DNA-binding protein SATB1

Overview
NameDNA-binding protein SATB1
Smed IDSMED30000446
Length (bp)2401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-binding protein SATB1 (SMED30000446) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-binding protein SATB1 (SMED30000446) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-binding protein SATB1 (SMED30000446) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-binding protein SATB1 (SMED30000446) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000446

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000446h1SMcG0006288 dd_Smed_v4_10184_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30000446h1SMcG0006288 dd_Smed_v4_10184_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000446h1SMcG0006288 dd_Smed_v4_10184_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000446h1SMcG0006288 dd_Smed_v4_10184_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000446h1SMcG0006288 dd_Smed_v6_10184_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000446h1SMcG0006288 OX_Smed_1.0.14220ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-binding protein SATB1 vs. Ensembl Celegans
Match: dve-1 (pep chromosome:WBcel235:X:427112:433799:-1 gene:WBGene00022861.1 transcript:ZK1193.5e.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dve-1)

HSP 1 Score: 73.559 bits (179), Expect = 2.268e-13
Identity = 73/292 (25.00%), Postives = 122/292 (41.78%), Query Frame = 1
Query: 1519 DLKQLEEWFKENPRPSREKFQHYAIELNRR-HQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDI------PNPLTDS------------ETMPNFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSN 2337
            ++ +L++WFK +  PS++K  +Y  +LN+   + N+SK    +  + I  WF   R++ + +  +            L Q  S   ++   P       +N  Q              R+  D    ++   +   S S +   +   +NSD   QD +      P P  DS            E++ +   K+ S  D       +    S         R+R+  DP TE+  LE+WF+   +P  +QI+ YT  LN   YR+N +  +   NV +WFKNRRA+ KR  N
Sbjct:  190 EIPRLDKWFKSDANPSKQKMNNYLSQLNQSPFRKNNSK----ISYQQICNWFTQKRSSSRTLAPVD-----------LVQVSSAQTAAQLLP----GFQLNLLQSLFGE--------QRQKFDFYDKLDETKIVGGSDSPSPADDEIHSNSDETIQDTLFSINIKPEPEIDSIASSPDMANSMRESLSSTSPKLLSGLDLGAFSTHSSSTNSMQNANSSAARSRLMFDPLTELPVLEKWFEENPHPTWMQIDQYTQCLNNCAYREN-YPHISQHNVKIWFKNRRAKCKRLLN 453          
BLAST of DNA-binding protein SATB1 vs. Ensembl Celegans
Match: dve-1 (pep chromosome:WBcel235:X:427061:433799:-1 gene:WBGene00022861.1 transcript:ZK1193.5e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dve-1)

HSP 1 Score: 73.559 bits (179), Expect = 2.268e-13
Identity = 73/292 (25.00%), Postives = 122/292 (41.78%), Query Frame = 1
Query: 1519 DLKQLEEWFKENPRPSREKFQHYAIELNRR-HQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDI------PNPLTDS------------ETMPNFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSN 2337
            ++ +L++WFK +  PS++K  +Y  +LN+   + N+SK    +  + I  WF   R++ + +  +            L Q  S   ++   P       +N  Q              R+  D    ++   +   S S +   +   +NSD   QD +      P P  DS            E++ +   K+ S  D       +    S         R+R+  DP TE+  LE+WF+   +P  +QI+ YT  LN   YR+N +  +   NV +WFKNRRA+ KR  N
Sbjct:  190 EIPRLDKWFKSDANPSKQKMNNYLSQLNQSPFRKNNSK----ISYQQICNWFTQKRSSSRTLAPVD-----------LVQVSSAQTAAQLLP----GFQLNLLQSLFGE--------QRQKFDFYDKLDETKIVGGSDSPSPADDEIHSNSDETIQDTLFSINIKPEPEIDSIASSPDMANSMRESLSSTSPKLLSGLDLGAFSTHSSSTNSMQNANSSAARSRLMFDPLTELPVLEKWFEENPHPTWMQIDQYTQCLNNCAYREN-YPHISQHNVKIWFKNRRAKCKRLLN 453          
BLAST of DNA-binding protein SATB1 vs. Ensembl Celegans
Match: dve-1 (pep chromosome:WBcel235:X:427112:429414:-1 gene:WBGene00022861.1 transcript:ZK1193.5c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dve-1)

HSP 1 Score: 69.707 bits (169), Expect = 8.853e-13
Identity = 32/71 (45.07%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2125 RARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSN 2337
            R+R+  DP TE+  LE+WF+   +P  +QI+ YT  LN   YR+N +  +   NV +WFKNRRA+ KR  N
Sbjct:  179 RSRLMFDPLTELPVLEKWFEENPHPTWMQIDQYTQCLNNCAYREN-YPHISQHNVKIWFKNRRAKCKRLLN 248          
BLAST of DNA-binding protein SATB1 vs. Ensembl Celegans
Match: dve-1 (pep chromosome:WBcel235:X:427061:429414:-1 gene:WBGene00022861.1 transcript:ZK1193.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dve-1)

HSP 1 Score: 69.707 bits (169), Expect = 8.853e-13
Identity = 32/71 (45.07%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2125 RARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSN 2337
            R+R+  DP TE+  LE+WF+   +P  +QI+ YT  LN   YR+N +  +   NV +WFKNRRA+ KR  N
Sbjct:  179 RSRLMFDPLTELPVLEKWFEENPHPTWMQIDQYTQCLNNCAYREN-YPHISQHNVKIWFKNRRAKCKRLLN 248          
BLAST of DNA-binding protein SATB1 vs. Ensembl Celegans
Match: dve-1 (pep chromosome:WBcel235:X:427112:429414:-1 gene:WBGene00022861.1 transcript:ZK1193.5d.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dve-1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.456e-12
Identity = 32/71 (45.07%), Postives = 45/71 (63.38%), Query Frame = 1
Query: 2125 RARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSN 2337
            R+R+  DP TE+  LE+WF+   +P  +QI+ YT  LN   YR+N +  +   NV +WFKNRRA+ KR  N
Sbjct:  176 RSRLMFDPLTELPVLEKWFEENPHPTWMQIDQYTQCLNNCAYREN-YPHISQHNVKIWFKNRRAKCKRLLN 245          
BLAST of DNA-binding protein SATB1 vs. Ensembl Fly
Match: dve (gene:FBgn0020307 transcript:FBtr0071775)

HSP 1 Score: 76.2554 bits (186), Expect = 8.918e-14
Identity = 37/70 (52.86%), Postives = 45/70 (64.29%), Query Frame = 1
Query: 2119 KRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKR 2328
            ++R R F+DP TEV KLEQWF +  +P    I  YT  LN  PYRQ  F +L  +NV  WFKNRRA+ KR
Sbjct:  928 RKRNRTFIDPVTEVPKLEQWFAMNTHPSHNLILKYTEDLNTMPYRQK-FPRLESKNVQFWFKNRRAKCKR 996          

HSP 2 Score: 68.1662 bits (165), Expect = 2.458e-11
Identity = 32/73 (43.84%), Postives = 47/73 (64.38%), Query Frame = 1
Query: 1483 RKVRNRVTFVVE-DLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKR 1698
            +K R R +F  E +L +L++WF +NP PSR++ Q Y ++LN        + ++ L   N+VYWFKNARAA KR
Sbjct:  555 QKTRMRTSFDPEMELPKLQKWFADNPHPSRQQIQTYVVQLNALESR---RGRKPLDVNNVVYWFKNARAAQKR 624          
BLAST of DNA-binding protein SATB1 vs. Ensembl Fly
Match: dve (gene:FBgn0020307 transcript:FBtr0071776)

HSP 1 Score: 75.485 bits (184), Expect = 1.214e-13
Identity = 37/70 (52.86%), Postives = 45/70 (64.29%), Query Frame = 1
Query: 2119 KRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKR 2328
            ++R R F+DP TEV KLEQWF +  +P    I  YT  LN  PYRQ  F +L  +NV  WFKNRRA+ KR
Sbjct:  684 RKRNRTFIDPVTEVPKLEQWFAMNTHPSHNLILKYTEDLNTMPYRQK-FPRLESKNVQFWFKNRRAKCKR 752          

HSP 2 Score: 67.781 bits (164), Expect = 2.911e-11
Identity = 32/73 (43.84%), Postives = 47/73 (64.38%), Query Frame = 1
Query: 1483 RKVRNRVTFVVE-DLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKR 1698
            +K R R +F  E +L +L++WF +NP PSR++ Q Y ++LN        + ++ L   N+VYWFKNARAA KR
Sbjct:  311 QKTRMRTSFDPEMELPKLQKWFADNPHPSRQQIQTYVVQLNALESR---RGRKPLDVNNVVYWFKNARAAQKR 380          
BLAST of DNA-binding protein SATB1 vs. TrEMBL
Match: A0A443SN98 (Uncharacterized protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_08524 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.960e-26
Identity = 111/334 (33.23%), Postives = 153/334 (45.81%), Query Frame = 1
Query: 1486 KVRNRVTFVVE-DLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVI------SPFA---TGELKSSRLPQTKSTDPSSIDNPESSNDHNI--NFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIK-ESTSANSDSEHQDDIPNPLTDSETM---PNFRTK---------IDSLEDNNYRIKDTKICKSSL----TFRGGK----------------------RRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCS 2334
            + R R +F  E +L +L +WF EN  PSR + Q Y  ELN     +  K +++L   N+VYWFKNARAA+KR  +       SP      G   S    Q  S   +  D  ESS  H+   N   E  D  + D EY+  + +D ++S  +  L      +  +K ES S  S          P    ET     NF+ K         ++ ++D++Y  ++T +   S     T  G +                      RR+R F+DP TEV +LEQWF V  +P   QI  YT  LN  PYRQ  F KL P+N+  WFKNRRA+ KR S
Sbjct:  124 RTRIRTSFDPELELPKLHKWFAENQHPSRAQIQQYVKELNAL---DSRKGRKLLDVNNVVYWFKNARAAHKRQELKFVNGSHSPPVDNNGGNQFSVNSTQEMSDTKNQRDGSESSGKHSHEENGHNEDGDD-SGDHEYSGAEGIDDDSSQMSQTLDLSVRPVKRLKSESLSPCS----------PQVGLETGRYSSNFQIKDEQTDEDDDLNEIDDHDYYSENTPVGSESAFPGSTPNGNRFYSNNGNSLLPQPDSPEEGRRIRRSRTFIDPMTEVPRLEQWFAVNTHPTHSQIVKYTEELNNLPYRQK-FPKLEPKNIQFWFKNRRAKYKRLS 442          
BLAST of DNA-binding protein SATB1 vs. TrEMBL
Match: A0A195CAP7 (DNA-binding protein SATB1 OS=Cyphomyrmex costatus OX=456900 GN=ALC62_12004 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.216e-25
Identity = 99/297 (33.33%), Postives = 139/297 (46.80%), Query Frame = 1
Query: 1486 KVRNRVTFVVE-DLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMT---------------VISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMPNFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKR 2328
            K R R +F  E +L +L+ WF EN  PSRE+ QHY  ELN        + ++ L A N+VYWFKNARAA KR +               ++S   T E + +R  Q+ S  P   ++P           ++    PTS     T  SV           +QE   ++    S S + ++ H   IP P       P F   I  +  +    +    C +S+     ++R R F+DP TEV +LE WF+   +P    I +YT  LN  PYRQ  F +L P+NV  WFKNRRA+ KR
Sbjct:  245 KTRMRTSFDSELELPRLQRWFAENQHPSREQIQHYVAELNSLESR---RGRKPLDANNVVYWFKNARAAQKRASMNGCSPPGLSPRGASIVSEDCTDEEEDTRH-QSTSGSPCPPNSPPVGPLSLTTRPEDQQQPPTS-----TPSSV-----------KQEDARVS----SGSEDDETRHTGPIP-PGFSLVPSPMFGHGIMYM-SHYLPPRGPAGCPTSMLADERRKRNRTFIDPVTEVPRLEYWFKRSTHPSHALILSYTEELNKMPYRQK-FPRLEPKNVQFWFKNRRAKNKR 514          
BLAST of DNA-binding protein SATB1 vs. TrEMBL
Match: E2BXT8 (DNA-binding protein SATB1 OS=Harpegnathos saltator OX=610380 GN=EAI_12450 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.491e-25
Identity = 97/290 (33.45%), Postives = 137/290 (47.24%), Query Frame = 1
Query: 1486 KVRNRVTFVVE-DLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSE--------YTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMPNFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKR 2328
            K R R +F  E +L +L+ WF EN  PSRE+ QHY  ELN     +  + ++ L A N+VYWFKNARAA KR ++          +   P   S   +SI + E   D   + +Q+S                  TTR       S     ++QE   ++    S S + ++ H   IP P       P F   I  +  +    +    C +S+     ++R R F+DP TEV +LE WF+   +P    I +YT  LN  PYRQ  F +L P+NV  WFKNRRA+ KR
Sbjct:  244 KTRMRTSFDSELELPRLQRWFAENQHPSREQIQHYVAELNSL---DSRRGRKPLDANNVVYWFKNARAAQKRASM----------NGCSPPGLSPRGASIVS-EDCTDEEDDIRQQSTSGSPCPPSSPPVGPLSLTTRPEDQQPPSSTPSSVKQEDARVS----SGSEDDEARHTGPIP-PGFSLVPSPMFGHGIMYM-SHYLPPRGPAGCPTSMLADERRKRNRTFIDPVTEVPRLEYWFKRSTHPSHALILSYTEELNKMPYRQK-FPRLEPKNVQFWFKNRRAKNKR 512          
BLAST of DNA-binding protein SATB1 vs. TrEMBL
Match: A0A026WZ43 (DNA-binding protein SATB1 OS=Ooceraea biroi OX=2015173 GN=X777_12009 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 7.678e-25
Identity = 97/286 (33.92%), Postives = 134/286 (46.85%), Query Frame = 1
Query: 1486 KVRNRVTFVVE-DLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKR--MTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENV--FLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMPNFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKR 2328
            K R R +F  E +L +L+ WF EN  PSRE+ QHY  ELN        + ++ L A N+VYWFKNARAA KR  M   SP       S R     S D    D  E +   + +        P       T +  D +    +    ++QE   ++    S S + ++ H   IP P       P F   I  +  +    +    C +S+     ++R R F+DP TEV +LE WF+   +P    I +YT  LN  PYRQ  F +L P+NV  WFKNRRA+ KR
Sbjct:  193 KTRMRTSFDSELELPRLQRWFAENQHPSREQIQHYVAELNSLESR---RGRKPLDANNVVYWFKNARAAQKRASMNGCSPPGL----SPRGASIVSED--CTDEEEDTRQQSTSGSPCPPSSPPVGPLSLTTRPEDQQQPPPSTPSSVKQEDARVS----SGSEDDETRHTGPIP-PGFSLVPSPMFGHGIMYM-SHYLPPRGPAGCPTSMLADERRKRNRTFIDPVTEVPRLEYWFKRSTHPSHALILSYTEELNKMPYRQK-FPRLEPKNVQFWFKNRRAKNKR 462          
BLAST of DNA-binding protein SATB1 vs. TrEMBL
Match: A0A3L8D2P8 (Uncharacterized protein OS=Ooceraea biroi OX=2015173 GN=DMN91_012664 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.054e-24
Identity = 97/286 (33.92%), Postives = 134/286 (46.85%), Query Frame = 1
Query: 1486 KVRNRVTFVVE-DLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKR--MTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENV--FLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMPNFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKR 2328
            K R R +F  E +L +L+ WF EN  PSRE+ QHY  ELN        + ++ L A N+VYWFKNARAA KR  M   SP       S R     S D    D  E +   + +        P       T +  D +    +    ++QE   ++    S S + ++ H   IP P       P F   I  +  +    +    C +S+     ++R R F+DP TEV +LE WF+   +P    I +YT  LN  PYRQ  F +L P+NV  WFKNRRA+ KR
Sbjct:  341 KTRMRTSFDSELELPRLQRWFAENQHPSREQIQHYVAELNSLESR---RGRKPLDANNVVYWFKNARAAQKRASMNGCSPPGL----SPRGASIVSED--CTDEEEDTRQQSTSGSPCPPSSPPVGPLSLTTRPEDQQQPPPSTPSSVKQEDARVS----SGSEDDETRHTGPIP-PGFSLVPSPMFGHGIMYM-SHYLPPRGPAGCPTSMLADERRKRNRTFIDPVTEVPRLEYWFKRSTHPSHALILSYTEELNKMPYRQK-FPRLEPKNVQFWFKNRRAKNKR 610          
BLAST of DNA-binding protein SATB1 vs. Planmine SMEST
Match: SMESG000001288.1 (SMESG000001288.1)

HSP 1 Score: 1381.31 bits (3574), Expect = 0.000e+0
Identity = 670/672 (99.70%), Postives = 671/672 (99.85%), Query Frame = 1
Query:  346 MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEVFGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMP-NFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN 2358
            MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEVFGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMP +FRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN
Sbjct:    1 MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEVFGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMPTDFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN 672          
BLAST of DNA-binding protein SATB1 vs. Planmine SMEST
Match: SMESG000010119.1 (SMESG000010119.1)

HSP 1 Score: 1379 bits (3568), Expect = 0.000e+0
Identity = 669/672 (99.55%), Postives = 671/672 (99.85%), Query Frame = 1
Query:  346 MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEVFGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMP-NFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN 2358
            MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEVFGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPF+DQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMP +FRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN
Sbjct:    1 MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEVFGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFNDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMPTDFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN 672          
BLAST of DNA-binding protein SATB1 vs. Planmine SMEST
Match: SMESG000001288.1 (SMESG000001288.1)

HSP 1 Score: 1367.83 bits (3539), Expect = 0.000e+0
Identity = 669/687 (97.38%), Postives = 670/687 (97.53%), Query Frame = 1
Query:  346 MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEV---------------FGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMP-NFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN 2358
            MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEV                GLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMP +FRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN
Sbjct:    1 MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNMSSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLLTELGCIIDPSLAQVEVCKFQEYQMKYFHVFLVGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLLNYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLLKTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLNGIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSIDKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSSEASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWFKENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYKRMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHPTSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIPNPLTDSETMPTDFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLDPTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTLWFKNRRARLKRCSNVTTQMSN 687          
The following BLAST results are available for this feature:
BLAST of DNA-binding protein SATB1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dve-12.268e-1325.00pep chromosome:WBcel235:X:427112:433799:-1 gene:WB... [more]
dve-12.268e-1325.00pep chromosome:WBcel235:X:427061:433799:-1 gene:WB... [more]
dve-18.853e-1345.07pep chromosome:WBcel235:X:427112:429414:-1 gene:WB... [more]
dve-18.853e-1345.07pep chromosome:WBcel235:X:427061:429414:-1 gene:WB... [more]
dve-11.456e-1245.07pep chromosome:WBcel235:X:427112:429414:-1 gene:WB... [more]
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dve8.918e-1452.86gene:FBgn0020307 transcript:FBtr0071775[more]
dve1.214e-1352.86gene:FBgn0020307 transcript:FBtr0071776[more]
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SN981.960e-2633.23Uncharacterized protein OS=Leptotrombidium deliens... [more]
A0A195CAP72.216e-2533.33DNA-binding protein SATB1 OS=Cyphomyrmex costatus ... [more]
E2BXT84.491e-2533.45DNA-binding protein SATB1 OS=Harpegnathos saltator... [more]
A0A026WZ437.678e-2533.92DNA-binding protein SATB1 OS=Ooceraea biroi OX=201... [more]
A0A3L8D2P82.054e-2433.92Uncharacterized protein OS=Ooceraea biroi OX=20151... [more]
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-binding protein SATB1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000001288.10.000e+099.70SMESG000001288.1[more]
SMESG000010119.10.000e+099.55SMESG000010119.1[more]
SMESG000001288.10.000e+097.38SMESG000001288.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000446 ID=SMED30000446|Name=DNA-binding protein SATB1|organism=Schmidtea mediterranea sexual|type=transcript|length=2401bp
ATTTAAATGACTAAGAAACACACAAACACATTAAGCATGGATAGGGCAAT
GAGAGCAGATTAATCACAAAGAAAGCAATGCCCTTTTTAAACAAGGGTTG
AGATCTTTAGTAAGCAGAGAGAAAAAGCAGTAAGAGAGATTTTACAGGGG
AAGGATTTCTTGTCCTATTCATCAGATAACACTATCGATTTACTGCAATT
CTAGGTAGGATTTATTAGAGATTAGCGACTAGCAGCTTTGCATGCTGTTG
GCTAAATGCTAATTCGTCGTGCATTTGTCAGCTTGGCATGGAGATAAGAC
TGGCTAATCTAGTCGTATTGTTACTCTGCTCGCAACAAATCGTCAATGAA
TCCTGACAGCTATTTGTTTTATTCTTCAACTGGTTGCAACTTTAGTTTGA
TTCCACCTAAGCCGAAGATACCTGTTCTCACAGTTAGAAGAGAAATGTAC
CCTTTCAGATTTAATGACAATTCTTCAAAATCTCACGGAAATATGTCAAG
TGGATTGAAACAAAATGAAAAATTTAGTCTTGAAGTTGAAATTCAGTTCG
TACGGGAAAGTGATAAATCAACAATTAATACAATAAGACGACGAGCGGTA
GTTGATCACAGGCTTACTTTAGCTGATTTGCCAGCTCAGCTTCTAACTGA
ACTTGGTTGCATCATTGATCCGTCATTAGCTCAAGTTGAAGTGTTTGGTC
TTCGTTTGTTAGATTGGTCTTGTTTAATTCCTCTCGATGTTGTTTCAGAA
GATTTGACTTCATCTACAGTCGGTGACAAACTAAGTGTGTTACTAAATTA
CTTACTATTCTTTTATCGTGTGTCAATAAAAACTTGCCACGAAATTACAT
CGGTCGAGGTTTGGTCAATAATTGGTGATCTAGTCAAAAGGTATACGGCA
GAAGGAGCATATCACCGACTCAAACAAATGAACTGTCCGCTTCTTAAAAC
AAACAGCACTATATTTTATGAGTTTCTCTTTCAAAGTGCTTCTATAAACC
TCGAAAGTTTGGATCAAGTTTATCAGCTGTCATTTCTCGACACCTTTTCA
TTTGACAATTGGTATCGGTCATTTCCTATTAATCAGTTTCTCAATGGAAT
TAAATCTCTTCAAAGCAATTTATTTTCTCAACATTCTTTGGATTCTACTG
TGAACTCGGCAGCCTTCGAAAAATTGACTAGCAGTCTGAATGAAGTCCTT
AGACAGAAGAACTCAATTAATCTCGACATTTCTCAATCTTCCATTGACAA
GTCATGCGATTCAATAATACAAGAAGCACTGATGAAAATGAAATCGGATT
CTAATTCTTTTCCAATATCAGAAAATAATTGCTGTATTGAATCAACAAGA
AATGGATTCGGAGATGAACCTTTCAGTGACCAGAAAACATCGTCAGAAGC
AAGTTCTTCGTTTCCCATCAATCAATTCAAAACATTAGATTGCGGGCAAC
CTCAGATTCAAGAAGGTCAAAAAGCGGAGAAAAGAAAAGTTCGAAATCGA
GTAACGTTTGTCGTGGAAGACCTAAAACAACTAGAAGAATGGTTCAAAGA
AAATCCCCGTCCTTCGAGGGAAAAATTCCAGCACTATGCCATTGAATTAA
ATAGACGGCATCAGAATAATCACAGCAAAGCTAAACGGATTCTTCATGCT
AGGAATATAGTATATTGGTTCAAAAATGCTCGGGCAGCTTATAAACGCAT
GACCGTGATTAGTCCTTTTGCAACCGGAGAGCTGAAAAGTTCAAGGTTGC
CACAGACTAAATCCACTGATCCAAGTTCAATAGATAATCCAGAAAGCTCC
AACGATCATAATATAAATTTTAAGCAAGAAAGTATAGATCATCCAACTAG
TGATTCAGAGTACACCACTAGAAAATCTGTCGATTCAGAAGCGTCAATGG
AAAATGTATTTTTACAACAAGAATCGGGAAGTTTAACGGATATTAAAGAG
TCTACAAGCGCAAACTCGGATTCAGAACATCAAGATGACATTCCGAATCC
GCTTACGGATTCAGAAACAATGCCGAATTTCAGAACCAAAATCGATTCTT
TAGAAGATAACAATTATCGAATTAAAGACACAAAAATTTGCAAATCATCT
TTAACATTTAGAGGGGGCAAAAGACGAGCCAGAATATTTTTGGATCCTAC
TACCGAAGTCAATAAACTTGAGCAATGGTTTCAAGTGGAAAAGTATCCGG
ATATAATACAAATTGAAAATTATACAAATATTTTGAATATGAGTCCTTAT
CGACAAAATCATTTTCGAAAATTAGTTCCCGAAAATGTCACACTCTGGTT
CAAAAACCGAAGAGCGAGGTTGAAAAGATGTAGCAATGTTACGACGCAAA
TGAGTAATTGAAAGCAAAATGGTAGATACTTGAAAATGTAGAAAATCATG
T
back to top

protein sequence of SMED30000446-orf-1

>SMED30000446-orf-1 ID=SMED30000446-orf-1|Name=SMED30000446-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=672bp
MNPDSYLFYSSTGCNFSLIPPKPKIPVLTVRREMYPFRFNDNSSKSHGNM
SSGLKQNEKFSLEVEIQFVRESDKSTINTIRRRAVVDHRLTLADLPAQLL
TELGCIIDPSLAQVEVFGLRLLDWSCLIPLDVVSEDLTSSTVGDKLSVLL
NYLLFFYRVSIKTCHEITSVEVWSIIGDLVKRYTAEGAYHRLKQMNCPLL
KTNSTIFYEFLFQSASINLESLDQVYQLSFLDTFSFDNWYRSFPINQFLN
GIKSLQSNLFSQHSLDSTVNSAAFEKLTSSLNEVLRQKNSINLDISQSSI
DKSCDSIIQEALMKMKSDSNSFPISENNCCIESTRNGFGDEPFSDQKTSS
EASSSFPINQFKTLDCGQPQIQEGQKAEKRKVRNRVTFVVEDLKQLEEWF
KENPRPSREKFQHYAIELNRRHQNNHSKAKRILHARNIVYWFKNARAAYK
RMTVISPFATGELKSSRLPQTKSTDPSSIDNPESSNDHNINFKQESIDHP
TSDSEYTTRKSVDSEASMENVFLQQESGSLTDIKESTSANSDSEHQDDIP
NPLTDSETMPNFRTKIDSLEDNNYRIKDTKICKSSLTFRGGKRRARIFLD
PTTEVNKLEQWFQVEKYPDIIQIENYTNILNMSPYRQNHFRKLVPENVTL
WFKNRRARLKRCSNVTTQMSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006338chromatin remodeling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR039673SATB1/SATB2
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 381..456
e-value: 1.0E-8
score: 45.0
coord: 592..666
e-value: 1.2E-9
score: 48.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 383..451
e-value: 4.8E-7
score: 29.5
coord: 603..661
e-value: 2.4E-6
score: 27.3
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 591..662
score: 11.548
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 379..452
score: 13.491
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 593..661
e-value: 1.80936E-8
score: 49.1641
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 383..452
e-value: 3.32316E-9
score: 51.0901
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 362..452
e-value: 1.9E-10
score: 42.6
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 592..664
e-value: 3.8E-11
score: 44.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 513..560
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..560
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..491
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 492..512
NoneNo IPR availablePANTHERPTHR15116:SF16DEFECTIVE PROVENTRICULUS, ISOFORM Acoord: 593..666
NoneNo IPR availablePANTHERPTHR15116:SF16DEFECTIVE PROVENTRICULUS, ISOFORM Acoord: 235..547
IPR039673DNA-binding protein SATB1/SATB2PANTHERPTHR15116FAMILY NOT NAMEDcoord: 235..547
coord: 593..666
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 593..664
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 383..454