ++I  +++ FQG ++S I CF N EV+  +  N          +    + +RS S    T SDG    H
Sbjct:   53 MQDPIQQAEGVYCNRTWDG-WLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YFLGWGFPLIPACIHAIAR-SLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSH 434          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: CALCRL (calcitonin receptor like receptor [Source:HGNC Symbol;Acc:HGNC:16709])

HSP 1 Score: 178.333 bits (451), Expect = 8.629e-51
Identity = 125/385 (32.47%), Postives = 197/385 (51.17%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNI----NAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN--------AAATRRFQTVRSTSRRSFTKSDGSFDGH 1165
            +  PI     ++C   +D  +LCWN    G+++ Q CPD    F      +K C+ +G W+   A NRTWTN+  C +N    +    N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ +T +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPLI    +A  R  L   + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +L     E +    + ++I  +++ FQG ++S I CF N EV+  +  N          +    + +RS S    T SDG    H
Sbjct:   53 MQDPIQQAEGVYCNRTWDG-WLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YFLGWGFPLIPACIHAIAR-SLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSH 434          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: CALCRL (calcitonin receptor like receptor [Source:HGNC Symbol;Acc:HGNC:16709])

HSP 1 Score: 178.333 bits (451), Expect = 8.629e-51
Identity = 125/385 (32.47%), Postives = 197/385 (51.17%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNI----NAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN--------AAATRRFQTVRSTSRRSFTKSDGSFDGH 1165
            +  PI     ++C   +D  +LCWN    G+++ Q CPD    F      +K C+ +G W+   A NRTWTN+  C +N    +    N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ +T +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPLI    +A  R  L   + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +L     E +    + ++I  +++ FQG ++S I CF N EV+  +  N          +    + +RS S    T SDG    H
Sbjct:   53 MQDPIQQAEGVYCNRTWDG-WLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YFLGWGFPLIPACIHAIAR-SLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSH 434          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: CALCR (calcitonin receptor [Source:HGNC Symbol;Acc:HGNC:1440])

HSP 1 Score: 171.4 bits (433), Expect = 4.069e-48
Identity = 107/328 (32.62%), Postives = 183/328 (55.79%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNI--NAVYIYF---AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            D +LCW+ T  G  +YQ CPD  P F      +K C+  G W+     NRTW+N+  C    P    NA  +Y+    G+SLS+  + ISL IF +F+ L C+RV +HKN+F++Y+LN+ I  +  + ++    ++  +P  C+I++    +    +YFW   EG+YL T++V+A     ++L +     GWGFPL+ T  +A  R  +   + CW ++++ +  I+  P + AL+ N   ++ I+++L+TK+      E   + K  +A  IL P+LGIQ ++F     ++ +  I +++   +I FQG  ++ I CFCNNEV+  +
Sbjct:   77 DGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVAVFTEKQRLRWY-YLLGWGFPLVPTTIHAITR-AVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTV 402          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: CALCR (calcitonin receptor [Source:HGNC Symbol;Acc:HGNC:1440])

HSP 1 Score: 171.4 bits (433), Expect = 4.069e-48
Identity = 107/328 (32.62%), Postives = 183/328 (55.79%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNI--NAVYIYF---AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            D +LCW+ T  G  +YQ CPD  P F      +K C+  G W+     NRTW+N+  C    P    NA  +Y+    G+SLS+  + ISL IF +F+ L C+RV +HKN+F++Y+LN+ I  +  + ++    ++  +P  C+I++    +    +YFW   EG+YL T++V+A     ++L +     GWGFPL+ T  +A  R  +   + CW ++++ +  I+  P + AL+ N   ++ I+++L+TK+      E   + K  +A  IL P+LGIQ ++F     ++ +  I +++   +I FQG  ++ I CFCNNEV+  +
Sbjct:   77 DGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVVAVFTEKQRLRWY-YLLGWGFPLVPTTIHAITR-AVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTV 402          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 93.2041 bits (230), Expect = 1.910e-20
Identity = 93/387 (24.03%), Postives = 175/387 (45.22%), Query Frame = 2
Query:   74 PNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRT----WTNFDPC---------INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHN-----------PSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASL-----RYQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNIL----FFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRS 1132
            PN   I+C   +D + LCW  T   S     CP + G        K+C+  G W   +  +      WTNF  C         I +    NA  + F G  LS++ + +++ IF YF++L+  R  +H +L I+ ++  I  +  ++ +I       H            P  C+ ++  + +F   ++ W F EG+YL   +V  F +   KLL   +  G+G PL+ T+ +  +      +++E+    + ++ +   IL  P +  L+ NL  +  ++++L +K+    N  +   +K+ +A  +L P+LG+ NI+    F  + ++  V  +  + A+    +QG +++ I CF N EV   +    A  R     ++  RR 
Sbjct:   67 PNDTRIWCNATYDTV-LCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFI-AGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFW-ILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRG 450          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 93.2041 bits (230), Expect = 1.910e-20
Identity = 93/387 (24.03%), Postives = 175/387 (45.22%), Query Frame = 2
Query:   74 PNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRT----WTNFDPC---------INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHN-----------PSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASL-----RYQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNIL----FFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRS 1132
            PN   I+C   +D + LCW  T   S     CP + G        K+C+  G W   +  +      WTNF  C         I +    NA  + F G  LS++ + +++ IF YF++L+  R  +H +L I+ ++  I  +  ++ +I       H            P  C+ ++  + +F   ++ W F EG+YL   +V  F +   KLL   +  G+G PL+ T+ +  +      +++E+    + ++ +   IL  P +  L+ NL  +  ++++L +K+    N  +   +K+ +A  +L P+LG+ NI+    F  + ++  V  +  + A+    +QG +++ I CF N EV   +    A  R     ++  RR 
Sbjct:   67 PNDTRIWCNATYDTV-LCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFI-AGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFW-ILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRG 450          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 92.4337 bits (228), Expect = 3.573e-20
Identity = 93/387 (24.03%), Postives = 175/387 (45.22%), Query Frame = 2
Query:   74 PNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRT----WTNFDPC---------INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHN-----------PSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASL-----RYQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNIL----FFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRS 1132
            PN   I+C   +D + LCW  T   S     CP + G        K+C+  G W   +  +      WTNF  C         I +    NA  + F G  LS++ + +++ IF YF++L+  R  +H +L I+ ++  I  +  ++ +I       H            P  C+ ++  + +F   ++ W F EG+YL   +V  F +   KLL   +  G+G PL+ T+ +  +      +++E+    + ++ +   IL  P +  L+ NL  +  ++++L +K+    N  +   +K+ +A  +L P+LG+ NI+    F  + ++  V  +  + A+    +QG +++ I CF N EV   +    A  R     ++  RR 
Sbjct:   67 PNDTRIWCNATYDTV-LCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFI-AGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEF-WILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRG 450          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 92.4337 bits (228), Expect = 3.573e-20
Identity = 93/387 (24.03%), Postives = 175/387 (45.22%), Query Frame = 2
Query:   74 PNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRT----WTNFDPC---------INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHN-----------PSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASL-----RYQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNIL----FFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRS 1132
            PN   I+C   +D + LCW  T   S     CP + G        K+C+  G W   +  +      WTNF  C         I +    NA  + F G  LS++ + +++ IF YF++L+  R  +H +L I+ ++  I  +  ++ +I       H            P  C+ ++  + +F   ++ W F EG+YL   +V  F +   KLL   +  G+G PL+ T+ +  +      +++E+    + ++ +   IL  P +  L+ NL  +  ++++L +K+    N  +   +K+ +A  +L P+LG+ NI+    F  + ++  V  +  + A+    +QG +++ I CF N EV   +    A  R     ++  RR 
Sbjct:   67 PNDTRIWCNATYDTV-LCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFI-AGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEF-WILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRG 450          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 92.4337 bits (228), Expect = 4.119e-20
Identity = 93/387 (24.03%), Postives = 175/387 (45.22%), Query Frame = 2
Query:   74 PNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRT----WTNFDPC---------INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHN-----------PSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASL-----RYQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNIL----FFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRS 1132
            PN   I+C   +D + LCW  T   S     CP + G        K+C+  G W   +  +      WTNF  C         I +    NA  + F G  LS++ + +++ IF YF++L+  R  +H +L I+ ++  I  +  ++ +I       H            P  C+ ++  + +F   ++ W F EG+YL   +V  F +   KLL   +  G+G PL+ T+ +  +      +++E+    + ++ +   IL  P +  L+ NL  +  ++++L +K+    N  +   +K+ +A  +L P+LG+ NI+    F  + ++  V  +  + A+    +QG +++ I CF N EV   +    A  R     ++  RR 
Sbjct:   67 PNDTRIWCNATYDTV-LCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFI-AGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEF-WILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRG 450          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0343652)

HSP 1 Score: 139.043 bits (349), Expect = 2.019e-36
Identity = 117/374 (31.28%), Postives = 197/374 (52.67%), Query Frame = 2
Query:   11 LLKMDNFEREKLKNACLMQPIPNKV--------DIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-----INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPE--KCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQW--RKTARAIFILFPVLGIQNILF-FMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            ++ M N + E  +   LM  + +           +FCP  FD  YLCW  T  G+   Q CPD + GF+++ +A K C  NG+WY     N+TW+N+  C++         IN +Y+   GY+LS+L + IS+ IF  FK L+C R+ IH +LF S     + W+  +  ++ +   +  NP +C  ++++V +F + +YFW F EGL+L  VLV+ F   +  + +  V   W  P+ + I Y   R+    P+   CW   S    I  +P  ++L+A+ + +I +L++++ KL HP + +      RK  RA  IL P+ G+Q+ L  +       +    + ++ V++S QG V+SF+ CF N++V  AI
Sbjct:   84 VIDMRNVDEELAEKEELMATVVSATMATNQKENRLFCPLNFDG-YLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLENGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYV--KGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIV-ISWFSPIPIAIVYGLARH-FSSPDNKHCWITDSLYLWIFSVPITLSLLASFIFLINVLRVIVRKL-HPQSAQPAPLAIRKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDVTFAI 451          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0073753)

HSP 1 Score: 139.043 bits (349), Expect = 2.019e-36
Identity = 117/374 (31.28%), Postives = 197/374 (52.67%), Query Frame = 2
Query:   11 LLKMDNFEREKLKNACLMQPIPNKV--------DIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-----INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPE--KCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQW--RKTARAIFILFPVLGIQNILF-FMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            ++ M N + E  +   LM  + +           +FCP  FD  YLCW  T  G+   Q CPD + GF+++ +A K C  NG+WY     N+TW+N+  C++         IN +Y+   GY+LS+L + IS+ IF  FK L+C R+ IH +LF S     + W+  +  ++ +   +  NP +C  ++++V +F + +YFW F EGL+L  VLV+ F   +  + +  V   W  P+ + I Y   R+    P+   CW   S    I  +P  ++L+A+ + +I +L++++ KL HP + +      RK  RA  IL P+ G+Q+ L  +       +    + ++ V++S QG V+SF+ CF N++V  AI
Sbjct:   84 VIDMRNVDEELAEKEELMATVVSATMATNQKENRLFCPLNFDG-YLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLENGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYV--KGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIV-ISWFSPIPIAIVYGLARH-FSSPDNKHCWITDSLYLWIFSVPITLSLLASFIFLINVLRVIVRKL-HPQSAQPAPLAIRKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDVTFAI 451          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Dh31-R (gene:FBgn0052843 transcript:FBtr0330735)

HSP 1 Score: 136.732 bits (343), Expect = 6.198e-36
Identity = 115/342 (33.63%), Postives = 182/342 (53.22%), Query Frame = 2
Query:   80 KVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVY----IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVH-NPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEK---CWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNRE-----QKQWRKTARAIFILFPVLGIQNILF-FMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEV 1060
            +    C   FD  +LCW  T  G+  Y+ CPD I GF     A K+C ++G W+     N+TW+N+  C+N + ++N  +    I   GY  S+L + +SL I  YFK L+C R+ +H NLF S+  N   W+ +  ++   + ++H +P  C  +++ + +F +S+Y W   EG YL TVLV AF    K+L+   + FGWG P I+   Y+  R     PE    CW  ++  QNIL++P  I++  NL+ +  I++++L KL  P + +      +   +  RA  +L P+LG+Q IL  F  +         E I+A   SFQG  ++ + CFCN EV
Sbjct:   63 EAGTHCAGTFDG-WLCWPDTAVGTSAYELCPDFITGFDPARYAHKECGLDGEWFKHPLTNKTWSNYTTCVN-LEDLNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMNLFASFAANNSLWLVWYLLVMPNSELLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFIS-EKRLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQNILMVPVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYILTPFRPAPKHPWENTYEIISAFTASFQGLCVAILFCFCNGEV 401          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Dh31-R (gene:FBgn0052843 transcript:FBtr0087755)

HSP 1 Score: 136.346 bits (342), Expect = 9.413e-36
Identity = 115/342 (33.63%), Postives = 182/342 (53.22%), Query Frame = 2
Query:   80 KVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVY----IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVH-NPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEK---CWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNRE-----QKQWRKTARAIFILFPVLGIQNILF-FMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEV 1060
            +    C   FD  +LCW  T  G+  Y+ CPD I GF     A K+C ++G W+     N+TW+N+  C+N + ++N  +    I   GY  S+L + +SL I  YFK L+C R+ +H NLF S+  N   W+ +  ++   + ++H +P  C  +++ + +F +S+Y W   EG YL TVLV AF    K+L+   + FGWG P I+   Y+  R     PE    CW  ++  QNIL++P  I++  NL+ +  I++++L KL  P + +      +   +  RA  +L P+LG+Q IL  F  +         E I+A   SFQG  ++ + CFCN EV
Sbjct:   63 EAGTHCAGTFDG-WLCWPDTAVGTSAYELCPDFITGFDPARYAHKECGLDGEWFKHPLTNKTWSNYTTCVN-LEDLNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMNLFASFAANNSLWLVWYLLVMPNSELLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFIS-EKRLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQNILMVPVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYILTPFRPAPKHPWENTYEIISAFTASFQGLCVAILFCFCNGEV 401          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Dh31-R (gene:FBgn0052843 transcript:FBtr0330736)

HSP 1 Score: 136.732 bits (343), Expect = 4.601e-35
Identity = 115/342 (33.63%), Postives = 181/342 (52.92%), Query Frame = 2
Query:   80 KVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVY----IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMT-FLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEK---CWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNRE-----QKQWRKTARAIFILFPVLGIQNILF-FMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEV 1060
            +    C   FD  +LCW  T  G+  Y+ CPD I GF     A K+C ++G W+     N+TW+N+  C+N + ++N  +    I   GY  S+L + +SL I  YFK L+C R+ +H NLF S+  N   W+  +L ++    ++  +P  C  +++ + +F +S+Y W   EG YL TVLV AF    K+L+   + FGWG P I+   Y+  R     PE    CW  ++  QNIL++P  I++  NL+ +  I++++L KL  P + +      +   +  RA  +L P+LG+Q IL  F  +         E I+A   SFQG  ++ + CFCN EV
Sbjct:   63 EAGTHCAGTFDG-WLCWPDTAVGTSAYELCPDFITGFDPARYAHKECGLDGEWFKHPLTNKTWSNYTTCVN-LEDLNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMNLFASFAANNSLWLVWYLLVMPNSELLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFIS-EKRLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQNILMVPVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYILTPFRPAPKHPWENTYEIISAFTASFQGLCVAILFCFCNGEV 401          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 178.718 bits (452), Expect = 4.106e-50
Identity = 115/344 (33.43%), Postives = 193/344 (56.10%), Query Frame = 2
Query:   65 QPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-INAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            QP  NK  ++C   +D  +LCW+ T  G+ T Q CP+    F      +K C+  G W+     NRTW+N+  CI    + +   YI +     G++LS++ + ISL IFFYF+ L C+R+ +HKNLF SYVLN A T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +  ++  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++     E+R    I ++I  +++ +QG +++ I CF N EV+ A+
Sbjct:  191 QPY-NKSGLYCNRTWDG-WLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDETGNWFRHPETNRTWSNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNPISCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPASIHAVARKKYFD-DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGEIYDYIMHILMHYQGLLVATIFCFFNGEVQGAL 530          

HSP 2 Score: 57.3806 bits (137), Expect = 1.553e-8
Identity = 25/65 (38.46%), Postives = 36/65 (55.38%), Query Frame = 2
Query:   77 NKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTN 271
            NK   FC   +D L LCW+ T  G+   QNCPD P F      +K C+ +G W    ++N+TW++
Sbjct:   67 NKTGSFCSRFWDGL-LCWDETPAGTFASQNCPDYPSFDPLEKVTKYCDESGNWVHSASINKTWSH 130          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 174.866 bits (442), Expect = 5.431e-49
Identity = 120/369 (32.52%), Postives = 200/369 (54.20%), Query Frame = 2
Query:   65 QPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-INAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN--------AAATRRFQTVRSTS 1123
            QP  NK  ++C   +D  +LCW+ T  G+ T Q CP+    F      +K C+  G W+     NRTW+N+  CI    + +   YI +     G++LS++ + ISL IFFYF+ L C+R+ +HKNLF SYVLN A T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +  ++  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++     E+R    I ++I  +++ +QG +++ I CF N EV+ A+               R   ++RSTS
Sbjct:  153 QPY-NKSGLYCNRTWDG-WLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDETGNWFRHPETNRTWSNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNP-VCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPASIHAVARKKYFD-DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGEIYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKAQWGQRRREHCSMRSTS 516          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 174.866 bits (442), Expect = 5.431e-49
Identity = 120/369 (32.52%), Postives = 200/369 (54.20%), Query Frame = 2
Query:   65 QPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-INAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN--------AAATRRFQTVRSTS 1123
            QP  NK  ++C   +D  +LCW+ T  G+ T Q CP+    F      +K C+  G W+     NRTW+N+  CI    + +   YI +     G++LS++ + ISL IFFYF+ L C+R+ +HKNLF SYVLN A T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +  ++  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++     E+R    I ++I  +++ +QG +++ I CF N EV+ A+               R   ++RSTS
Sbjct:  153 QPY-NKSGLYCNRTWDG-WLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDETGNWFRHPETNRTWSNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNP-VCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPASIHAVARKKYFD-DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGEIYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKAQWGQRRREHCSMRSTS 516          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 175.252 bits (443), Expect = 7.080e-49
Identity = 113/340 (33.24%), Postives = 191/340 (56.18%), Query Frame = 2
Query:   77 NKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-INAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            NK  ++C   +D  +LCW+ T  G+ T Q CP+    F      +K C+  G W+     NRTW+N+  CI    + +   YI +     G++LS++ + ISL IFFYF+ L C+R+ +HKNLF SYVLN A T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +  ++  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++     E+R    I ++I  +++ +QG +++ I CF N EV+ A+
Sbjct:  187 NKSGLYCNRTWDG-WLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDETGNWFRHPETNRTWSNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNP-VCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPASIHAVARKKYFD-DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGEIYDYIMHILMHYQGLLVATIFCFFNGEVQGAL 522          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 175.252 bits (443), Expect = 7.080e-49
Identity = 113/340 (33.24%), Postives = 191/340 (56.18%), Query Frame = 2
Query:   77 NKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-INAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            NK  ++C   +D  +LCW+ T  G+ T Q CP+    F      +K C+  G W+     NRTW+N+  CI    + +   YI +     G++LS++ + ISL IFFYF+ L C+R+ +HKNLF SYVLN A T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +  ++  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++     E+R    I ++I  +++ +QG +++ I CF N EV+ A+
Sbjct:  187 NKSGLYCNRTWDG-WLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDETGNWFRHPETNRTWSNYTLCIAHTKDKLKMAYILYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIVNLITVVNNPKVVQRNP-VCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPASIHAVARKKYFD-DNCWMSVETHLLYVVHGPIMAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIIPWRPENRLAGEIYDYIMHILMHYQGLLVATIFCFFNGEVQGAL 522          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: calcrl (calcitonin receptor like receptor [Source:NCBI gene;Acc:549647])

HSP 1 Score: 173.711 bits (439), Expect = 4.358e-49
Identity = 124/372 (33.33%), Postives = 191/372 (51.34%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPN-INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFTKSDG 1150
            + +P   K   FC   +D  +LCW     G  + Q CPD    F      +K+C  NG W+     NRTWTN+  C      KV   +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ IT ++  A+ +   ++  NP  C+I   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R  L   + CW + ++ +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E R    I +++  +++ +QG +++ I CF N EV+      A   R +   +     SF  S+G
Sbjct:   63 MQEPANGKEGHFCNRTWDG-WLCWGDVSAGVISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTALNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAVANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPACIHAVAR-SLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQGLLVATIFCFFNGEVQ------AVLKRHWNQYKIQFGSSFAHSEG 425          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: calcrl (calcitonin receptor like receptor [Source:NCBI gene;Acc:549647])

HSP 1 Score: 152.14 bits (383), Expect = 1.458e-41
Identity = 107/309 (34.63%), Postives = 164/309 (53.07%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPN-INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQ 1015
            D +LCW     G  + Q CPD    F      +K+C  NG W+     NRTWTN+  C      KV   +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ IT ++  A+ +   ++  NP  C+I   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R  L   + CW + ++ +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E R    I +++  +++ +Q
Sbjct:   52 DGWLCWGDVSAGVISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTALNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAVANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPACIHAVAR-SLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQ 358          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: calcrl (calcitonin receptor like receptor [Source:NCBI gene;Acc:549647])

HSP 1 Score: 152.525 bits (384), Expect = 2.016e-41
Identity = 110/319 (34.48%), Postives = 166/319 (52.04%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPN-INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFI 991
            + +P   K   FC   +D  +LCW     G  + Q CPD    F      +K+C  NG W+     NRTWTN+  C      KV   +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ IT ++  A+ +   ++  NP  C+I   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R  L   + CW + ++ +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E R    I +++
Sbjct:   33 MQEPANGKEGHFCNRTWDG-WLCWGDVSAGVISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTALNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAVANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPACIHAVAR-SLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYV 348          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: calcrl (calcitonin receptor like receptor [Source:NCBI gene;Acc:549647])

HSP 1 Score: 152.525 bits (384), Expect = 2.707e-41
Identity = 110/319 (34.48%), Postives = 166/319 (52.04%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPN-INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFI 991
            + +P   K   FC   +D  +LCW     G  + Q CPD    F      +K+C  NG W+     NRTWTN+  C      KV   +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ IT ++  A+ +   ++  NP  C+I   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R  L   + CW + ++ +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E R    I +++
Sbjct:   45 MQEPANGKEGHFCNRTWDG-WLCWGDVSAGVISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTALNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAVANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPACIHAVAR-SLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYV 360          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 132.88 bits (333), Expect = 1.023e-33
Identity = 107/368 (29.08%), Postives = 184/368 (50.00%), Query Frame = 2
Query:   83 VDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-------INAVY-IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHN---------------PS------YCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSK-MQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHP-VNR--EQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLI----QEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
             D  C P +D + +CW     G+    +CP+ I  F+ +  A ++C++NG+W +    NRTW N+  C   + N        + +Y IY  GYS+S+  + +++ I  YF++L C R +IH +LFIS++L A +     A++   + +                  P+       C+++     +F  ++Y+W   EGLYL +++ MAF    KK L+    FGWG P I  + +A  R  +     CW + +  ++ I+ +P + A++ N  + I I+++L TKL      R   ++Q+RK  ++  +L P+ G+  I+ FM+     VS I    Q     +  SFQG  ++ I CFCN EV+  I
Sbjct:   53 ADGLCLPEWDGV-VCWPEGLPGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGNNRTWANYTECAKYLFNETKEREVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFMAFIS-DKKYLWGFTLFGWGVPAIFVLIWARERATVADT-GCWDLSAGYLKWIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIV-FMAFPYTEVSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEI 416          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Calcr (calcitonin receptor [Source:MGI Symbol;Acc:MGI:101950])

HSP 1 Score: 174.096 bits (440), Expect = 4.817e-49
Identity = 106/328 (32.32%), Postives = 187/328 (57.01%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPNINAVY-IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLA-IISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            D ++CW+ T  G+  YQ+CPD  P F      SK C+ NG W+     NRTW+N+  C      K+ N   +Y +   G+SLS+  +  S+ IF+ FK L C+RV +HK++F++Y+LN+I  +  L  ++    ++  +P  C++++ +  +    +YFW   EG+YL T++VMA     ++L +     GWGFP++ TI +A  R  L   + CW + ++ +  I+  P ++AL+ N   ++ I+++L+TK+      E   + K  +A  +L P+LGIQ ++F     ++ +  I +++   +I FQG  ++ I CFCN+EV+V +
Sbjct:   94 DGWMCWDDTPAGATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWY-YLLGWGFPIVPTIIHAITR-ALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTL 419          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Calcr (calcitonin receptor [Source:MGI Symbol;Acc:MGI:101950])

HSP 1 Score: 174.096 bits (440), Expect = 4.817e-49
Identity = 106/328 (32.32%), Postives = 187/328 (57.01%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPNINAVY-IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLA-IISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            D ++CW+ T  G+  YQ+CPD  P F      SK C+ NG W+     NRTW+N+  C      K+ N   +Y +   G+SLS+  +  S+ IF+ FK L C+RV +HK++F++Y+LN+I  +  L  ++    ++  +P  C++++ +  +    +YFW   EG+YL T++VMA     ++L +     GWGFP++ TI +A  R  L   + CW + ++ +  I+  P ++AL+ N   ++ I+++L+TK+      E   + K  +A  +L P+LGIQ ++F     ++ +  I +++   +I FQG  ++ I CFCN+EV+V +
Sbjct:   94 DGWMCWDDTPAGATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWY-YLLGWGFPIVPTIIHAITR-ALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTL 419          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Calcr (calcitonin receptor [Source:MGI Symbol;Acc:MGI:101950])

HSP 1 Score: 174.096 bits (440), Expect = 4.817e-49
Identity = 106/328 (32.32%), Postives = 187/328 (57.01%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPNINAVY-IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLA-IISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            D ++CW+ T  G+  YQ+CPD  P F      SK C+ NG W+     NRTW+N+  C      K+ N   +Y +   G+SLS+  +  S+ IF+ FK L C+RV +HK++F++Y+LN+I  +  L  ++    ++  +P  C++++ +  +    +YFW   EG+YL T++VMA     ++L +     GWGFP++ TI +A  R  L   + CW + ++ +  I+  P ++AL+ N   ++ I+++L+TK+      E   + K  +A  +L P+LGIQ ++F     ++ +  I +++   +I FQG  ++ I CFCN+EV+V +
Sbjct:   94 DGWMCWDDTPAGATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWY-YLLGWGFPIVPTIIHAITR-ALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTL 419          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Calcrl (calcitonin receptor-like [Source:MGI Symbol;Acc:MGI:1926944])

HSP 1 Score: 160.999 bits (406), Expect = 1.884e-44
Identity = 114/349 (32.66%), Postives = 185/349 (53.01%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-----INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAI-TWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN 1081
            +  PI     ++C   +D  +LCWN    G+++ Q CPD    F      +K C+ +G W+     NRTWTN+  C N         +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S++ N+I T +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPL+    +A  R  L   + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E +    + +++  +++ FQG +++ I CF N EV+  +  N
Sbjct:   52 MQDPIQQAEGLYCNRTWDG-WLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQDGHWFRHPDSNRTWTNYTLCNNSTHEKVKTALNLFYLTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNLFFSFICNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGVYLHTLIVVAVFAEKQHLMWY-YFLGWGFPLLPACIHAIAR-SLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQVESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVAEEVYDYVMHILMHFQGLLVATIFCFFNGEVQAILRRN 397          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Calcrl (calcitonin receptor-like [Source:MGI Symbol;Acc:MGI:1926944])

HSP 1 Score: 160.999 bits (406), Expect = 1.884e-44
Identity = 114/349 (32.66%), Postives = 185/349 (53.01%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-----INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAI-TWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN 1081
            +  PI     ++C   +D  +LCWN    G+++ Q CPD    F      +K C+ +G W+     NRTWTN+  C N         +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S++ N+I T +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPL+    +A  R  L   + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E +    + +++  +++ FQG +++ I CF N EV+  +  N
Sbjct:   52 MQDPIQQAEGLYCNRTWDG-WLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQDGHWFRHPDSNRTWTNYTLCNNSTHEKVKTALNLFYLTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNLFFSFICNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGVYLHTLIVVAVFAEKQHLMWY-YFLGWGFPLLPACIHAIAR-SLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQVESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVAEEVYDYVMHILMHFQGLLVATIFCFFNGEVQAILRRN 397          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|A6QP74|CALRL_BOVIN (Calcitonin gene-related peptide type 1 receptor OS=Bos taurus OX=9913 GN=CALCRL PE=2 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 2.246e-51
Identity = 130/386 (33.68%), Postives = 203/386 (52.59%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNI----NAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQ---------TVRSTSRRSFTKSDGSFDGH 1165
            +  P+     I+C   +D  +LCWN    G+++ Q+CPD    F      +K C+ +G W+   A NRTWTN+  C +N    +    N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ IT +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPLI    +A  R +L   + CW +  +++  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +L     E +    I ++I  +++ +QG ++S I CF N EV+ AIL       + Q         T+RS S    T SDG+   H
Sbjct:   54 MQDPVQQTEGIYCNRTWDG-WLCWNDVAAGTESMQHCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHVLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVITIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLVVVAVFAEKQHLMWY-YFLGWGFPLIPACIHAVAR-RLYYNDNCWISSDTQLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEIYDYIINILMHYQGLLVSTIFCFFNGEVQ-AILRRNWNQYKIQFGNNFSHSDTLRSASYTVSTISDGTGYSH 435          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|Q8WN93|CALRL_PIG (Calcitonin gene-related peptide type 1 receptor OS=Sus scrofa OX=9823 GN=CALCRL PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.525e-51
Identity = 126/385 (32.73%), Postives = 198/385 (51.43%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNI----NAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAI-TWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN--------AAATRRFQTVRSTSRRSFTKSDGSFDGH 1165
            +  PI     I+C   +D  +LCWN    G+++ Q+CPD    F      +K C+ +G W+     NRTWTN+  C IN    +    N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+I T +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPLI    +A  R +L   + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +L     E +    + ++I  +++ +QG ++S I CF N EV+  +  N          +      +RS S    T SDG+   H
Sbjct:   54 MQDPIQQTEGIYCNRTWDG-WLCWNDVAAGTESMQHCPDYFQDFDPSEKVTKICDQDGNWFRHPESNRTWTNYTQCNINTHEKVQTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSIVTIIHLTAVANNQALVATNPVSCKVFQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YFLGWGFPLIPACIHAVAR-RLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILVHYQGLLVSTIYCFFNGEVQAILRRNWNQYKIQFGNSFSHSDALRSASYTVSTISDGAGYSH 435          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|Q16602|CALRL_HUMAN (Calcitonin gene-related peptide type 1 receptor OS=Homo sapiens OX=9606 GN=CALCRL PE=1 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 4.058e-50
Identity = 125/385 (32.47%), Postives = 197/385 (51.17%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNI----NAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN--------AAATRRFQTVRSTSRRSFTKSDGSFDGH 1165
            +  PI     ++C   +D  +LCWN    G+++ Q CPD    F      +K C+ +G W+   A NRTWTN+  C +N    +    N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ +T +   A+ +   ++  NP  C++   I  +    +YFW   EG+YL T++V+A     + L++   F GWGFPLI    +A  R  L   + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +L     E +    + ++I  +++ FQG ++S I CF N EV+  +  N          +    + +RS S    T SDG    H
Sbjct:   53 MQDPIQQAEGVYCNRTWDG-WLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YFLGWGFPLIPACIHAIAR-SLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSH 434          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|Q0P4Y4|CALRL_XENTR (Calcitonin gene-related peptide type 1 receptor OS=Xenopus tropicalis OX=8364 GN=calcrl PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.309e-48
Identity = 124/372 (33.33%), Postives = 191/372 (51.34%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPN-INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFTKSDG 1150
            + +P   K   FC   +D  +LCW     G  + Q CPD    F      +K+C  NG W+     NRTWTN+  C      KV   +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ IT ++  A+ +   ++  NP  C+I   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R  L   + CW + ++ +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E R    I +++  +++ +QG +++ I CF N EV+      A   R +   +     SF  S+G
Sbjct:   63 MQEPANGKEGHFCNRTWDG-WLCWGDVSAGVISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTALNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAVANNQALVATNPVSCKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPACIHAVAR-SLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQGLLVATIFCFFNGEVQ------AVLKRHWNQYKIQFGSSFAHSEG 425          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|Q7ZXS8|CALRL_XENLA (Calcitonin gene-related peptide type 1 receptor OS=Xenopus laevis OX=8355 GN=calcrl PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.112e-47
Identity = 124/372 (33.33%), Postives = 190/372 (51.08%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVPN-INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFTKSDG 1150
            + +P   K   FC   +D  +LCW     G  + Q CPD    F      +K+C  NG W+     NRTWTN+  C      KV   +N  Y+   G+ LS+  + ISL IFFYFK L C+R+ +HKNLF S+V N+ IT ++  A+ +   ++  NP  C+I   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R  L   + CW + ++ +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGI+ +LF    E R    I +++  +++ +QG +++ I CF N EV+       A  +R          SF  S+G
Sbjct:   68 MQEPAHGKEGQFCNRTWDG-WLCWGDVAAGIISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTALNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAVANNQALVATNPVICKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPACIHAVAR-SLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQGLLVATIFCFFNGEVQ-------AVLKRHWNQYRIQFGSFAHSEG 429          
BLAST of Calcitonin receptor vs. TrEMBL
Match: R7T7Q8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221530 PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 5.893e-66
Identity = 137/392 (34.95%), Postives = 213/392 (54.34%), Query Frame = 2
Query:   20 MDNFEREKLKN------ACLMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDI-PGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVP---NINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIIS-KPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLR-YQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNV-SLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFTKSDGSF 1156
            M   E E L++        L QP PN   ++C P +D  + CWN+T  G+     CP   PGF     A + C +NGTW+     NRTW+N+  C+N      +   + ++ AGY++S+L +  SL IF +FK+LQC+RV IHK+LF SY+ N   W+ +    +    V  +NP +CQ ++VI  +F   ++FW F EGLYL T++V+AF  G KKLL  C   GW  P+ +T  Y + R    ++ + CW  +S +Q I+  P ++ ++ N + +  I+++L+TKL    + +   +RK  RA  IL P+LG+Q ILF +  E+      I   ++AV+ S QG  ++ I CF N EV   I       RR+   R  ++++     GSF
Sbjct:    1 MGQHEEELLRHEHLCNLTVLNQPPPNDGRLYCDPYWDT-WGCWNYTLAGTNAVIPCPSHQPGFDPSLTAYRTCSVNGTWWTHPVTNRTWSNYTTCVNHADLAKDKRVINVFIAGYTVSILFLIASLLIFTFFKQLQCDRVTIHKHLFTSYIFNGAVWILYYTTAAMDAQVQANNPVWCQAVHVITQYFVTCNFFWMFCEGLYLHTIIVVAFSTG-KKLLICCYVLGWVLPIFITALYTAARALSPDEAKACWLHESTLQWIVAGPIVLTIVINFIFLCNIVRVLVTKLRSVNSPDTNGYRKAVRATLILIPLLGLQFILFPLRPEENTTWDEIYMLVSAVVTSCQGLFVAVIFCFLNGEVHTVI------KRRWNQHRMMTQKAL-NPRGSF 383          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A0K0PVL8 (DH31-like receptor 1 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.477e-64
Identity = 131/355 (36.90%), Postives = 208/355 (58.59%), Query Frame = 2
Query:   86 DIFCPPIFDDLYLCWNFTKGGSKTYQNCPDI-PGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINK---VPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIIS-KPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLR--YQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSL-IQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSR 1126
            +++C   +D+ + CWN+TK GS+ + +CP    GF     A K C  +GTW++    NR+W N+  C+N      +   VYI+ AGY++S++ + +SL IFFYF++LQC+RV +HKNLFISY+LN I W+ +  + S    V+  NP++CQ ++V+  +F   ++FW F EG YL T++V AF  G K L+  C   GWG P + T+ Y + R  Y  ++ E CW  +S +Q I++ P ++ ++ NL  +  I+++L+TKL    + +  Q RK  RA  IL P+LG+Q IL      D +  L +   ++A++ +FQG  +S I CF N EV +++L       R      T R
Sbjct:   31 ELYCNATWDE-WGCWNYTKAGSRAFISCPSYKEGFDASLWAYKDCNPDGTWWLHPITNRSWANYTACVNMNALETDKRVVYIFVAGYAISIVFLLLSLIIFFYFRQLQCDRVTLHKNLFISYILNGIAWILYYTLASLDGEVLSENPAWCQFLHVVTQYFVTCNFFWMFCEGFYLHTIIVSAFTTG-KTLIIFCFIVGWGAPFVSTVIYGAARGVYPSKRNE-CWMDESFLQWIVLGPILLTIVLNLFFLCNIVRVLITKLRAVNSPDTNQTRKAVRATLILIPLLGLQYILLPFRPNDGSPLLDVYLHVSALVTAFQGLFVSTIFCFFNGEV-ISVLKRKWGQHRLMQGNGTGR 381          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A513ZS13 (Calcitonin receptor 3 OS=Crassostrea gigas OX=29159 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.604e-63
Identity = 124/345 (35.94%), Postives = 207/345 (60.00%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCIN-------KVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIIS-KPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEK-CWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSL--IQEFIAAVIISFQGTVMSFILCFCNNEV 1060
            + +P PN   ++C P  D    CWN+T+ G++ +  CPDIPGF+ +  A   C  NG+WY+     + ++N+  C N          N   VY+   G+ +S++ +  SL IFF F++L+C+R+ +HKNLF+SY++ A  ++ +L+++S    V++ NP +CQ+++VI  +  VS++ W F EGL L T+++  F  G+  L+ +C+  GW  PL+LT  YA LR  L    K CW  +S +Q I+  P + +++ N++ VI I+++L+TKL      E  Q RK  RA  IL P+LG+Q ++F     D++ +L  +  +  A+++S QG+ +S I CFCN+EV
Sbjct:   29 MSKPAPNDGKLYCSPRHDHFMGCWNYTEAGTRAFLPCPDIPGFAPDHSAYFDCLRNGSWYVHPTTGKEYSNYLGCRNFQNVLTDIGKNFAHVYVSVVGFCVSLIFLICSLVIFFKFRQLRCDRITVHKNLFVSYIITAFCFVIYLSVVSFGDGVLMENPVWCQVLHVITQYAVVSNFSWMFCEGLCLHTLMMHTFISGN-SLIIVCLIIGWCVPLVLTGIYAGLRATLTDNTKFCWLSESSLQWIMFAPVVFSMLINIIFVINIMRLLVTKLRQ--MPEAAQTRKAVRATGILIPLLGLQFLVFIKRPNDKDSTLYDVYTYAVAIVVSLQGSFVSVIYCFCNHEV 370          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A3S0ZQZ1 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_011508 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.075e-60
Identity = 138/398 (34.67%), Postives = 228/398 (57.29%), Query Frame = 2
Query:    8 VLLKMDNFEREKLKNACLMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCIN--KVPNINA-------VYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLA-IISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQP-EKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILF-FMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFTKSDGSFDGH 1165
            VLL       ++LK+    QP P    ++C   +D L +C+N T+ GS    +CPD P ++ E    + CE NGTW +D A  RT ++F  CI     PN++A       +Y++ AG S+S++ + ISL IF+ F++L+C+RV +HKNLFIS+   A+TW+ F + ++    V++ NP +C+ ++V+  +F  +++ W   E LYL  ++      G KKL+   V  GWG PL+LT  YA+ R  +    +KCW  ++ +Q IL  P +++++ N+ I+I ++++L+TKL    + +Q   RK A+A  IL P+ G+Q ++F    +ED  +  +     AV++S QGT++S I CFCN EV+  I+       R  T RS+ + +   S    DG+
Sbjct:   22 VLLAEPRLRCQELKS----QPAPTD-GVYCKAEWDGL-VCFNHTRAGSNASVHCPDFPVYNPEENVRRYCEPNGTWQVDGA-GRTISDFSDCIKNRSSPNLSAPDEAFSYIYLFMAGASVSLVLLIISLVIFYGFRQLRCDRVTVHKNLFISFACTALTWILFYSLVVLDGHVVLENPLWCRYLHVLAQYFTTTNFSWMCCEALYLHIIMAHTLHTG-KKLIKCLVVAGWGVPLLLTGIYAAARATVSGSYKKCWIEETAVQWILAGPILVSVVVNICILINLVRLLMTKLRQVPDAQQS--RKAAKATLILVPLFGLQFLVFPVRPAEDSPMHDVYLHFMAVLMSMQGTLVSIIFCFCNGEVRSLIMRKWHQ-HRLMTSRSSRKNTGFTSSTYVDGY 408          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A210PI29 (Calcitonin receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18973 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.416e-59
Identity = 126/339 (37.17%), Postives = 193/339 (56.93%), Query Frame = 2
Query:   59 LMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGF---SKEAMASKKCEINGTWYIDQALNRTWTNFDPCI-NKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLR-YQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEV 1060
            L Q  P+   ++C   FD  + CWN+T  G++ Y +CP             A K C ++GTW       RTWTN+ PC  NK      + IY++GY+LS++    SL IF  F++L C RV +HK+LFI+YVL+   W+   A++  P ++  N  +CQ ++V+  +  + +YFW F EG YL  ++V AF    K+LL +C   GW  PLI T  YA++R  + E    CW++ +    IL  P +++L+ N + ++ IL+ILL+KL    + E  Q R+TARA  IL P+LG+Q   F +  +    S I + I+AV+ S+QG +++   CFCN EV
Sbjct:   57 LSQLYPSDGGLYCNATFDG-WDCWNYTSAGTRIYHDCPTFLRHKYGQPTGQAFKDCRVDGTWLTHPDTGRTWTNYTPCASNKETLQRVISIYYSGYALSIILSIASLLIFSCFRQLHCSRVTLHKHLFITYVLSGAAWILMFALMDMPGMVKDNQPWCQALHVLTQYLTLCNYFWMFCEGFYLHALVVFAFTS-DKRLLVICYVIGWVGPLIPTAVYAAVRGSKPELRHGCWSITADENWILTGPVVVSLVVNFLFLLNILRILLSKLRAVNSSEAHQSRRTARATLILIPLLGLQ--YFVIPFQPDTPSPIYDIISAVLTSYQGVLVALFFCFCNGEV 391          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 186.422 bits (472), Expect = 2.541e-54
Identity = 116/340 (34.12%), Postives = 192/340 (56.47%), Query Frame = 2
Query:   77 NKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN-INAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            NK  ++C   +D  +LCW+ T  G+ T QNCP+  P F     A+K C+  G W+     NRTW+N+  CI      +   YI +     G++LS+  + ISL IFFYF+ L C+R+ +HKNLF SYVLN A T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +  ++  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++F    E+R    I ++I  +++ +QG +++ I CF N EV+  +
Sbjct:   42 NKSGLYCNRTWDG-WLCWDDTPAGTYTTQNCPNYFPDFDPTEKATKYCDETGNWFRHPETNRTWSNYTHCIAYTKEKLKMAYILYYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTIINLIFVVNNPKVVERNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPASIHAVARKKYFD-DNCWMSVETHLLYVVHGPIVAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIFPWRPENRLAGEIYDYIMHILLHYQGLLVATIFCFFNGEVQATL 378          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: ENSAMXT00000051776.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:4488382:4515609:1 gene:ENSAMXG00000038684.1 transcript:ENSAMXT00000051776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 8.838e-45
Identity = 111/325 (34.15%), Postives = 179/325 (55.08%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCI-----NKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVK 1063
            D +LCW++ + G    Q+CPD    F     A+K C  +G W+I    NRTWTN+  C      ++   IN  Y+   G+ LS++ + ISL IFFYFK L C+R+ +HKNLF S+VLN+ IT + F A+++   ++    ++C++   +  +     YFW   EG+YL T++V+A     + L++     GWGFPLI  + +A  R      + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ +L     E      I E++  +++++QG +++ I CF N EV+
Sbjct:   47 DGWLCWDYIQTGLTATQHCPDYFHNFDTSEEATKICTEDGYWFIHPESNRTWTNYTSCTKSTNEHRQVAINLYYLGLIGHGLSLIFLCISLGIFFYFKSLSCQRITLHKNLFSSFVLNSTITIIWFTAVVNNQDLI--QQTHCKVATFVHLYAFGCVYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPALIHAVAR-SYYFNDNCWISHNTSLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLLGIQFVLLPYKPEGSLSFEIYEYMMNILMNYQGLLVATIFCFFNGEVQ 367          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: ENSAMXT00000031305.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:23043231:23049818:1 gene:ENSAMXG00000034825.1 transcript:ENSAMXT00000031305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 2.354e-37
Identity = 98/297 (33.00%), Postives = 161/297 (54.21%), Query Frame = 2
Query:  200 MASKKCEINGTWYIDQALNRTWTNFDPC-----INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA---ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVK 1063
            M +K C  NG W++    NRTWTN+  C       ++  +N +Y+   G+ LS++ + ISL IFF+FK L C+R+ +HKNLF S+VLN+   I W+T  A+ +   ++  NP+ C++   +  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R      + CW +  + +  I+  P   AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ               I +++  +++ +QG +++ I CF N EV+
Sbjct:    1 MVTKICMDNGQWFLHPESNRTWTNYTRCNERTNEGRMTAMNLLYLALIGHGLSLISLFISLAIFFHFKSLSCQRITLHKNLFFSFVLNSIITIIWLT--AVANNQELVQRNPTSCKVSQFVHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPATIHAIAR-SYYYNDNCWISSNTSLLYIIHGPICAALVVNLFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLLGIQ--------------YIYDYVMNILMHYQGLLVATIFCFFNGEVQ 279          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 134.035 bits (336), Expect = 2.335e-34
Identity = 108/367 (29.43%), Postives = 179/367 (48.77%), Query Frame = 2
Query:   92 FCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCI-----NKVPNINAVY-----IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAI---------------------TWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKS-KMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHP-VNR--EQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVS----LIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            FC P +D + LCW     G      CP+ I  F+ +  A ++C++NG+W +  + N+TW N+  C      N       V+     IY  GYS+S+  + +++ I  YF++L C R +IH +LF+S++L AI                     T     +I   P         C+I   +  +F  ++Y+W   EGLYL +++ M F    +K L+     GWG P +    +AS+R  L   E CW + +  ++ I+ IP + A++ N ++ + I+++L TKL      R   ++Q+RK  ++  +L P+ G+  I+ FM+     VS     IQ     +  SFQG  ++ I CFCN EV+  I
Sbjct:   51 FCMPEWDGI-LCWPEGAPGRTVSTACPEYIYDFNHKGHAYRRCDLNGSWELATSNNKTWANYSECAKFLHYNHQNQEREVFDRLYLIYTIGYSISLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDVVLYSGAVLEETERVTVEDLKSITEAPPANKTQFVGCKIAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFS-DRKYLWGFTLIGWGVPAMFVTVWASVRATLADTE-CWDLSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIV-FMAMPYTEVSGIPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEI 413          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 133.65 bits (335), Expect = 3.632e-34
Identity = 108/367 (29.43%), Postives = 179/367 (48.77%), Query Frame = 2
Query:   92 FCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCI-----NKVPNINAVY-----IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAI---------------------TWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKS-KMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHP-VNR--EQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVS----LIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            FC P +D + LCW     G      CP+ I  F+ +  A ++C++NG+W +  + N+TW N+  C      N       V+     IY  GYS+S+  + +++ I  YF++L C R +IH +LF+S++L AI                     T     +I   P         C+I   +  +F  ++Y+W   EGLYL +++ M F    +K L+     GWG P +    +AS+R  L   E CW + +  ++ I+ IP + A++ N ++ + I+++L TKL      R   ++Q+RK  ++  +L P+ G+  I+ FM+     VS     IQ     +  SFQG  ++ I CFCN EV+  I
Sbjct:   65 FCMPEWDGI-LCWPEGAPGRTVSTACPEYIYDFNHKGHAYRRCDLNGSWELATSNNKTWANYSECAKFLHYNHQNQEREVFDRLYLIYTIGYSISLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDVVLYSGAVLEETERVTVEDLKSITEAPPANKTQFVGCKIAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFS-DRKYLWGFTLIGWGVPAMFVTVWASVRATLADTE-CWDLSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIV-FMAMPYTEVSGIPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEI 427          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 8.843e-48
Identity = 112/330 (33.94%), Postives = 182/330 (55.15%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC----INKVP-NINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA-ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIIS--FQGTVMSFILCFCNNEVKVAI 1072
            D +LCW  T  G    Q+CPD  P F  +   +K C  +G W+     NRTW+N+  C     +K+   +N  Y+   G+ +S+L + +SL IFFYFK L C+R+ +HKNLF+SY+LN+ IT +   A+ +   ++   P +C+++     +    +YFW   EG+YL T++V+A     K+ L+     GWGFP++  + +A  R  +   + CW +  + +  I+  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ +L     E R V  I ++I  +  +   QG +++ I CFCN EV+ A+
Sbjct:   46 DGWLCWGDTMAGDVAVQHCPDYFPDFDLQEKVTKICNTDGQWFRHPDSNRTWSNYTLCNAFTADKLKMAVNLFYLAVTGHGVSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSIITIIQLTAVANNQELVASKPVWCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAV-FAEKQHLFWYYLLGWGFPIVPALMHAVAR-TIYYDDNCWISSATHLLYIIHGPVVAALLVNLFFLLNIVRVLVTKLKVTHRAETSMYMKAVRATLILVPLLGIQFVLVPWKPE-RFVGEIYDYIMQIFPTHLIQGFLVATIFCFCNGEVQAAL 372          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 141.739 bits (356), Expect = 1.615e-38
Identity = 106/360 (29.44%), Postives = 175/360 (48.61%), Query Frame = 2
Query:   77 NKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKV-PNINA---------VYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAII-------------SKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSK-MQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQ---KQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSL---IQEFIAAVIISFQGTVMSFILCFCNNEVK 1063
            +  D  C   +D L +CW +   GS   + CP  I  F+    A +KCE NGTW +  A NR W N+  C   + P++ A           +Y  GYS+S+  +AI+L I   F++L C R +IH +LF+S++L A +      ++             S P    H  + C+++  +  +   +SYFW   EGLYL +++ + F    +  L+     GWGFP++    +A+ R  L    +CW + +  ++ I   P + A+  N V+ + I+++L TKL       Q   +Q+RK  ++  +L P+ G+  +LF        + L   IQ +      SFQG  ++ I CFCN EV+
Sbjct:   42 SSADTHCTAEWDGL-ICWPWGLPGSMVREKCPSYIYDFNAHGHAYRKCESNGTWKMSTA-NRLWANYSECTEFLNPHVQAKEKESIHRLSILYTIGYSVSLASLAIALCILTVFRRLHCTRNYIHMHLFVSFMLRAASIFVKDGVLYSDNELRLATPGPSPPAEAPHIFAGCRVVVTLFLYCLATSYFWVLVEGLYLYSLIFLTFSASGR--LWTFALIGWGFPVVFVFVWAAARATLAN-SQCWDLSAGWLKWIYQAPILAAVAVNFVLFVNIVRVLATKLRETNAARQESRQQYRKLLKSTLVLMPLFGVHYVLFAAMPYTDVIGLAWQIQMYYEMTFNSFQGFFVAIIYCFCNGEVR 396          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 1.659e-31
Identity = 101/340 (29.71%), Postives = 178/340 (52.35%), Query Frame = 2
Query:   95 CPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMAS--KKCEINGTWYIDQALNRTWTNFDPCIN-KVPNIN----AVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQ-DGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSK---MQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQW-RKTARAIFILFPVLGIQNILFFMS-SEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            C    D++  CW  ++ G      CP+   G   ++  S  ++C  NGTW    A    ++   P I+ K PN      A+ + + G+ +S+  +  +   F++ + ++C R  IH +L  +++L    W+  L II   T   + P +C+++  +  +F V+++FW F EG YL T +VM +  D  +K +++C+  GW  P  + I +A ++   E  EKCW  K++   +  I   P I+ L+ N + +  I++IL+TKL      E  Q+ RK  +A  +L P+LGI  +LFF++  ED    +I  ++ + ++SFQG  +S   CF N EV+ A+
Sbjct:   42 CNATRDEIGTCWPESEAGRTVATPCPERFNGVRYDSSKSVIRECLANGTW----AQRSNYSLCKPIIDAKKPNSQHYKIALIVNYLGHCISLAALITAFGFFWWLRSIRCLRNAIHWHLVTTFILRNAAWL-LLQIIDLSTQERNEP-WCRVVITVFNYFQVTNFFWMFVEGCYLHTAIVMTYSTDKLRKSIFVCI--GWCIPAPIIIVWAMVKLFYED-EKCWFGKTEGKYIDYIYQGPIILVLLVNFIFLFNIVRILMTKLRASTTSETIQYSRKAVKATLVLLPLLGITYMLFFVNPGEDPVSQVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSAL 372          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009958.1 (pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 gene:ENSPMAG00000008983.1 transcript:ENSPMAT00000009958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 1.642e-29
Identity = 104/349 (29.80%), Postives = 173/349 (49.57%), Query Frame = 2
Query:   62 MQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMAS--KKCEINGTWYIDQALNRTWTNFDPCINKVPNIN----AVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQ-DGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSK---MQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMS-SEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
            + P       FC    D++  CW  ++      + CPD   G   +   S  ++C  + TW    A    ++  +  I    N      A+ + + G+ +S+L +  +  IF+  + ++C R  IH NL  +++L   TW  FL  +   +    N  +C II  I  +F V+++FW F EG YL T +VM +  D  +K +++C+  GW  P  + I +A ++   E  EKCW  K+    +  I   P I+ L+ N + +  I+ IL+TKL      E  Q+RK  +A  +L P+LGI  +LFF++  ED    +I  ++ + ++SFQG  +S   CF N EV+ AI
Sbjct:    2 LSPTVLHAGPFCNATRDEIGTCWPSSEASRVVIRPCPDRFNGVQYDTSKSVYRECMADATW----ARRSNYSLCEAIILSKRNSQHYKVALVVNYLGHCVSLLALMTAFTIFWCLRSIRCLRNAIHWNLMTTFILRNATW--FLLQLIDLSTQERNEPWCCIIITIFNYFQVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWIFICI--GWVIPAPIIIIWAMVKLHFED-EKCWFGKTPGKYIDYIYQGPIILVLLINFIFLFNIVTILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQVIFLYVNSFLMSFQGFFVSVFYCFLNGEVRSAI 341          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004243.1 (pep scaffold:Pmarinus_7.0:GL484465:15708:23345:-1 gene:ENSPMAG00000003877.1 transcript:ENSPMAT00000004243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 5.186e-21
Identity = 67/261 (25.67%), Postives = 111/261 (42.53%), Query Frame = 2
Query:   74 PNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSK--EAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAV-----------YIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSY-------------------CQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKM 757
            P    ++C   FD  Y CW  +   +K    CP  +P   K       + C  +GTW     +   W +   C++   NI+              +Y  GYS+S+  + +++ I   F++L C R +IH NLF S++L AI      +++ K   + HN +                    C+  +V + +   ++YFW   EG YL T+L M      KKL+   V  GWG P++  I +   +   E  + CW + + M
Sbjct:   26 PFLSGVYCNRTFDH-YACWPDSLPDTKVAIPCPSYLPWIDKVEGGYVYRYCTRDGTWLTQDNVTAAWRDHSECLDDENNISTEGKEMYLLHALRLVYTTGYSVSLASLVVAMGILIMFRRLHCTRNYIHMNLFASFILRAI------SVLLKDAALTHNYTKRPQNASDWLGYFGYEGYTGCRATHVFMQYCIGANYFWLLVEGSYLHTLLTMCVFT-KKKLIAFYVLLGWGTPIMFIIPWMVSKLIYEN-QGCWGINTWM 277          
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Match: EDO34537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP31])

HSP 1 Score: 60.8474 bits (146), Expect = 1.950e-10
Identity = 64/252 (25.40%), Postives = 119/252 (47.22%), Query Frame = 2
Query:  317 IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEK-CW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKV 1066
            I + G  +S + + I+L IF   + L  ER  IH NL ++  L  I    FL+ I+       N   CQ++   + +F   ++ W  +EG++L   +V  F+  + +LL+  + FGWGFP ++    A+++      E  CW ++        I P    +  N +I+IV++K ++       N +    R   +   +L P+LG+  I   ++     V    +++ A+  SFQG ++  +    N EV++
Sbjct:   48 ITYIGCGISSVALLITLVIFLSIESLSTERHRIHLNLVLALFLAQIL---FLSGINATG----NKIGCQVVAAFLHYFYTVAFTWMLNEGVHLYLKVVKVFRIENVRLLHYYI-FGWGFPAVIVGISAAIKPNSYGTESICWLSLSDDFVWAFIGPVTFIIAINCLILIVVVKTIVNSASTVKNSDHAHIRAGVKGALVLMPLLGVSWISGLLAVNKDTVFF--QYVFAITNSFQGFLIFLLHVVFNTEVRI 289          
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Match: EDO44368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW06])

HSP 1 Score: 59.3066 bits (142), Expect = 2.658e-10
Identity = 57/205 (27.80%), Postives = 98/205 (47.80%), Query Frame = 2
Query:  176 IPGFSKEAMASKKCEINGTWYIDQALNRTW--TNFDPCINKVPNINAVY----------IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGS----KKLLYLCVFFGWGFPLILTIFYASLRYQLEQPE-KCW 739
            +PGF     ++K C +NGT      + + +  T F   +N   +++A+           I + G  LSV+ + I+L  F  F+ L+  R F+HKNL IS +L     + FL  ++K  + +     CQII  ++ +  ++S+ W   EG+ L  +LV  F   +    K+ ++L   FGWG P ++    A +  Q    +  CW
Sbjct:   12 LPGF----WSNKGCYVNGT-NSTHTICKCYHLTGFAILMNVKGDMDAILKGDHRLALSLITYIGIVLSVVTLCIALLTFITFRFLKSSRTFLHKNLSISLILAQ---LLFLFGVNKTEIKL----VCQIIAALLHYLWLASFAWMALEGVMLYLMLVKVFGTKTITNKKRAVFLT--FGWGLPAVVVGVSAGIFPQGYSTQYYCW 202          
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Match: EDO30890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZH0])

HSP 1 Score: 56.6102 bits (135), Expect = 6.521e-10
Identity = 35/118 (29.66%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  317 IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWG 670
            I + G  +S+  +A++L  F   + L  ER  IHKNL ++  L  I    FLA I  P     NP  C+++ + + +   +++ W   EG++L T ++  F     K+ Y     GWG
Sbjct:   42 ITYVGCGISLFGLALTLATFLSLETLASERTSIHKNLVVAIGLAQII---FLAGIDAP-----NPIACKVVALSLHYLYTAAFAWMCCEGVHLYTKVIEVFSSEGSKMKYY-YLLGWG 150          
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Match: EDO32453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV04])

HSP 1 Score: 58.5362 bits (140), Expect = 2.672e-9
Identity = 39/143 (27.27%), Postives = 71/143 (49.65%), Query Frame = 2
Query:  317 IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGS-KKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEK-CW 739
            I + G S+S++C+AI++    + +     R  IH  L IS  ++   ++  +A I            C I  + + +F  +++ W F EG +L   +V+A++  + K+L Y C  FGWGFP I+    +++  +    E  CW
Sbjct:  573 ITYVGCSISLVCLAITIISMPFLRLTSTLRYKIHMQLCISLAVSQAAFLLGIAAIRYKVA-------CMITAMSLHYFYTAAFSWMFLEGFHLYMKIVIAYEKKAIKQLYYFC--FGWGFPFIIVGISSAVNSEGYGTEAGCW 706          
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Match: EDO50018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF24])

HSP 1 Score: 56.9954 bits (136), Expect = 3.060e-9
Identity = 58/262 (22.14%), Postives = 119/262 (45.42%), Query Frame = 2
Query:  317 IYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQ-LEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQ------WRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN 1081
            + + G +LS+L + +++        L+ ER  IH NL I+     ++ + FLA       +V +   C++   ++ +  +S + W   EG++L  ++++AF   ++ ++    F GWG P+ + +  + + ++    P  CW   +           I +I    +V+  +  L TKL +      +        R  AR   +L P+LG+  I    ++ +   +L+ ++I A   S QG ++    C  N+EV   ++ N
Sbjct:   48 VTYIGCTLSILGVFLTVVTLISLPVLRSERTRIHCNLCIAV---GVSQILFLA--GGTEELVESKVGCKLYAALMFYAFMSVFSWMLVEGIHLYQMIIIAFI--TRAMMKFYYFIGWGLPMCIVVIASCISHKGYGTPNFCWLSLTDHTIWAFTGPAIVVILVNAVVLGAVLRLRTKLENNAEVSHRACLSILFLRTGARVSIMLLPLLGLSWIFGLFTAMEG--TLVIQYIFAATNSLQGLMIFAFHCVGNSEVGCLLIGN 300          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: calcr (calcitonin receptor [Source:NCBI gene;Acc:101174680])

HSP 1 Score: 182.956 bits (463), Expect = 4.615e-53
Identity = 117/344 (34.01%), Postives = 191/344 (55.52%), Query Frame = 2
Query:   65 QPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNINAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
             P  NK   FC   +D  +LCW  T  G+   QNCP+    F     A+K C  +G W+     NRTW+N+  C  N    + + YI F     G++LS+  + ISL IFFYF+ L C+R+ +HKNLF SYVLN A+T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +   +  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++F    E+R    + E++  +++ +QG +++ I CF N EV+ A+
Sbjct:   35 DPPYNKSGPFCSRNWDG-WLCWEDTPAGTFAAQNCPNYFDDFDPTEKATKYCGEDGQWFRHPDTNRTWSNYTLCNENTKAKLKSAYILFYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFFSYVLNSALTIIYLVTVVNNPEVVARNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPVSIHAVARKKYFD-DNCWMSVETHLLYAVHGPIVAALLVNLFFLLNIIRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIFPWRPENRLAGEVYEYVMHILMHYQGLLVATIFCFFNGEVQGAL 375          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: calcrla (calcitonin receptor like receptor [Source:NCBI gene;Acc:101158808])

HSP 1 Score: 175.252 bits (443), Expect = 5.764e-50
Identity = 124/376 (32.98%), Postives = 197/376 (52.39%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-----INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA---ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN---------AAATRRFQTVRSTS--RRSFTKSDG--SFDGHIK 1171
            D +LCW+ T  G  + Q+CPD    F    M +K C  NG W++    NRTWTN+  C       ++  +N  Y+   G+ LS++ + ISL IFF+FK L C+R+ +HKNLF S+VLN+   I W+T  A+ +   ++  NP+ C++   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R      + CW + K+ +  I+  P   AL+ N+  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ +L       R  S I ++I  +++ +QG +++ I CF N EV+  +  +         ++       +RS S    S T+  G  S DGH +
Sbjct:   68 DGWLCWDDTAAGVTSEQHCPDYFQDFDPSEMVTKICTENGHWFLHPESNRTWTNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFFHFKSLSCQRITLHKNLFFSFVLNSVITIIWLT--AVANNQELVQRNPTSCKVSMFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPASIHAIAR-SYYYNDNCWISSKTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLLGIQYVLLPYKPGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQYNIQFGSSIGNHSDALRSASYTASSITEVQGCYSIDGHTE 439          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: calcrla (calcitonin receptor like receptor [Source:NCBI gene;Acc:101158808])

HSP 1 Score: 174.866 bits (442), Expect = 1.150e-49
Identity = 124/376 (32.98%), Postives = 197/376 (52.39%), Query Frame = 2
Query:  113 DLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-----INKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA---ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN---------AAATRRFQTVRSTS--RRSFTKSDG--SFDGHIK 1171
            D +LCW+ T  G  + Q+CPD    F    M +K C  NG W++    NRTWTN+  C       ++  +N  Y+   G+ LS++ + ISL IFF+FK L C+R+ +HKNLF S+VLN+   I W+T  A+ +   ++  NP+ C++   I  +    +YFW   EG+YL T++V+A     + L++     GWGFPLI    +A  R      + CW + K+ +  I+  P   AL+ N+  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ +L       R  S I ++I  +++ +QG +++ I CF N EV+  +  +         ++       +RS S    S T+  G  S DGH +
Sbjct:   82 DGWLCWDDTAAGVTSEQHCPDYFQDFDPSEMVTKICTENGHWFLHPESNRTWTNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFFHFKSLSCQRITLHKNLFFSFVLNSVITIIWLT--AVANNQELVQRNPTSCKVSMFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY-YLLGWGFPLIPASIHAIAR-SYYYNDNCWISSKTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVPLLGIQYVLLPYKPGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQYNIQFGSSIGNHSDALRSASYTASSITEVQGCYSIDGHTE 453          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: calcr (calcitonin receptor [Source:NCBI gene;Acc:101174680])

HSP 1 Score: 169.474 bits (428), Expect = 6.775e-48
Identity = 114/344 (33.14%), Postives = 187/344 (54.36%), Query Frame = 2
Query:   65 QPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNINAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
             P  NK   FC   +D  +LCW  T  G+   QNCP+    F     A+K C  +G W+     NRTW+N+  C  N    + + YI F     G++LS+  + ISL IFFYF+ L C+R+ +HKNLF SYVLN A+T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +   +  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++F    E+R    + E++  +++ +Q      I+ F N +V+ A+
Sbjct:   48 DPPYNKSGPFCSRNWDG-WLCWEDTPAGTFAAQNCPNYFDDFDPTEKATKYCGEDGQWFRHPDTNRTWSNYTLCNENTKAKLKSAYILFYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFFSYVLNSALTIIYLVTVVNNPEVVARNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPVSIHAVARKKYFD-DNCWMSVETHLLYAVHGPIVAALLVNLFFLLNIIRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIFPWRPENRLAGEVYEYVMHILMHYQ-----VIIYFVNQKVQGAL 383          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: calcr (calcitonin receptor [Source:NCBI gene;Acc:101174680])

HSP 1 Score: 168.703 bits (426), Expect = 5.606e-46
Identity = 114/344 (33.14%), Postives = 187/344 (54.36%), Query Frame = 2
Query:   65 QPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPD-IPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPC-INKVPNINAVYIYF----AGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLN-AITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCW-TMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAI 1072
             P  NK   FC   +D  +LCW  T  G+   QNCP+    F     A+K C  +G W+     NRTW+N+  C  N    + + YI F     G++LS+  + ISL IFFYF+ L C+R+ +HKNLF SYVLN A+T +  + +++ P V+  NP  C++++    +    +YFW   EG+YL T++V+A     ++ L+     GWGFPL+    +A  R +    + CW ++++ +   +  P + AL+ NL  ++ I+++L+TKL      E   + K  RA  IL P+LGIQ ++F    E+R    + E++  +++ +Q      I+ F N +V+ A+
Sbjct:  322 DPPYNKSGPFCSRNWDG-WLCWEDTPAGTFAAQNCPNYFDDFDPTEKATKYCGEDGQWFRHPDTNRTWSNYTLCNENTKAKLKSAYILFYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFFSYVLNSALTIIYLVTVVNNPEVVARNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVF-AEEQHLHWYYLLGWGFPLVPVSIHAVARKKYFD-DNCWMSVETHLLYAVHGPIVAALLVNLFFLLNIIRVLVTKLRDTHRAESNMYMKAVRATLILVPLLGIQFVIFPWRPENRLAGEVYEYVMHILMHYQ-----VIIYFVNQKVQGAL 657          

HSP 2 Score: 51.2174 bits (121), Expect = 1.301e-6
Identity = 30/96 (31.25%), Postives = 45/96 (46.88%), Query Frame = 2
Query:   41 KLKNACLMQPIPNKVDIFCPPIFD----DLYLCWNFTKGGSKTYQNCPDI-PGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAV 313
            K  + C+M   P+K  +FC  +      D +LCW+ T  G   +QNCPD          A+K C  +G W+     N TWTN+  C++    +  V
Sbjct:  183 KTHSFCVM---PHKPVLFCAGLHCSRSWDGWLCWDNTPAGVYAFQNCPDYYSDLKPTEKAAKYCGEDGQWFRHPKSNMTWTNYTLCVDNNDRLRVV 275          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000006966.1 (SMESG000006966.1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 385/386 (99.74%), Postives = 385/386 (99.74%), Query Frame = 2
Query:   20 MDNFEREKLKNACLMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFTKSDGSFDGHIKGF 1177
            MDNFEREKLKNACLMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKMQNILIIPNIIALIANLVIVIVILKILLTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHN AATRRFQTVRSTSRRSFTKSDGSFDGHIKGF
Sbjct:    1 MDNFEREKLKNACLMQPIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKMQNILIIPNIIALIANLVIVIVILKILLTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNTAATRRFQTVRSTSRRSFTKSDGSFDGHIKGF 386          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000023013.1 (SMESG000023013.1)

HSP 1 Score: 358.221 bits (918), Expect = 1.094e-121
Identity = 185/354 (52.26%), Postives = 251/354 (70.90%), Query Frame = 2
Query:   92 FCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKMQXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFTKSDGS 1153
            +C    D L  CWN+TK G   +  CP +PGF+  A ASKKCEINGTWY     N  W+N+  C+   PN++ VY++FAGYSLSVLC++ISLFIFF FK+L+C+RV +HKNLF+ +++NAI W+ F  +IS   VM  NP +CQI++VI T+F+V +YFW FSEG+YLA +L++ F  G   LL +C+  GWG PLILT  Y   RY +E+PEKCWT  SKM  IL IPN++AL ANL+I++ ILK L+TKL HP NRE+ QW KTA+A+FIL P+LG+QNI+FF+  +++ V LIQ++  AV+ SFQG ++SFILCF N+EV+  I   A      Q +++T R ++T    S
Sbjct:   22 YCNATKDKLGTCWNYTKAGEIAFAPCPKLPGFNWNAEASKKCEINGTWYFSIEENNYWSNYSKCLQNKPNVSLVYVFFAGYSLSVLCLSISLFIFFVFKQLRCDRVTLHKNLFMCHLINAIIWINFYVVISNGDVMQRNPIHCQILFVIATYFSVGTYFWMFSEGIYLAVILILTFHKG-PILLTICIVTGWGLPLILTSIYVISRYLMEKPEKCWTEPSKMYLILAIPNVVALGANLLILLFILKTLVTKLSHPTNREETQWSKTAKAVFILIPLLGLQNIIFFIYPDNQEVRLIQDYSTAVLSSFQGVLVSFILCFFNHEVRTIIRRRACQHSLLQPLKTTRRGTYTTELAS 374          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000027375.1 (SMESG000027375.1)

HSP 1 Score: 249.595 bits (636), Expect = 2.423e-79
Identity = 123/354 (34.75%), Postives = 204/354 (57.63%), Query Frame = 2
Query:   86 DIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNIN--AVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKM-QXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFT 1138
            +++C P  D L   WN TK G  +Y  CP IPGF+  A A ++C ING+WYID +  + W+N+DPC+   PN+N   +YI+F G+S+S + +  SLFIF Y ++L+C R+ +HKNLF  Y+ NA+ W+    +   P  +  N ++C +I+++ ++F+ ++YFW  SEG+YLA VL+  F    K LL +C+  GW  P +    Y   +  LE+  + W  +SK+   + I   I       +I +++  ++    + P   + + W +T +++FIL  +LG+QN+ F     D+  SLI ++I+A++ SFQG  +S +LC  N E+K+         R+  +V S + R  T
Sbjct:    8 ELYCFPETDKLGTFWNITKAGKVSYSQCPKIPGFNPSAFAERQCTINGSWYIDNSTKQYWSNYDPCL--FPNVNQFTIYIFFIGHSISAIFLIFSLFIFHYLRELKCHRITLHKNLFTCYLGNAVFWLAVHGLSVHPNTIAQNSNFCLVIFILASYFSTATYFWMLSEGVYLAVVLLKTFVADFKYLLLVCMTIGWAVPGMFCFVYILCKMILEKHSRYWLEQSKLIYILQIPGIIALFANVAIIFLILKLLISKLKYPPSTLDDRHWGRTGKSVFILVLLLGVQNVFFLYQPTDKTSSLIHDYISAILTSFQGLFVSCLLCLNNKEIKITWKRRQITKRKLLSVSSVAHRRNT 359          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000027375.1 (SMESG000027375.1)

HSP 1 Score: 245.743 bits (626), Expect = 8.931e-78
Identity = 122/353 (34.56%), Postives = 202/353 (57.22%), Query Frame = 2
Query:   86 DIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNIN-AVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKM-QXXXXXXXXXXXXXXXXXXXXXXXXXXTKLWHPVNREQKQWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNAAATRRFQTVRSTSRRSFT 1138
            +++C P  D L   WN TK G  +Y  CP IPGF+  A A ++C ING+WYID +  + W+N+DPC+   PN    +YI+F G+S+S + +  SLFIF Y ++L+C R+ +HKNLF  Y+ NA+ W+    +   P  +  N ++C +I+++ ++F+ ++YFW  SEG+YLA VL+  F    K LL +C+  GW  P +    Y   +  LE+  + W  +SK+   + I   I       +I +++  ++    + P   + + W +T +++FIL  +LG+QN+ F     D+  SLI ++I+A++ SFQG  +S +LC  N E+K+         R+  +V S + R  T
Sbjct:    8 ELYCFPETDKLGTFWNITKAGKVSYSQCPKIPGFNPSAFAERQCTINGSWYIDNSTKQYWSNYDPCL--FPNNQFTIYIFFIGHSISAIFLIFSLFIFHYLRELKCHRITLHKNLFTCYLGNAVFWLAVHGLSVHPNTIAQNSNFCLVIFILASYFSTATYFWMLSEGVYLAVVLLKTFVADFKYLLLVCMTIGWAVPGMFCFVYILCKMILEKHSRYWLEQSKLIYILQIPGIIALFANVAIIFLILKLLISKLKYPPSTLDDRHWGRTGKSVFILVLLLGVQNVFFLYQPTDKTSSLIHDYISAILTSFQGLFVSCLLCLNNKEIKITWKRRQITKRKLLSVSSVAHRRNT 358          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000066855.1 (SMESG000066855.1)

HSP 1 Score: 161.384 bits (407), Expect = 3.093e-47
Identity = 83/233 (35.62%), Postives = 136/233 (58.37%), Query Frame = 2
Query:   23 DNFEREKL-KNACLMQ---PIPNKVDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWG----FPLILTIFY 697
            D+F+  +L + +C  Q   P P    ++C  I+D L LCWN+TK G    QNCP +  F+  A+A K C  +G W     +N+++T++  C+ K     ++YIYF GYS+S++ + ISL + FYFK+L C R+ +HKN+F   ++N+  W+ ++ ++S  +      S CQ +Y+IV +   ++YFW   EGLYL  +L+  F  G + ++  C+  GWG      L++TI Y
Sbjct:    6 DSFDYLELERTSCEAQMPPPPPTDGQLYCRAIYDGL-LCWNYTKAGLTVEQNCPALYDFNVSALAYKSCLPSGEWLTKGGVNQSYTDYMACVPKASY--SIYIYFVGYSMSIIALVISLAVLFYFKQLNCHRITLHKNMFFCNLMNSTGWLLYINVLSMHSNDSAVYSMCQALYLIVNYTGTATYFWMLCEGLYLLMILIFTFNKG-QFIVRFCIILGWGEFSILLLVVTISY 234          
The following BLAST results are available for this feature:
BLAST of Calcitonin receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALCRL8.629e-5132.47calcitonin receptor like receptor [Source:HGNC Sym... [more]
CALCRL8.629e-5132.47calcitonin receptor like receptor [Source:HGNC Sym... [more]
CALCRL8.629e-5132.47calcitonin receptor like receptor [Source:HGNC Sym... [more]
CALCR4.069e-4832.62calcitonin receptor [Source:HGNC Symbol;Acc:HGNC:1... [more]
CALCR4.069e-4832.62calcitonin receptor [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdfr-11.910e-2024.03Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.910e-2024.03Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-13.573e-2024.03Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-13.573e-2024.03Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-14.119e-2024.03Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hec2.019e-3631.28gene:FBgn0030437 transcript:FBtr0343652[more]
hec2.019e-3631.28gene:FBgn0030437 transcript:FBtr0073753[more]
Dh31-R6.198e-3633.63gene:FBgn0052843 transcript:FBtr0330735[more]
Dh31-R9.413e-3633.63gene:FBgn0052843 transcript:FBtr0087755[more]
Dh31-R4.601e-3533.63gene:FBgn0052843 transcript:FBtr0330736[more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calcr4.106e-5033.43calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr5.431e-4932.52calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr5.431e-4932.52calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr7.080e-4933.24calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
calcr7.080e-4933.24calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calcrl4.358e-4933.33calcitonin receptor like receptor [Source:NCBI gen... [more]
calcrl1.458e-4134.63calcitonin receptor like receptor [Source:NCBI gen... [more]
calcrl2.016e-4134.48calcitonin receptor like receptor [Source:NCBI gen... [more]
calcrl2.707e-4134.48calcitonin receptor like receptor [Source:NCBI gen... [more]
ccdc221.023e-3329.08coiled-coil domain containing 22 [Source:Xenbase;A... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calcr4.817e-4932.32calcitonin receptor [Source:MGI Symbol;Acc:MGI:101... [more]
Calcr4.817e-4932.32calcitonin receptor [Source:MGI Symbol;Acc:MGI:101... [more]
Calcr4.817e-4932.32calcitonin receptor [Source:MGI Symbol;Acc:MGI:101... [more]
Calcrl1.884e-4432.66calcitonin receptor-like [Source:MGI Symbol;Acc:MG... [more]
Calcrl1.884e-4432.66calcitonin receptor-like [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QP74|CALRL_BOVIN2.246e-5133.68Calcitonin gene-related peptide type 1 receptor OS... [more]
sp|Q8WN93|CALRL_PIG4.525e-5132.73Calcitonin gene-related peptide type 1 receptor OS... [more]
sp|Q16602|CALRL_HUMAN4.058e-5032.47Calcitonin gene-related peptide type 1 receptor OS... [more]
sp|Q0P4Y4|CALRL_XENTR2.309e-4833.33Calcitonin gene-related peptide type 1 receptor OS... [more]
sp|Q7ZXS8|CALRL_XENLA1.112e-4733.33Calcitonin gene-related peptide type 1 receptor OS... [more]
back to top
BLAST of Calcitonin receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7T7Q85.893e-6634.95Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A0K0PVL81.477e-6436.90DH31-like receptor 1 OS=Platynereis dumerilii OX=6... [more]
A0A513ZS131.604e-6335.94Calcitonin receptor 3 OS=Crassostrea gigas OX=2915... [more]
A0A3S0ZQZ12.075e-6034.67Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A210PI291.416e-5937.17Calcitonin receptor OS=Mizuhopecten yessoensis OX=... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calcr2.541e-5434.12calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ENSAMXT00000051776.18.838e-4534.15pep primary_assembly:Astyanax_mexicanus-2.0:13:448... [more]
ENSAMXT00000031305.12.354e-3733.00pep primary_assembly:Astyanax_mexicanus-2.0:19:230... [more]
pth1r2.335e-3429.43parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r3.632e-3429.43parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000542.18.843e-4833.94pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
pth1r1.615e-3829.44parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000004899.11.659e-3129.71pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000009958.11.642e-2929.80pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 ... [more]
ENSPMAT00000004243.15.186e-2125.67pep scaffold:Pmarinus_7.0:GL484465:15708:23345:-1 ... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345371.950e-1025.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443682.658e-1027.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308906.521e-1029.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324532.672e-927.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500183.060e-922.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calcr4.615e-5334.01calcitonin receptor [Source:NCBI gene;Acc:10117468... [more]
calcrla5.764e-5032.98calcitonin receptor like receptor [Source:NCBI gen... [more]
calcrla1.150e-4932.98calcitonin receptor like receptor [Source:NCBI gen... [more]
calcr6.775e-4833.14calcitonin receptor [Source:NCBI gene;Acc:10117468... [more]
calcr5.606e-4633.14calcitonin receptor [Source:NCBI gene;Acc:10117468... [more]
back to top
BLAST of Calcitonin receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006966.10.000e+099.74SMESG000006966.1[more]
SMESG000023013.11.094e-12152.26SMESG000023013.1[more]
SMESG000027375.12.423e-7934.75SMESG000027375.1[more]
SMESG000027375.18.931e-7834.56SMESG000027375.1[more]
SMESG000066855.13.093e-4735.62SMESG000066855.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000450 ID=SMED30000450|Name=Calcitonin receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1177bp
AATTTTAGTACTTTTAAAAATGGATAATTTTGAAAGAGAAAAGTTGAAGA
ATGCTTGTTTGATGCAACCGATCCCAAATAAAGTGGATATTTTCTGTCCA
CCTATATTTGATGATCTATATCTGTGTTGGAATTTCACAAAAGGTGGCTC
CAAAACCTATCAGAATTGTCCAGACATTCCAGGATTTAGTAAAGAAGCCA
TGGCATCAAAGAAGTGTGAAATAAATGGTACTTGGTACATAGATCAAGCC
CTAAATCGGACATGGACGAATTTTGACCCGTGTATCAATAAAGTGCCAAA
TATAAATGCCGTTTATATATATTTTGCTGGATATTCGCTATCAGTTCTCT
GTATGGCTATTTCATTATTCATATTTTTTTATTTTAAAAAATTACAATGT
GAAAGAGTTTTTATTCACAAAAATCTATTCATAAGCTACGTTCTTAATGC
TATAACCTGGATGACATTTCTTGCAATTATTTCGAAACCCACAGTAATGG
TCCACAATCCTAGTTATTGCCAAATAATTTATGTCATTGTTACATTTTTC
AATGTATCTTCCTATTTTTGGACATTTTCAGAAGGTCTTTATTTGGCCAC
AGTTTTAGTTATGGCTTTTCAGGATGGTTCAAAGAAATTGTTGTACTTGT
GCGTCTTTTTTGGATGGGGTTTCCCACTTATTCTTACAATTTTTTACGCT
TCACTTCGATATCAACTTGAACAACCTGAAAAATGTTGGACAATGAAGTC
AAAGATGCAAAATATTCTTATTATACCAAATATCATCGCTCTCATAGCTA
ATTTGGTCATTGTTATCGTCATATTGAAAATTTTACTTACAAAATTGTGG
CATCCAGTAAATCGTGAACAGAAACAATGGAGAAAAACCGCTCGAGCTAT
ATTTATTTTATTTCCAGTTTTGGGAATTCAAAATATTTTATTTTTCATGT
CCTCAGAAGATCGCAACGTATCATTGATACAAGAATTTATAGCTGCTGTT
ATCATTTCTTTTCAGGGCACAGTTATGTCATTCATTCTTTGTTTTTGTAA
TAATGAAGTAAAAGTTGCCATTTTACATAATGCAGCTGCTACAAGAAGAT
TTCAGACCGTTCGCAGTACAAGTCGTCGTTCTTTTACAAAATCTGATGGA
AGTTTTGATGGACATATAAAAGGATTT
back to top

protein sequence of SMED30000450-orf-1

>SMED30000450-orf-1 ID=SMED30000450-orf-1|Name=SMED30000450-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
ILVLLKMDNFEREKLKNACLMQPIPNKVDIFCPPIFDDLYLCWNFTKGGS
KTYQNCPDIPGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCINKVPN
INAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNA
ITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLAT
VLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKS
KMQNILIIPNIIALIANLVIVIVILKILLTKLWHPVNREQKQWRKTARAI
FILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCN
NEVKVAILHNAAATRRFQTVRSTSRRSFTKSDGSFDGHIKGF
back to top
Aliases
The feature 'Calcitonin receptor' has the following synonyms
Synonym
crf-r
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000420parapharyngeal region
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR000832GPCR_2_secretin-like
IPR001879GPCR_2_extracellular_dom
IPR017983GPCR_2_secretin-like_CS
IPR017981GPCR_2-like
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0004948calcitonin receptor activity
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 105..129
score: 30.64
coord: 175..198
score: 35.03
coord: 254..279
score: 29.73
coord: 296..316
score: 34.46
coord: 328..349
score: 32.67
coord: 137..161
score: 33.15
coord: 214..239
score: 28.49
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 103..341
e-value: 7.6E-48
score: 162.9
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 28..103
e-value: 0.0024
score: 27.0
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 31..95
e-value: 4.9E-8
score: 33.1
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 18..98
score: 13.751
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 5..98
e-value: 1.5E-19
score: 72.1
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 14..111
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 101..384
e-value: 1.6E-59
score: 203.4
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 11..380
NoneNo IPR availablePANTHERPTHR45620:SF31DIURETIC HORMONE 31 RECEPTOR, ISOFORM Ccoord: 11..380
NoneNo IPR availableCDDcd152607tmB1_NPR_B4_insect-likecoord: 104..357
e-value: 1.55626E-72
score: 225.615
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 94..359
NoneNo IPR availableTMHMMTMhelixcoord: 141..160
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 255..277
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 297..316
NoneNo IPR availableTMHMMTMhelixcoord: 175..192
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00649G_PROTEIN_RECEP_F2_1coord: 32..57
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 103..350
score: 33.268